Transient receptor potential cation channel subfamily M member

Overview
NameTransient receptor potential cation channel subfamily M member
Smed IDSMED30008055
Length (bp)2675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member (SMED30008055) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30008055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member (SMED30008055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30008055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30008055SMESG000068518.1 dd_Smed_v4_10717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008055SMESG000068518.1 dd_Smed_v4_10717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008055SMESG000068518.1 dd_Smed_v4_10717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008055SMESG000068518.1 dd_Smed_v4_10717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 110.538 bits (275), Expect = 6.241e-24
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  868 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1148          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 109.768 bits (273), Expect = 1.252e-23
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  730 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1010          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 109.768 bits (273), Expect = 1.252e-23
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  730 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1010          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 109.768 bits (273), Expect = 1.328e-23
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  727 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1007          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 109.768 bits (273), Expect = 1.328e-23
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  727 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1007          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 77.411 bits (189), Expect = 4.154e-14
Identity = 64/299 (21.40%), Postives = 133/299 (44.48%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF-------FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEY 2284
             P   F+  +    +F+  F+Y L++      +VIE +   Y   + +E+ R+I +   K F   +++Y     N + I A  F + GF +R    +                       R+IL    +L+ M+++ + S+  ++GP + M   MI +++  +I + VV + SFG+  Q++ YP+  +     ++   K    + G+++     T     +  + +E+       N    ++          L+  ++++ NI+LM++LIA+F++      + S + W   RYK + EY
Sbjct:  899 APISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSV--------------------AYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMI-QNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWD-QHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1175          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 76.6406 bits (187), Expect = 6.539e-14
Identity = 64/299 (21.40%), Postives = 133/299 (44.48%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF-------FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEY 2284
             P   F+  +    +F+  F+Y L++      +VIE +   Y   + +E+ R+I +   K F   +++Y     N + I A  F + GF +R    +                       R+IL    +L+ M+++ + S+  ++GP + M   MI +++  +I + VV + SFG+  Q++ YP+  +     ++   K    + G+++     T     +  + +E+       N    ++          L+  ++++ NI+LM++LIA+F++      + S + W   RYK + EY
Sbjct: 1204 APISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSV--------------------AYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMI-QNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWD-QHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1480          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 76.6406 bits (187), Expect = 6.773e-14
Identity = 64/299 (21.40%), Postives = 133/299 (44.48%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF-------FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEY 2284
             P   F+  +    +F+  F+Y L++      +VIE +   Y   + +E+ R+I +   K F   +++Y     N + I A  F + GF +R    +                       R+IL    +L+ M+++ + S+  ++GP + M   MI +++  +I + VV + SFG+  Q++ YP+  +     ++   K    + G+++     T     +  + +E+       N    ++          L+  ++++ NI+LM++LIA+F++      + S + W   RYK + EY
Sbjct: 1305 APISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSV--------------------AYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMI-QNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWD-QHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1581          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 76.6406 bits (187), Expect = 7.146e-14
Identity = 64/299 (21.40%), Postives = 133/299 (44.48%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF-------FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEY 2284
             P   F+  +    +F+  F+Y L++      +VIE +   Y   + +E+ R+I +   K F   +++Y     N + I A  F + GF +R    +                       R+IL    +L+ M+++ + S+  ++GP + M   MI +++  +I + VV + SFG+  Q++ YP+  +     ++   K    + G+++     T     +  + +E+       N    ++          L+  ++++ NI+LM++LIA+F++      + S + W   RYK + EY
Sbjct: 1244 APISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSV--------------------AYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMI-QNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWD-QHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1520          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 68.9366 bits (167), Expect = 1.388e-11
Identity = 99/468 (21.15%), Postives = 184/468 (39.32%), Query Frame = 2
Query: 1190 NLKEFCEKYSIAVMNRA-----VIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTK-----FLSLPSCQKALTRLWYRG-----------------------------------TR-----RCPALKFYMHSFIHCVFLGLFSYFLIINFY----------------SNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKH--------PDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLY---PNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEE--MEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDR-SLLPPPMNXXXXXXXXXYVF 2353
             L E C++YS  ++++      VI     D     G +N  NI      L ++ L  + K     F+S P CQ+ LT +WY G                                   +R     R P +KF+ +S     FLGL ++    ++                    + +E + + + IG    E +Q++    ++  K Y +   N++D      M+  ++  +S+++  +        P +     +  S    L ++  +  +  +  F RIIY       +GP    +  M+V D+    FIFV+ I+SF I    L +   PN+   L  +      ++   + D +    +++F      +   +E+ +   +V +        + ++Y     I+L+N+LIA+ S++   I   +   WK +R K    ++D  S LPPP NI      +IYV 
Sbjct:  285 QLSEQCKQYSCDLLSQCRSSEEVIAILNKD-----GNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLW----EEGFKRYMRQWWNWLDF----LMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPML-VAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLV-DVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKITQWVGQG-------MFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVM 730          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 79.7221 bits (195), Expect = 9.736e-15
Identity = 73/304 (24.01%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEI--VCYLYGIGYFMEETRQIYIYRQKDFLKSYFK----DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+  S  +  FL +FS+ +++         E   + Y+  +G+  E+ R+I I  +   +   F     +  N  D +A    V G   R                F E+T   + I R+I C+  I +++RI+    + + +GP + M+  M V++++  + +  V + SFG++ QA+LYPN     +  +    +    + G++F                 E    P  V   G+      + +Y+++ NI+L+NLLIA+F+N    +   S + W   R+  + EY  + +LPPP
Sbjct:  821 APITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGF--EKVREI-ISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR----------------FRENT---MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKM-VKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCG--------EDPSQPGCVT--GHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPP 1091          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339080)

HSP 1 Score: 79.7221 bits (195), Expect = 1.078e-14
Identity = 73/304 (24.01%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEI--VCYLYGIGYFMEETRQIYIYRQKDFLKSYFK----DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+  S  +  FL +FS+ +++         E   + Y+  +G+  E+ R+I I  +   +   F     +  N  D +A    V G   R                F E+T   + I R+I C+  I +++RI+    + + +GP + M+  M V++++  + +  V + SFG++ QA+LYPN     +  +    +    + G++F                 E    P  V   G+      + +Y+++ NI+L+NLLIA+F+N    +   S + W   R+  + EY  + +LPPP
Sbjct:  868 APITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGF--EKVREI-ISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR----------------FRENT---MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKM-VKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCG--------EDPSQPGCVT--GHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPP 1138          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 79.7221 bits (195), Expect = 1.084e-14
Identity = 73/304 (24.01%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEI--VCYLYGIGYFMEETRQIYIYRQKDFLKSYFK----DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+  S  +  FL +FS+ +++         E   + Y+  +G+  E+ R+I I  +   +   F     +  N  D +A    V G   R                F E+T   + I R+I C+  I +++RI+    + + +GP + M+  M V++++  + +  V + SFG++ QA+LYPN     +  +    +    + G++F                 E    P  V   G+      + +Y+++ NI+L+NLLIA+F+N    +   S + W   R+  + EY  + +LPPP
Sbjct:  839 APITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGF--EKVREI-ISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR----------------FRENT---MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKM-VKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCG--------EDPSQPGCVT--GHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPP 1109          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339081)

HSP 1 Score: 79.7221 bits (195), Expect = 1.113e-14
Identity = 73/304 (24.01%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEI--VCYLYGIGYFMEETRQIYIYRQKDFLKSYFK----DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+  S  +  FL +FS+ +++         E   + Y+  +G+  E+ R+I I  +   +   F     +  N  D +A    V G   R                F E+T   + I R+I C+  I +++RI+    + + +GP + M+  M V++++  + +  V + SFG++ QA+LYPN     +  +    +    + G++F                 E    P  V   G+      + +Y+++ NI+L+NLLIA+F+N    +   S + W   R+  + EY  + +LPPP
Sbjct:  853 APITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGF--EKVREI-ISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR----------------FRENT---MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKM-VKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCG--------EDPSQPGCVT--GHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPP 1123          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 79.7221 bits (195), Expect = 1.120e-14
Identity = 73/304 (24.01%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEI--VCYLYGIGYFMEETRQIYIYRQKDFLKSYFK----DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+  S  +  FL +FS+ +++         E   + Y+  +G+  E+ R+I I  +   +   F     +  N  D +A    V G   R                F E+T   + I R+I C+  I +++RI+    + + +GP + M+  M V++++  + +  V + SFG++ QA+LYPN     +  +    +    + G++F                 E    P  V   G+      + +Y+++ NI+L+NLLIA+F+N    +   S + W   R+  + EY  + +LPPP
Sbjct:  828 APITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGF--EKVREI-ISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR----------------FRENT---MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKM-VKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCG--------EDPSQPGCVT--GHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPP 1098          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 107.457 bits (267), Expect = 4.293e-23
Identity = 78/312 (25.00%), Postives = 156/312 (50.00%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P  KF+ ++  + V+L L++Y +++      S+ E +   Y I   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q+E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S        YA+E          + + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+
Sbjct:  781 APYTKFWFNTTAYLVYLMLYNYIILVKMERWPSLQEWIVISYIITLGLEKVRQILMSEPGKLKQKINVWLEEYWNITDLAAITTFLMGLLLRL---------QNEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDL-----YAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQIWKFQRYQLIMTFHDRPVLPPPL 1066          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 107.457 bits (267), Expect = 4.293e-23
Identity = 78/312 (25.00%), Postives = 156/312 (50.00%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P  KF+ ++  + V+L L++Y +++      S+ E +   Y I   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q+E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S        YA+E          + + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+
Sbjct:  781 APYTKFWFNTTAYLVYLMLYNYIILVKMERWPSLQEWIVISYIITLGLEKVRQILMSEPGKLKQKINVWLEEYWNITDLAAITTFLMGLLLRL---------QNEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDL-----YAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQIWKFQRYQLIMTFHDRPVLPPPL 1066          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 107.457 bits (267), Expect = 4.293e-23
Identity = 78/312 (25.00%), Postives = 156/312 (50.00%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P  KF+ ++  + V+L L++Y +++      S+ E +   Y I   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q+E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S        YA+E          + + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+
Sbjct:  781 APYTKFWFNTTAYLVYLMLYNYIILVKMERWPSLQEWIVISYIITLGLEKVRQILMSEPGKLKQKINVWLEEYWNITDLAAITTFLMGLLLRL---------QNEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDL-----YAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQIWKFQRYQLIMTFHDRPVLPPPL 1066          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 106.301 bits (264), Expect = 8.726e-23
Identity = 79/304 (25.99%), Postives = 149/304 (49.01%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLII--NFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ H+  +  +L LF+Y +++  + + +     ++ Y++  G  +E+ R+I +      L   K + ++  N  D+ A      G +LR  LQ P                  +   R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L PN       +++        I G++F          +   EE      P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  728 APIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNG--IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVLR--LQDPP----------------LMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTEEGVVMPLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1008          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm4a (transient receptor potential cation channel, subfamily M, member 4a [Source:ZFIN;Acc:ZDB-GENE-090302-3])

HSP 1 Score: 99.7525 bits (247), Expect = 9.386e-21
Identity = 76/283 (26.86%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 1520 IEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEME----------------HQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
            +E+V Y +      EE RQ +          +K Y +D  N  DI+A G  V G + R               +F  + N      R ++C+   +F +R+I+  ++ +Q+GPK+ ++  M V+D+   +F   V++ ++G+  QALLY           S++ +   ++   +F R  Y   +    L+E++                H+      + + N  V  LL +Y++V NI+L+NLLIA+FS T   + ++S   WK  RY  I EY+ R  L PP
Sbjct:  873 LELVLYFWVFTLACEEIRQSFFVGSTTLTQRMKVYIQDIWNKCDITALGLFVLGLLCR---------------MFPWTYN----FGRAVMCVDYTVFTLRLIHIFAVHKQLGPKIIIVGKM-VKDVFFFLFFLGVWLMAYGVANQALLY-----------SYDSRP-GWVARRVFYRP-YMHIYGQIPLDEIDADKRHDKRCTDNVTLIHEGAEPCPDSDANWLVLILLSVYLLVTNILLVNLLIAMFSYTFNKVQERSDVYWKFQRYNLIVEYHSRPCLAPP 1122          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 114.005 bits (284), Expect = 5.023e-25
Identity = 80/306 (26.14%), Postives = 150/306 (49.02%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKR--STYTIFHTHYA--LEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      SV E V   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F       T  HT     L + + +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  847 APIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQIDRKTRIHTPCGENLYDEDGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1131          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 111.694 bits (278), Expect = 3.043e-24
Identity = 77/302 (25.50%), Postives = 148/302 (49.01%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      SV E V   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F          +  L + + +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  697 APIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQIDPPCGEN--LYDEDGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 975          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 111.309 bits (277), Expect = 3.967e-24
Identity = 79/312 (25.32%), Postives = 150/312 (48.08%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      SV E V   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F           YA+E          + + +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  731 APIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQI-----DLYAMEINPPCGENLYDEDGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1016          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 110.923 bits (276), Expect = 4.181e-24
Identity = 77/302 (25.50%), Postives = 148/302 (49.01%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      SV E V   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F          +  L + + +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  650 APIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQIDPPCGEN--LYDEDGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 928          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 110.923 bits (276), Expect = 4.224e-24
Identity = 77/302 (25.50%), Postives = 148/302 (49.01%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      SV E V   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F          +  L + + +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  736 APIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQIDPPCGEN--LYDEDGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1014          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 113.235 bits (282), Expect = 6.849e-25
Identity = 95/365 (26.03%), Postives = 173/365 (47.40%), Query Frame = 2
Query: 1406 GTRRC-----PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTH-YALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVF---CKKPKVFIVNEEGDGINL-IQDEFVEK 2431
            GT+ C     P +KF+ ++  +  +L LF+Y +++      S  E +   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +IL+++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P        +++        I G++F          H YA+E          + E +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM I   I+ II      C+K +     E   G+ L + DE ++K
Sbjct:  862 GTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAILRLQSQ------------------PYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDRKTRIHIYAMEINPPCGENLYDEEGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKK 1205          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 111.309 bits (277), Expect = 1.996e-24
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  391 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLP--PCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 671          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 111.309 bits (277), Expect = 2.577e-24
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  880 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1160          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 110.538 bits (275), Expect = 5.006e-24
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  858 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1138          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 110.538 bits (275), Expect = 5.044e-24
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  853 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1133          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q2WEA5|TRPM1_RAT (Transient receptor potential cation channel subfamily M member 1 OS=Rattus norvegicus OX=10116 GN=Trpm1 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.635e-24
Identity = 83/322 (25.78%), Postives = 154/322 (47.83%), Query Frame = 2
Query: 1406 GTRRC-----PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTH-YALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
            GT+ C     P +KF+ ++  +  +L LF+Y +++      S  E +   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +IL+++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P        +++        I G++F          H YA+E          + E +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  862 GTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAILRLQNQ------------------PYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDRKTRIHIYAMEINPPCGENLYDEEGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1162          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q2TV84|TRPM1_MOUSE (Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=2 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 4.081e-23
Identity = 94/364 (25.82%), Postives = 172/364 (47.25%), Query Frame = 2
Query: 1406 GTRRC-----PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVF---CKKPKVFIVNEEGDGINL-IQDEFVEK 2431
            GT+ C     P +KF+ ++  +  +L LF+Y +++      S  E +   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +IL+++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P        +++        I G++F           YA+E          + E +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM I   I+ II      C+K +     E   G+ L + DE ++K
Sbjct:  862 GTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAILRLQSQ------------------PYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQI-----DLYAMEINPPCGENLYDEEGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKK 1199          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q9HCF6|TRPM3_HUMAN (Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=2 SV=4)

HSP 1 Score: 109.768 bits (273), Expect = 6.468e-23
Identity = 80/304 (26.32%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIE--IVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ ++  +  +L LF+Y +++      S  E  ++ Y++ +G  +E+ R+I +      L   K + ++  N  D+ A      G ILR+  Q    P +S+               R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L+PN       +++        I G++F          +   E+ +  + P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  893 APIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLG--IEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQ----PFRSDG--------------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1173          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q7Z4N2|TRPM1_HUMAN (Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.275e-22
Identity = 81/321 (25.23%), Postives = 153/321 (47.66%), Query Frame = 2
Query: 1406 GTRRC-----PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE----------EMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
            GT+ C     P +KF+ ++  +  +L LF+Y +++      S+ E +   Y +   +E+ R+I +         +K + ++  N  D+ A    + G ILR+  Q                   ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P        +++        I G++F           YA+E          + E +  P  +   G      L+  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPPM
Sbjct:  817 GTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISTFMIGAILRLQNQ------------------PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDL-----YAMEINPPCGENLYDEEGKRLPPCI--PGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1111          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q923J1|TRPM7_MOUSE (Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.879e-22
Identity = 88/381 (23.10%), Postives = 178/381 (46.72%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFIS-RLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKK---------PKVFIVNEEGDGINLIQDEFVE-------------KNENISVSFKIIQAFALR 2482
             P +KF+ ++  +  FL L+++ +++      SV E +   Y   Y +E+ R++++         +K +F D  N  D  A      GF LR   +            +I + +  +F++ RLI C+++I +++R++ F ++ +Q GP + MI  M+  ++  ++ I  + + SFG+  +A+LYP+     + ++         I G+++           Y ++   +  T   +   G     FL  +Y+ V  I+++NLLIA F+N    +   S+  WK  RY  I  Y+++ +LPPP+ I   I  +    CK+         PK+F+  E+   ++  +++ VE               E I V+F+ ++  +++
Sbjct:  851 APIVKFWFNTLAYLGFLMLYTFVVLVKMEQLPSVQEWIVIAYIFTYAIEKVREVFMSEAGKISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWN----------YINAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVA-NMFYIVVIMALVLLSFGVPRKAILYPHEEPSWSLAKDIVFHPYWMIFGEVYA----------YEIDVCANDSTLPTICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLFCCVCKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFDEKDDKFNSGSEERIRVTFERVEQMSIQ 1210          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A5J4NFU6 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0003022 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.475e-48
Identity = 128/314 (40.76%), Postives = 191/314 (60.83%), Query Frame = 2
Query: 1415 RCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFY----------GLNFSQSFEKKSISFI--LGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEG-NIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            R P+ KF+ HS  H  FL  FS   +    S +S+ E++   Y  GY +EE RQ+     +D  + YFKD  N+ID+ A GF + GF ++  L  P +P +S    F E+ +  L I+R    IS+ LF++R +Y  SI + IGP+LKM+S M+ +DL+PL+ +F + I SFG+ FQ L+YPNSFY           +  S S EK  + ++    ++FKR+ Y +F     L+EM  +E  Y     G +I ++F+ VLY  +VNI+L+NLLIALFSNTV+ I Q+S+  W A+RYK +KEY ++++LPPP+N
Sbjct:  220 RSPSTKFFFHSLFHLAFLFFFSAICLFGVLSQVSIAELIVVAYVTGYALEEFRQLLFEGMRDGWREYFKDTWNWIDLCAIGFTIAGFCIK--LTSPSYPIRS----FQEAYDSTLSITRNFYMISLTLFYVRTLYITSISKTIGPRLKMMSDMLRKDLVPLLVVFFICIFSFGVWFQGLIYPNSFYEKPHANRTYMKMRASNSLEKHQLPWMQTFKELFKRAFYNMFELSMILDEMSCEENVYCGYPLGFDIVIYFVFVLYTGIVNIILINLLIALFSNTVSRIEQESTAHWMASRYKMVKEYSEQTVLPPPLN 527          

HSP 2 Score: 189.889 bits (481), Expect = 1.497e-45
Identity = 122/314 (38.85%), Postives = 185/314 (58.92%), Query Frame = 2
Query: 1406 GTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLN--------FSQSFEKKSISFILGDIFKRSTYTIFHTHYALEE-MEHQETPYFVNKEG-NIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            G  + P++KF +HS  H  FL  FS   + + +S  +  E++  +Y  GY +EE RQI +   ++ L  Y KD  N+ID+ A      GF +R+  Q        EA       +  L+ +R +  + + LF+MR +Y  SI + IGP+LKM++ M+ +DL+PL+ +F +FI S+G+ FQ L+YPNSFY            + S  +  +S    ++FKR+ Y+IF     LEE +   ++PY  N  G N  ++F+LVLY  +VNI+L+NLLIALFSNTV+ I QK++  W A RYK +KEY +R++LPPP N
Sbjct:  842 GVYQSPSMKFCLHSLFHLFFLIFFSVVCVYSLHSYFTKAELISLIYVAGYAVEEIRQIAVEALRNELHDYLKDGWNWIDLLAISLTAVGFCIRLGAQTDFQSSYQEAH------DPLLYSTRNLYMLGLNLFYMRTLYITSISQIIGPRLKMMADMLRKDLVPLLIVFAIFICSYGVWFQGLIYPNSFYQTVEERNSMELAATSGHRLGLSDAFKELFKRAFYSIFEVSIVLEEEICDDKSPYCGNPNGMNTVLYFVLVLYTGIVNIILINLLIALFSNTVSRIDQKATALWLAGRYKMVKEYSERTVLPPPFN 1149          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A5K3FLD7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 7.752e-48
Identity = 139/375 (37.07%), Postives = 204/375 (54.40%), Query Frame = 2
Query: 1277 SGFLNKPNILAGQRILDIAFL---SKSTKFLSLPSCQKA-----------LTRLW-YRGTRR---------CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQS---FEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGN-IAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            SG  N P     +R LDI+ L    +S+  L    C KA           L+R + +RG+ R          P +KF+ HS  H VFL  F+  L+ + +  I + E     Y IGY +EE RQI I   +    +Y KD  N +++ A GF + GF  RV       P ++EA       +V  +I+R+     + LF MR ++  SI   IGP+LKM++ M+ +DL+PLI +F +FI S+G++FQ L+YPNS+    F      +EK      L  +  R+ Y+IF    ALEE E        N+ GN + + F+L+ Y I+VN++L+NLLIALFSNTV+ I  +S+  W A+RY+ +KEY D+S LPPP+N
Sbjct:  163 SGSANSPQ--KRRRGLDISGLRIKERSSSVLPPNRCSKASGPIPFTIYDRLSRQYGWRGSPRLSFLRAIYASPEVKFFFHSIFHVVFLVTFTLVLVNSLHFQIHLTECCAIAYVIGYAVEEIRQIIIECLRGQFSNYLKDSWNTLELFAIGFTLVGFWTRVGKIKQWAPPETEA------YDVTFYIARVCYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLVPLIIVFAIFIFSYGVSFQGLMYPNSYMRQEFPNGTLIYEKMPFLQALERLISRAFYSIFEVSVALEEAECSPDEKCGNQFGNKLVILFVLIAYTIIVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSTLPPPLN 529          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A0R3U772 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2667 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.130e-47
Identity = 139/375 (37.07%), Postives = 204/375 (54.40%), Query Frame = 2
Query: 1277 SGFLNKPNILAGQRILDIAFL---SKSTKFLSLPSCQKA-----------LTRLW-YRGTRR---------CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQS---FEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGN-IAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            SG  N P     +R LDI+ L    +S+  L    C KA           L+R + +RG+ R          P +KF+ HS  H VFL  F+  L+ + +  I + E     Y IGY +EE RQI I   +    +Y KD  N +++ A GF + GF  RV       P ++EA       +V  +I+R+     + LF MR ++  SI   IGP+LKM++ M+ +DL+PLI +F +FI S+G++FQ L+YPNS+    F      +EK      L  +  R+ Y+IF    ALEE E        N+ GN + + F+L+ Y I+VN++L+NLLIALFSNTV+ I  +S+  W A+RY+ +KEY D+S LPPP+N
Sbjct:  561 SGSANSPQ--KRRRGLDISGLRIKERSSSVLPPNRCSKASGPIPFTIYDRLSRQYGWRGSPRLSFLRAIYASPEVKFFFHSIFHVVFLVTFTLVLVNSLHFQIHLTECCAIAYVIGYAVEEIRQIIIECLRGQFSNYLKDSWNTLELFAIGFTLVGFWTRVGKIKQWAPPETEA------YDVTFYIARVCYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLVPLIIVFAIFIFSYGVSFQGLMYPNSYMRQEFPNGTLIYEKMPFLQALERLISRAFYSIFEVSVALEEAECSPDEKCGNQFGNKLVILFVLIAYTIIVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSTLPPPLN 927          

HSP 2 Score: 100.908 bits (250), Expect = 7.926e-18
Identity = 67/210 (31.90%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  800 NLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKF---IKSHSSFNLEKIFTDLT---DLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQ-RILDIAFLSKSTKFLSLPSCQKALTRLWYRG 1408
            + E    L+S + + +  +C+ENG G+ +Y+++ F   IK+H    + +  T L     L      +  P         + S LFLALI GRF +   LL   QFD I   +LV LI   L     FP+QV   ++ +    E  ++ V+    ++D TP+K+I  G LN P  + G   ++D+   +K T  LSLP CQ+ L   W RG
Sbjct:  289 DFETSQGLTSGQRAELFFDCYENGAGVYSYVQSNFAMNIKAHDFLTVLRSLTGLVLFEQLTVDGVIVLSP--------LHTSILFLALICGRFRVAELLLRMRQFDLIPACVLVVLILHRLYQEPTFPEQVRCELQQIASLVEAIAVDVLTLVSLKDNTPEKEICRGILNAPLRICGDLSLIDLCAQAKCTNLLSLPICQRVLDERW-RG 489          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A5K3FNF4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.288e-47
Identity = 139/375 (37.07%), Postives = 204/375 (54.40%), Query Frame = 2
Query: 1277 SGFLNKPNILAGQRILDIAFL---SKSTKFLSLPSCQKA-----------LTRLW-YRGTRR---------CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQS---FEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGN-IAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            SG  N P     +R LDI+ L    +S+  L    C KA           L+R + +RG+ R          P +KF+ HS  H VFL  F+  L+ + +  I + E     Y IGY +EE RQI I   +    +Y KD  N +++ A GF + GF  RV       P ++EA       +V  +I+R+     + LF MR ++  SI   IGP+LKM++ M+ +DL+PLI +F +FI S+G++FQ L+YPNS+    F      +EK      L  +  R+ Y+IF    ALEE E        N+ GN + + F+L+ Y I+VN++L+NLLIALFSNTV+ I  +S+  W A+RY+ +KEY D+S LPPP+N
Sbjct:  559 SGSANSPQ--KRRRGLDISGLRIKERSSSVLPPNRCSKASGPIPFTIYDRLSRQYGWRGSPRLSFLRAIYASPEVKFFFHSIFHVVFLVTFTLVLVNSLHFQIHLTECCAIAYVIGYAVEEIRQIIIECLRGQFSNYLKDSWNTLELFAIGFTLVGFWTRVGKIKQWAPPETEA------YDVTFYIARVCYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLVPLIIVFAIFIFSYGVSFQGLMYPNSYMRQEFPNGTLIYEKMPFLQALERLISRAFYSIFEVSVALEEAECSPDEKCGNQFGNKLVILFVLIAYTIIVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSTLPPPLN 925          

HSP 2 Score: 100.908 bits (250), Expect = 8.406e-18
Identity = 67/210 (31.90%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  800 NLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKF---IKSHSSFNLEKIFTDLT---DLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQ-RILDIAFLSKSTKFLSLPSCQKALTRLWYRG 1408
            + E    L+S + + +  +C+ENG G+ +Y+++ F   IK+H    + +  T L     L      +  P         + S LFLALI GRF +   LL   QFD I   +LV LI   L     FP+QV   ++ +    E  ++ V+    ++D TP+K+I  G LN P  + G   ++D+   +K T  LSLP CQ+ L   W RG
Sbjct:  287 DFETSQGLTSGQRAELFFDCYENGAGVYSYVQSNFAMNIKAHDFLTVLRSLTGLVLFEQLTVDGVIVLSP--------LHTSILFLALICGRFRVAELLLRMRQFDLIPACVLVVLILHRLYQEPTFPEQVRCELQQIASLVEAIAVDVLTLVSLKDNTPEKEICRGILNAPLRICGDLSLIDLCAQAKCTNLLSLPICQRVLDERW-RG 487          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A0V0J4K6 (Transient receptor potential cation channel subfamily M member 7 OS=Schistocephalus solidus OX=70667 GN=TRPM7 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.824e-47
Identity = 119/323 (36.84%), Postives = 191/323 (59.13%), Query Frame = 2
Query: 1421 PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGL---NFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGN-IAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFI 2377
            P +KF+ HS  H +FL +F+  L+  F+  + + E +  +Y  GYF+EE RQ+ I   +   +SY +D  N+I+I+A    + GF +R+      H     A    E      +++R+     + LF MR ++  SI   IGP+LKM++ M+ +DL+PL+ +F +FI S+G++FQ LLYPNSFY     N + S ++   +  +  +  R+ Y+IF    ALEE E  +     N  G+ + + F L++Y  +VN++L+NLLIALFSNTV+ I Q+S+  W A+RY+ +KEY D+S  PPP+NI  I+FE+   +C++    I
Sbjct:  856 PEVKFFFHSIFHILFLIVFTLVLLYRFHFQVHITEYLSVVYVAGYFIEEVRQMIIEALRGEFRSYLRDSWNFIEITAVISTLTGFGIRI------HKMDDRASPLDEVQEPSFYVARVFYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLIPLLIVFAIFILSYGVSFQGLLYPNSFYRKYEDNGTYSMDQFPFALTIEKVISRAFYSIFEVSVALEEAECSDKDVCGNPLGSKLVILFGLIVYTGIVNLILINLLIALFSNTVSRIGQQSTAHWLADRYQMVKEYQDKSACPPPLNILSILFEVFGCYCQQAACLI 1172          

HSP 2 Score: 96.6709 bits (239), Expect = 1.714e-16
Identity = 65/210 (30.95%), Postives = 101/210 (48.10%), Query Frame = 2
Query:  800 NLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKF---IKSHSSFNLEKIFTDLT---DLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQ-RILDIAFLSKSTKFLSLPSCQKALTRLWYRG 1408
            + E    L+S + + +  +C+ENG G+ ++I+  F   +K+H    + +  T L     L      I  P         + S LFLA+I GRF +   LL   QFD I   +LV LI + L     FP+QV   ++      E  ++ V+    ++D TP+K+I    LN P  + G   ++D+   +K T  LSLP CQ+ L   W RG
Sbjct:  507 DFETSQGLTSSQRAELFVDCYENGTGVYSHIQTNFATNLKTHDFLTILRTLTGLVVFEQLSVDGVVILAP--------LHTSILFLAVICGRFRIAEMLLRMRQFDQIPACVLVVLILKRLFQEPTFPEQVRSELQQFASHVEAIAVDVLTLVSLKDNTPEKEICRSMLNVPLCICGDLSLIDLFAQAKCTNLLSLPICQRVLDERW-RG 707          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 105.916 bits (263), Expect = 1.135e-22
Identity = 86/346 (24.86%), Postives = 169/346 (48.84%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRST--YTIFHTHYALEEM---EHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVF-------CKKPKVFIVNEEGDGINLI 2410
             P  KF+ ++  +  +L L++Y +++      S+ E +   Y +   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S   Y +       E M   + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+    II   +Y+        C K K   ++E+  G+ LI
Sbjct:  756 APFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLRL---------QPEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPL----IILSHLYILFRKICCRCGKKKEGELDEKDKGLKLI 1076          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 105.531 bits (262), Expect = 1.302e-22
Identity = 86/346 (24.86%), Postives = 169/346 (48.84%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRST--YTIFHTHYALEEM---EHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVF-------CKKPKVFIVNEEGDGINLI 2410
             P  KF+ ++  +  +L L++Y +++      S+ E +   Y +   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S   Y +       E M   + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+    II   +Y+        C K K   ++E+  G+ LI
Sbjct:  874 APFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLRL---------QPEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPL----IILSHLYILFRKICCRCGKKKEGELDEKDKGLKLI 1194          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 105.531 bits (262), Expect = 1.425e-22
Identity = 86/346 (24.86%), Postives = 169/346 (48.84%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIY---RQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRST--YTIFHTHYALEEM---EHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVF-------CKKPKVFIVNEEGDGINLI 2410
             P  KF+ ++  +  +L L++Y +++      S+ E +   Y +   +E+ RQI +    + K  +  + ++  N  D++A    + G +LR+         Q E          ++   R+I C+ +I +++R++    + + +GP + MI  M++ D++  + I +V + SFG+  QA+L+P+       +++        I G++F  S   Y +       E M   + ++ P  +   G      ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  ++DR +LPPP+    II   +Y+        C K K   ++E+  G+ LI
Sbjct:  856 APFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLRL---------QPEP---------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCI--PGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPL----IILSHLYILFRKICCRCGKKKEGELDEKDKGLKLI 1176          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 103.99 bits (258), Expect = 4.020e-22
Identity = 79/308 (25.65%), Postives = 153/308 (49.68%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLII--NFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILG-DIFKRSTYTIFHTHYALEEMEHQE---TPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ H+  +  +L LF+Y +++  + + +     ++ Y++  G  +E+ R+I +      L   K + ++  N  D+ A      G +LR  LQ P                  +   R+I C+++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L PN             +  S++L  +IF    + I+      + +  ++    P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  715 APIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNG--IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVLR--LQDPP----------------LMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPN-------------EDPSWMLARNIFFMPYWMIYGEAPCGQNITTEDGTIVPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 988          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 103.219 bits (256), Expect = 6.361e-22
Identity = 91/352 (25.85%), Postives = 168/352 (47.73%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDF---LKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALE-EMEHQETPYFVNKEGNIAVFF---LLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKK--------PKVFIVNEEGDGINLIQDEFVE 2428
             P +KF+ ++  + VFL L+SY +++      S  E    LY     +E+ R++++         +K +F D  N  D  A      GF                 GL   S NVF+   RLI C+++I +++R++   ++ +Q GP + MI  M+  ++  ++ I  V + ++G+  +A+LYPNS           +   S I+  +F+   + ++   YA E ++    T   ++      V+    L  +Y+ +  I+++NLLIA F+N    ++  S+  WK  RY  I  Y+D+ +LPPP+ IF  I   +   CK+        PK+F+  E+   ++  +++ VE
Sbjct:  821 APIVKFWTNTLFYLVFLMLYSYVVLVKLPIFPSPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFSDYFNRSDFIAIVMFAVGF-----------------GLRFGSGNVFI-AGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVA-NMFYIVVIMCVVLVTYGVPRKAILYPNS-----------EAEWSLIIDVVFQ-PYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLFLTEEDQKKLHDFEEQCVE 1141          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 85.5001 bits (210), Expect = 2.947e-17
Identity = 103/413 (24.94%), Postives = 183/413 (44.31%), Query Frame = 2
Query: 1400 YRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQK----DFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQS--EAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNS------FYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTE-IKTMKKAIEKIKHNLDQQG 2599
            +R     P   F+ +   + +FL LF+Y +I++F       E V Y + +   +EE RQ++   +K         Y KD  N IDI A      G I R+   IP   ++S  +AG             R +LC+  ++F +R+++  ++ + +GPK+ ++  M V+D+   +F+  V++ ++G+  Q +L  N       F G+ +           I G    R   T F T        +   P       +     L  LY++  NI+L+NLLIA+F+ T   +   +   WK  RY+ + EY+ R  L PP+    I+F  +Y+F ++   FI+ +        +  F E  E   ++++ I        R   + SQ   + +R  E IK+  + ++ +   LD  G
Sbjct:  715 WRNFWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTPDWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILALLLFTIGVICRL---IPNSINESTFQAG-------------RSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRM-VKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDWIFRGVVYQPYL------LIFGQFPTRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPL----IVFSHLYLFVRR---FILKKPQHKHEDFKKGFSESEEREFLAWESIM-------RESYVASQLTEKSQRLEERIKSTAEKMDSVMQFLDVSG 1090          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 71.2478 bits (173), Expect = 6.924e-13
Identity = 69/294 (23.47%), Postives = 134/294 (45.58%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSL 2299
             P +KF+ ++  +  FL LF+Y +++      SV E    LY     +E  R+I++     F +        Y +I+ +   +  F + V+L+       S++ L IE+        +++  + +I +++R++   ++ + +GP + MI  M+ +  M L+ I  + + SFG+  QA+L+             E     ++  +I  +  + IF   YA E   + +  Y     G     FL  +Y+ V  I+++NLLIA F+N        S + WK +RY     Y+ + +
Sbjct:  732 APIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQEWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLDGYWNINDS-LGILLFFVAVALR-------SQSHLLIEA--------KIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCM-LMIIMAIVLLSFGVARQAILFK------------EADPSWYLARNIVFQPYWMIFGEVYAPEIDNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQKPI 996          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.614e-9
Identity = 65/302 (21.52%), Postives = 134/302 (44.37%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYI----YRQKDFLKSYFKDPTNY-IDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEE---MEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSL 2299
             P +KF+ ++  +  FL LF+Y +++      SV E    LY     +E  R++       R+   L+S  +   +  I +   G+      L + L       +S++ L IE+        +++  + +I +++R++   ++ + +GP + MI  M+  ++  ++ I  + + SFG+  QA+L+  +      +++   +    I G+++      I     A  E     + +  Y     G     FL  +Y+ V  I+++NLLIA F+N        S + WK +RY     Y+ + +
Sbjct:  679 APIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGILLFFVAVALRSQSHLLIEA--------KIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMA-NMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQKPI 971          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 95.9005 bits (237), Expect = 4.895e-20
Identity = 88/315 (27.94%), Postives = 148/315 (46.98%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINF--------YSNISVIEIVCYLYGIGYFMEETRQI------YIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYF--VNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P  KF  +   +  F+ L++Y ++ NF           I   EIV Y +     +EE RQ+      YI   KD +  YF D  N++DI +    +   ILR                F  ++ +F   SR+IL + +I F +R +   S+   +GPKL MI  M+ +DL   I I  VF  ++GI   A+++P        S     ++ +++      +  Y   +    L+E++ ++   F  V+ +G      LL +YM+  NI+L+NLLIA+F+ T   + + S + WK  RY  ++EY+ R +  PP+
Sbjct:  836 APFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYI---KDKVSVYFSDTWNFVDIFSLTVFIIAIILR----------------FFTNSRIFT-ASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFP--------SPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPL 1121          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 75.0998 bits (183), Expect = 1.082e-13
Identity = 84/308 (27.27%), Postives = 153/308 (49.68%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFK--DPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQE--------TPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P  KF+ +  ++ +FL +FS+ ++I      S+ E V   +      EE RQ+ +    +F  S+F+  D  + +     GF +  F L V L++  +P               L I  L+  + ++L+ +R++   S+ + +GP + MI  M + D+M  + I VVF+ ++G+  QA+L+P+           EK S   I   IF R  + ++   + +E++++          TP F ++ G   V  ++  Y++V NI+L+NLLIA+F+NT + +   S++ WK  R+  + EY  R  L PP
Sbjct:  765 APITKFWSNLIVYLLFLVVFSHVILIELPPVPSIEEWVLIGFVFSLCAEEVRQVRVINVWNF--SFFESSDWASNVWNLCDGFAMVLFFLAVGLRL--NPGT-------------LRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTI-DMMYFLVIMVVFLLAYGVAQQAILFPH-----------EKPSWELIT-KIFFRPYFQVYGELF-IEDVDYSSNSRETAFSTPKF-DEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPP 1040          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO31100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW3])

HSP 1 Score: 55.0694 bits (131), Expect = 1.238e-7
Identity = 63/274 (22.99%), Postives = 121/274 (44.16%), Query Frame = 2
Query: 1514 SVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSE---AG-LFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKS--ISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMN 2317
            + +E V  ++ +G  + E +Q     Q+   K YF+D  NY+DI+     +   I+R+       P Q     AG +++   N       LIL +S +L   R           GP L++  + ++ DL  +I  FVV I +F      + +      +  +++    S       G+  +++T ++  + + L +++   T    N+  +   ++L  +++++  +ML+N L+AL +NT   I   S   WK  R     +Y      PPP+N
Sbjct:  485 TAVEYVILVFFLGRILAEVQQY----QRSRSKIYFRDMWNYLDITIILCYITIVIVRIVTMAKSGPVQGNNLLAGVMYMYGINTLF----LILRVSSVLELNRTT---------GP-LQLALMRMLVDLWVIIVQFVVVILAFSFAITKVYFAQRSLAMGQTETNATYSGFCPLDGGNCLRKTTESLVWSLFGLTDLDSIAT---NNRAASTLAYYLYAIFLVICVVMLLNTLVALLNNTYEDIKSNSDTEWKYVRAMYADQYNRCHPFPPPVN 737          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 106.301 bits (264), Expect = 7.955e-23
Identity = 79/304 (25.99%), Postives = 150/304 (49.34%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLII--NFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ H+  +  +L LF+Y +++  + + +     ++ Y++  G  +E+ R+I +      L   K + ++  N  D+ A      G +LR  LQ P                 F+   R+I CI++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L PN       +++        I G++F          +   ++      P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  840 APIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNG--IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLR--LQEPP----------------FMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTDDGVVVALP--ACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1120          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 105.916 bits (263), Expect = 1.144e-22
Identity = 79/304 (25.99%), Postives = 150/304 (49.34%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLII--NFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFL---KSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPM 2314
             P +KF+ H+  +  +L LF+Y +++  + + +     ++ Y++  G  +E+ R+I +      L   K + ++  N  D+ A      G +LR  LQ P                 F+   R+I CI++I +++R++    + + +GP + MI  M++ D+M  + I +V + SFG+  QA+L PN       +++        I G++F          +   ++      P    K G   V  ++  Y++V NI+L+NLLIA+F+NT   +   S++ WK  RY+ I  +++R +LPPP+
Sbjct:  840 APIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNG--IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLR--LQEPP----------------FMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTDDGVVVALP--ACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 1120          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm6 (transient receptor potential cation channel subfamily M member 6 [Source:NCBI gene;Acc:101159200])

HSP 1 Score: 100.523 bits (249), Expect = 4.757e-21
Identity = 81/299 (27.09%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1421 PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYI-----YRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF---FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDR 2293
            P +KF+ H+  +  FL LFS+ +++   +  S+ E +   Y +   +E+TR++ +      RQK  LK +F +  N  D  A    + GF LR       HPD                  R+  C+ +I +F+R++   ++ +  GP L +I+ M   ++  ++ +  + + SFG++ +A+L P+           E+ S S +  DI  +  + IF   YA E       P         A F   FL  +YM V  I+++N+LIA F+N    +   S++ WK NRY+ I  Y +R
Sbjct:  863 PVVKFWFHTMSYLCFLMLFSFVVLVKMENRPSIQEWLVIFYIVSTAVEKTREVLMSEPRKLRQK--LKIWFSEYWNISDFVAILLFLVGFALRW------HPDPYRTA------------GRIAYCLDIIFWFIRVLDLLAVNQHAGPYLTIITKM-TSNMFFIVVMMAIVLLSFGVSRKAILSPD-----------EEPSWS-LARDIVFQPYWMIFGEVYAGEI-----DPCAGGNSCPPASFLTSFLQAVYMFVQYIIMVNVLIAFFNNIYFDMASTSNKLWKYNRYRYIMTYQER 1123          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm6 (transient receptor potential cation channel subfamily M member 6 [Source:NCBI gene;Acc:101159200])

HSP 1 Score: 100.523 bits (249), Expect = 4.765e-21
Identity = 81/299 (27.09%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1421 PALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYI-----YRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVF---FLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDR 2293
            P +KF+ H+  +  FL LFS+ +++   +  S+ E +   Y +   +E+TR++ +      RQK  LK +F +  N  D  A    + GF LR       HPD                  R+  C+ +I +F+R++   ++ +  GP L +I+ M   ++  ++ +  + + SFG++ +A+L P+           E+ S S +  DI  +  + IF   YA E       P         A F   FL  +YM V  I+++N+LIA F+N    +   S++ WK NRY+ I  Y +R
Sbjct:  863 PVVKFWFHTMSYLCFLMLFSFVVLVKMENRPSIQEWLVIFYIVSTAVEKTREVLMSEPRKLRQK--LKIWFSEYWNISDFVAILLFLVGFALRW------HPDPYRTA------------GRIAYCLDIIFWFIRVLDLLAVNQHAGPYLTIITKM-TSNMFFIVVMMAIVLLSFGVSRKAILSPD-----------EEPSWS-LARDIVFQPYWMIFGEVYAGEI-----DPCAGGNSCPPASFLTSFLQAVYMFVQYIIMVNVLIAFFNNIYFDMASTSNKLWKYNRYRYIMTYQER 1123          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: hrc (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101158642])

HSP 1 Score: 100.138 bits (248), Expect = 5.238e-21
Identity = 86/312 (27.56%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 1418 CPALKFYMHSFIHCVFLGLFSYFLIINFYS----NISVIEIVCYLYGIGYFMEETRQIYI-----YRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLY-----PNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPP 2311
             P   F  +  ++ +FL LF+Y L+++F        +V E V Y +      EE R+        +RQ+  L+SY +D  N IDI A    + G I R+                 E +  F    R +LC+  ++F +R+I+  +I +Q+GPK+ ++  M+ +D+   +F   V++ ++G+  QAL+Y     P+  +   F + +        + +I     + +  T+  +  ++    P  V +  N  V  LL++Y++V NI+L+NLLIA+FS+T + +   S   WK  RY  I  Y+ R  L PP
Sbjct:  835 APVTSFLGNVLMYFLFLVLFAYVLLVDFKPQPPWGPAVSEYVLYFWVFTIVCEEIRETAFLGTRNWRQR--LRSYIQDVWNKIDIVAITLFIVGLICRM----------------YERSYEF---GREVLCVDYMVFTLRLIHIFAIHKQLGPKIIIVGKMM-KDVFFFLFFLGVWLIAYGVANQALIYSYDSNPDRIFRRVFYRPYLHIFGQIPVEEIDSGKNWDLECTN-NMTMIDSGSEPCRV-EHSNWVVVVLLIIYLLVTNIVLINLLIAIFSHTFSEVQANSDIYWKFQRYNLIVTYHFRPSLAPP 1122          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068518.1 (SMESG000068518.1)

HSP 1 Score: 1645.17 bits (4259), Expect = 0.000e+0
Identity = 843/844 (99.88%), Postives = 843/844 (99.88%), Query Frame = 2
Query:   80 MIDIYSTLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCXXXXXXXXXXXXXXXXXXXXXXQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLDQQGVKFL 2611
            MIDIYSTLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCNDKRKLKDIKKNKKINLNHLLKQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLIC NLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNIFEIIFEIIYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLDQQGVKFL
Sbjct:    1 MIDIYSTLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCNDKRKLKDIKKNKKINLNHLLKQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICHNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNIFEIIFEIIYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLDQQGVKFL 844          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068517.1 (SMESG000068517.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 454/839 (54.11%), Postives = 615/839 (73.30%), Query Frame = 2
Query:  107 LVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCXXXXXXXXXXXXXXXXXXXXXXQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYI-YRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXY-VFCKKP----KVFIVNEEGDGINLIQDEFVEKNENIS---VSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLDQQ 2596
            L + ++ N S++FK +  NLP ++ +  + L D+EK+ A++WCRE G+YL+HK+F  VTK ES+ F+  +L+ +  NHL DE+++TWLHIAV+  R ++IL FL+ ++ I++  TD NK+TALHLACQK  Y+ GEL++LIK+S QL+A+SFDD+TPLEL C D RKLKD+K+N+ +N+N LL+ IDK+S GL  TEDF FNDK++ +++WL+LLQK++K+ L  ++KK       YY++  E + +++   ENG G++TYIKNK+++++ S  + +IF  LT L  +   I+  ++ E  + +Y SALF+ LITGRFE+VPTLL  CQFD I+YGL+ CLIC+ L+ + +FP+QV+ +IR LK+ CEKYS+AV+NR VIRD TP K IISGFLNK + L GQ ILDIA L K +KFL LP+CQ+  T+ W    R+CPALKFY+HS  HC+FLGL SY L+ +FY+  + IEI+CY YG+GYF EE RQIYI Y++  F  SY ++ +NYIDI +   ++    LR+ L I  +P+Q + GLF+ES +  LF  RLILCIS+IL++MRIIYFGSIFEQ+GPKLKM++ MI++DLMPLIFIF VFI +FGI FQ+L++PNSFY +  + +FEKKSI  IL  + +RSTYTIF THY  EE+EH E  Y VN EG IAV+FLL++YM+VVNIML NLLIALFSNTVT IIQKS +SWKANRYKDIKEY+DRSL PPP+N+ EI+ EII  V+ KK     K   +NEE          F   NE      +SFKIIQAF L+  R+KLI+++ D+EYE + EIK +KK IE I  NL + 
Sbjct:    9 LKKFLKENNSKEFKQNAPNLPDDITELMETLNDEEKKKAVDWCREIGIYLVHKLFIFVTKTESLLFLQNNLELYKTNHLCDEKERTWLHIAVRYDRDVKILSFLVNEIQIDIRWTDSNKFTALHLACQKSNYIPGELEILIKESNQLVARSFDDVTPLELACADMRKLKDLKRNRIVNINELLQHIDKVSFGLPETEDFYFNDKISTKRMWLNLLQKNDKHILSYYMKKDPKFYLKYYMTVAEMTEIVDLSLENGHGVLTYIKNKYLENNVS--MGEIFVSLTGLNLE--KIQSNDENETTYVYYRSALFMTLITGRFELVPTLLAYCQFDLISYGLMTCLICKKLVVIKEFPEQVIVDIRKLKDCCEKYSVAVLNRTVIRDLTPGKTIISGFLNKTDKLVGQNILDIAHLGKCSKFLGLPTCQETFTKQWNTRNRQCPALKFYLHSLFHCIFLGLLSYVLVYDFYAKATAIEIICYAYGLGYFFEEVRQIYINYKEDGFNSSYLEEASNYIDIGSIFTLILSGTLRIFLPIKTYPNQGDEGLFLESKDFNLFFIRLILCISLILYYMRIIYFGSIFEQLGPKLKMMARMIIQDLMPLIFIFAVFIAAFGIAFQSLMFPNSFYPIKGNSTFEKKSIYVILRALIRRSTYTIFDTHYPFEELEHDEGGYVVNSEGKIAVYFLLIIYMVVVNIMLTNLLIALFSNTVTVIIQKSRDSWKANRYKDIKEYFDRSLFPPPLNVAEILIEIIVKVYRKKQLVKMKDLTLNEEE------MQNFENANETQKTQFISFKIIQAFTLKDCRYKLILNENDKEYENRIEIKCIKKGIESIDKNLKEH 837          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068496.1 (SMESG000068496.1)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 417/828 (50.36%), Postives = 581/828 (70.17%), Query Frame = 2
Query:  104 DLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCXXXXXXXXXXXXXXXXXXXXXXQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENIS-----VSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEK 2572
            + V++++ N  ++FK++I NLP +V + TD L+DKEKE  I+W ++ GVYL+H++    TK+ S++F+  +L YF +NHL D+E +TWLH+AV  +R IEIL+F++ED+ ++VEK DIN  TALH ACQK +Y EGEL++LIK S+QLI++S DD+TPLEL C D RKLKDI+KN  +NL  LL+ ID IS+GL   E+F FN+ L ++K+WL+LL K++K+RLIN +KK  N ++ YY+    F  ++  CHENGQGI+TY+K +F  +  + + E+IF  L+ L     ++KE   + EN  FY S++FL+LITGRFE+VPTLL+ CQF+ I +GL++C IC NL  V  FPDQVL NI  LK+F EKY+IAV+NR VIRD T +KK IS FLNK   L  + ILDIA L K  +FLSLPSCQ A   +W++  R+CPA+K+ +HS IH VFL LF++ LI  FY  IS  EI+CY+YG+GY +EE RQIYI +Q   +  Y ++PTN ID+++  FM  G  LR   Q     D+   GL I+      F++R +LCIS IL+ MRIIY GS+F+Q+GPKLKMIS MIV+DL+PL+FIF+VFI SFG+TFQ+LLY N   G +   S  +KS  +I+  IF+R+T+TIF   Y L+E+   +    V   G +A +F L+++++VVN+MLMNLLIALFS TVT IIQKS+ESWKA+RYKDIKEY+DRS LPPP+NI EI  EI+    K  +    N +   +NL   + +E  +         SF+I+QAF+L+  R+KLI ++ED+EYER+  I  + + +++
Sbjct:   11 EFVQIVKQNNFQQFKTNIVNLPKDVTEITDKLSDKEKERLIKWSKDLGVYLVHQLTGTATKLSSIEFLKINLTYFKQNHLLDQEKRTWLHVAVVCNRSIEILKFIVEDLYLDVEKQDINGNTALHNACQKVKYNEGELNVLIKNSKQLISQSLDDVTPLELSCGDLRKLKDIQKNPLVNLKELLESIDDISSGLPQHEEFYFNENLPMDKMWLNLLHKNDKHRLINSMKKDPNFKSKYYIQPDLFIDIVMACHENGQGIVTYVKKQFFINKQTKSPEEIFKQLSGL-----NLKESAHLNEN-VFYTSSVFLSLITGRFELVPTLLSYCQFEIIPFGLIICRICHNLTHVKIFPDQVLENILKLKDFSEKYAIAVLNRTVIRDTTMNKKSISNFLNKSKYL-DKTILDIAHLGKCKRFLSLPSCQGAFDEIWWKNNRKCPAVKYMIHSIIHLVFLILFAFVLISEFYFFISPEEIICYIYGLGYLLEELRQIYILKQNRLMMFYLRNPTNIIDMTSLVFMGIGASLRFMFQ----SDRLLNGLKIQDQ---FFVTRFVLCISFILYSMRIIYLGSVFKQLGPKLKMISKMIVQDLLPLVFIFLVFIFSFGVTFQSLLYTNVLLGSSKLNSSARKSPIYIISTIFRRATFTIFDVQYTLQEITELDGTNSVTYNGRVATYFFLIIFIVVVNVMLMNLLIALFSYTVTEIIQKSNESWKADRYKDIKEYFDRSTLPPPLNILEITTEIVVNLIKLKRT--ENRKSSNLNLETFQLLEGQQMFGKKSKFTSFEILQAFSLQDCRYKLIQTEEDKEYERQMNILLINRKLDE 822          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068502.1 (SMESG000068502.1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 323/786 (41.09%), Postives = 493/786 (62.72%), Query Frame = 2
Query:  236 REKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQN--SRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCXXXXXXXXXXXXXXXXXXXXXXQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNL 2587
            + K +Y  H++F  VT  + ++ I  + + +++++L D + +TWLH AV+N  +  I IL+FLI+D+ + V K+D    TALH+AC K +  + ++  LI+   +L +KS D  TPLEL C +   L+ I  + K   + L K+ +   +     + F +        +WLS+L+ D+KYRL   +K  +N  + +YL  KEFS V+ NCH+NG G++ Y + K +   +    E +F +L+ LK  + S       +E+  ++ SALFLAL+TGRFE+VP+LL   Q + I YG+L CLIC+ L  +  FPD V+  I  +K+FCE YSIAV+N+  +RD T +KK++  +LN+        IL+IAF SKS+KFL LPSCQK+L +LW   +R  P  KFY H+  H +FLG+FSY L+ +FY   S +EI CYLYG GYF+EE      Y+Q +F++    D   YI+IS    M+ GFI+R+ ++  +        L+ ES N  L ISRLILC+S+I F++RIIYFG IF+ +GPKL+MIS MIV DL+PL FIF++F+ SFGITFQ++L+PN+ Y    +++ ++KS  +I+ +IF+R+ +TIF++ Y +EE+E +E  Y +++    ++  L +LYMI+ N+MLMNLLIALFS TV TII +S ESW ANRY    +Y+ RS +PPP NIFEI+   I   C K ++       + ++   D   E      ++F+I+Q FA +  R KLI S E++ YE++ ++ ++K +I  I  ++
Sbjct:   42 KSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAELFSKSLDKKTPLELACCNIGNLEIIINSVKDFDSVLRKKSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCR-KQLSVVTERKCENLFCNLSGLKITNNS------NDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFFKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGFGYFLEEASYALKYKQINFIRLLKNDARLYINISGIILMLIGFIIRIIVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLIFFYIRIIYFGFIFKILGPKLEMISKMIVNDLLPLTFIFLIFVISFGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVRRAILFLCHKKRM-----NSNYLHPKNDPLKE------LAFRILQIFACKDCRFKLIKSSENKNYEKEMKLNSLKNSINSINRSI 809          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068504.1 (SMESG000068504.1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 346/851 (40.66%), Postives = 526/851 (61.81%), Query Frame = 2
Query:   95 STLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFIT--RHLQYFIENHLKDEEDKTWLHIAV-----QN------SRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQ-LIAKSFDDITPLELVCXXXXXXXXXXXXXXXXXXXXXXQIDKISNGL-LVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNK--FIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFY-NSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFM-VFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNXXXXXXXXXYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLD 2590
            S     + IR+++   F ++     I   DF  L  +  K TAI WCR K +YL+H++  +   V ++ F++  ++LQ++ ++HL D + KTWLH+AV     QN      +  +EI+ FL+  + ++V +TD + YTALH AC    + +   +LL   S++ LI  S DD+TPLE+  +D  KLK IK  +K  L+ LL +ID IS+ +  + E F+  +  +  ++W+ LL  +++Y L+NF+KK  N +  +YLSS+EF  +I+N ++NG G++ +++ K  F+  +   + E+++ +LT  + K        + +   +FY NSALFL LITGRF +V  L+  CQF  I Y LL CLIC  LLS   F DQ   ++  +KEFCE YSIAV++R  IRD T  K+ I  FL    +   + IL+IA+L    KFL LP CQ++LT+LW     + PALKFY+HS IH VFLGL +Y LI   Y +IS+IE++CY+YG G  +E  RQ  +  +  FLK + KDPTN IDI +T  + V G    ++ ++       +  L  ++    LF   + LC S +LF  ++I+FG IFEQ GPKLKMI  MI++DL+PL F+F+VFI SFG+TFQ+L+YPNSFY    +++ EKK     + DIFKR+TY+IF T+Y + E++ ++     +    +A+  LL +Y++VVNIM+MNLLIA+FS TVT II+KS  SWKA RYKDIK +  RS LPPP NI  I+ E +        +FIV +  D I+       EK+    +SFKI+QAF+L+  R+KL+  +++RE++R+ EI+ ++ ++ K+++ ++
Sbjct:    4 SAKSAADYIRNDDKSGFLTNFETFEIE--DFYSLSVESLK-TAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGLDILLSEIDSISSAIPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREIISNSNDNGNGLLNFVQGKKYFLDKNELID-ERLYHELTGYQVKGLC-----QSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCSFLLFSFKVIFFGFIFEQFGPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYIVVVNIMMMNLLIAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFL--------IFIVPQSHDQIDCKN----EKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMN 833          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM36.241e-2426.32transient receptor potential cation channel subfam... [more]
TRPM31.252e-2326.32transient receptor potential cation channel subfam... [more]
TRPM31.252e-2326.32transient receptor potential cation channel subfam... [more]
TRPM31.328e-2326.32transient receptor potential cation channel subfam... [more]
TRPM31.328e-2326.32transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gon-24.154e-1421.40Transient receptor potential channel [Source:UniP... [more]
gon-26.539e-1421.40Transient receptor potential channel [Source:UniP... [more]
gon-26.773e-1421.40Transient receptor potential channel [Source:UniP... [more]
gon-27.146e-1421.40Transient receptor potential channel [Source:UniP... [more]
trp-11.388e-1121.15Transient-receptor-potential-like protein [Source... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm9.736e-1524.01gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm1.078e-1424.01gene:FBgn0265194 transcript:FBtr0339080[more]
Trpm1.084e-1424.01gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm1.113e-1424.01gene:FBgn0265194 transcript:FBtr0339081[more]
Trpm1.120e-1424.01gene:FBgn0265194 transcript:FBtr0339079[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm1a4.293e-2325.00transient receptor potential cation channel, subfa... [more]
trpm1a4.293e-2325.00transient receptor potential cation channel, subfa... [more]
trpm1a4.293e-2325.00transient receptor potential cation channel, subfa... [more]
trpm38.726e-2325.99transient receptor potential cation channel, subfa... [more]
trpm4a9.386e-2126.86transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM15.023e-2526.14transient receptor potential cation channel subfam... [more]
TRPM13.043e-2425.50transient receptor potential cation channel subfam... [more]
TRPM13.967e-2425.32transient receptor potential cation channel subfam... [more]
TRPM14.181e-2425.50transient receptor potential cation channel subfam... [more]
TRPM14.224e-2425.50transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm16.849e-2526.03transient receptor potential cation channel, subfa... [more]
Trpm31.996e-2426.32transient receptor potential cation channel, subfa... [more]
Trpm32.577e-2426.32transient receptor potential cation channel, subfa... [more]
Trpm35.006e-2426.32transient receptor potential cation channel, subfa... [more]
Trpm35.044e-2426.32transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2WEA5|TRPM1_RAT5.635e-2425.78Transient receptor potential cation channel subfam... [more]
sp|Q2TV84|TRPM1_MOUSE4.081e-2325.82Transient receptor potential cation channel subfam... [more]
sp|Q9HCF6|TRPM3_HUMAN6.468e-2326.32Transient receptor potential cation channel subfam... [more]
sp|Q7Z4N2|TRPM1_HUMAN1.275e-2225.23Transient receptor potential cation channel subfam... [more]
sp|Q923J1|TRPM7_MOUSE4.879e-2223.10Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NFU61.475e-4840.76Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
A0A5K3FLD77.752e-4837.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U7721.130e-4737.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FNF41.288e-4737.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J4K61.824e-4736.84Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm1b1.135e-2224.86transient receptor potential cation channel subfam... [more]
trpm1b1.302e-2224.86transient receptor potential cation channel subfam... [more]
trpm1b1.425e-2224.86transient receptor potential cation channel subfam... [more]
trpm34.020e-2225.65transient receptor potential cation channel, subfa... [more]
trpm76.361e-2225.85transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm22.947e-1724.94transient receptor potential cation channel, subfa... [more]
trpm76.924e-1323.47transient receptor potential cation channel, subfa... [more]
trpm73.614e-921.52transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO301354.895e-2027.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476581.082e-1327.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311001.238e-722.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm37.955e-2325.99transient receptor potential cation channel subfam... [more]
trpm31.144e-2225.99transient receptor potential cation channel subfam... [more]
trpm64.757e-2127.09transient receptor potential cation channel subfam... [more]
trpm64.765e-2127.09transient receptor potential cation channel subfam... [more]
hrc5.238e-2127.56transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068518.10.000e+099.88SMESG000068518.1[more]
SMESG000068517.10.000e+054.11SMESG000068517.1[more]
SMESG000068496.10.000e+050.36SMESG000068496.1[more]
SMESG000068502.10.000e+041.09SMESG000068502.1[more]
SMESG000068504.10.000e+040.66SMESG000068504.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008055 ID=SMED30008055|Name=Transient receptor potential cation channel subfamily M member|organism=Schmidtea mediterranea sexual|type=transcript|length=2675bp
AATAAGTGTGCTTCACACAGCACAGTTGTTTGCACTTATTCTTTTATTGT
AGTTATCGGAAAATTTGACTCAATTATTGATGATTGATATTTATTCAACT
CTGGATCTCGTAGAATTGATCCGATCAAATGAGTCAGAAAAGTTCAAATC
GAGCATTCACAATCTACCGATCAACGTGTTTGATTTCACTGACCTCTTAA
CCGACAAAGAAAAAGAAACCGCCATTGAATGGTGTCGAGAAAAGGGAGTT
TATTTGTTGCATAAAATGTTCGCAAAAGTAACCAAAGTCGAATCGGTGGA
TTTTATAACGAGACATTTACAATATTTTATAGAAAACCATTTGAAAGATG
AGGAAGACAAAACCTGGCTCCATATTGCCGTTCAGAATAGTAGAAAAATT
GAAATTTTGCGATTTCTCATTGAAGATGTTTCGATTAATGTGGAGAAAAC
TGATATTAATAAATACACAGCGTTGCATCTTGCGTGCCAGAAACCCGAAT
ACGTTGAAGGTGAATTGGATCTTTTAATAAAAAAATCCGAACAATTAATC
GCAAAATCCTTCGACGATATTACCCCACTCGAGTTGGTTTGCAATGACAA
ACGAAAACTTAAAGACATAAAAAAAAATAAAAAAATAAATTTAAATCATT
TATTAAAACAAATTGATAAAATATCAAATGGTCTCTTAGTCACAGAGGAT
TTTGAGTTTAATGATAAACTGACTTTGGAAAAGGTTTGGCTTAGTCTTCT
GCAAAAGGATAACAAGTATAGGCTAATTAATTTTGTCAAAAAATATGATA
ACCTTGAAAACATGTATTACTTGAGCTCCAAAGAATTCTCGTATGTCATT
AACAATTGCCACGAGAATGGGCAAGGAATTATGACATATATCAAAAATAA
ATTTATTAAATCCCATTCCAGTTTCAATTTAGAGAAAATCTTCACAGATC
TCACGGATTTGAAAACGAAAGATCCATCAATAAAAGAACCAGAGAAAATG
GAAGAAAATCACGAATTTTATAATTCGGCTTTATTTTTGGCGTTAATTAC
TGGCCGATTTGAAATGGTACCCACCCTTTTGACATGCTGCCAATTCGACT
CGATCACATACGGGTTATTGGTTTGTCTTATCTGTCAGAATCTTCTCTCC
GTCACAGATTTCCCGGATCAAGTGTTGGGAAACATCAGAAATTTGAAAGA
GTTTTGTGAAAAATACTCGATTGCTGTCATGAATCGAGCGGTGATTCGAG
ATTTTACACCCGATAAAAAAATTATTTCTGGATTTTTAAACAAACCAAAC
ATTTTAGCTGGACAACGAATTTTGGACATTGCATTTCTGTCGAAGTCGAC
GAAGTTTCTCAGTTTGCCTTCTTGCCAAAAAGCTCTAACTCGACTTTGGT
ATAGAGGCACCAGAAGATGTCCAGCGTTGAAATTTTATATGCATTCTTTT
ATTCATTGCGTTTTTCTAGGATTGTTTTCCTATTTTTTAATAATAAACTT
CTATTCGAATATATCGGTGATAGAAATAGTTTGTTATCTCTACGGAATAG
GATATTTCATGGAAGAGACTCGTCAGATATATATCTACAGGCAAAAAGAT
TTTCTGAAGTCATATTTTAAAGACCCTACAAATTACATAGACATCAGTGC
AACTGGATTTATGGTATTTGGGTTCATTCTCAGGGTGAGTTTACAAATTC
CCAAGCATCCTGATCAAAGTGAGGCTGGACTCTTTATTGAAAGTACGAAT
GTTTTCCTTTTTATTTCTCGGTTGATATTATGTATATCAATGATTCTATT
TTTCATGAGAATAATTTATTTTGGTTCAATTTTCGAACAAATCGGACCCA
AATTAAAAATGATAAGTATCATGATAGTTCGAGACTTGATGCCGTTGATT
TTTATTTTCGTTGTTTTCATAACGTCATTTGGAATTACATTTCAAGCATT
ACTTTATCCGAACAGTTTTTATGGGTTAAATTTCAGTCAAAGCTTTGAAA
AAAAGTCTATTTCTTTTATACTGGGAGACATATTTAAACGATCAACGTAT
ACAATTTTCCATACTCATTATGCACTCGAAGAAATGGAACACCAGGAAAC
TCCTTATTTTGTCAATAAGGAAGGCAACATAGCAGTATTCTTTCTTTTGG
TTCTCTACATGATTGTTGTTAACATAATGTTGATGAACCTTTTAATTGCC
TTGTTTAGTAATACTGTCACCACGATTATTCAAAAATCATCTGAGTCTTG
GAAGGCAAACAGATACAAGGACATCAAGGAGTATTATGATAGATCATTAT
TACCTCCACCAATGAACATTTTTGAAATAATCTTTGAAATAATTTATGTT
TTTTGTAAAAAACCGAAAGTCTTCATTGTGAATGAAGAAGGTGATGGTAT
CAATTTGATTCAGGATGAATTCGTTGAGAAAAATGAAAACATTTCGGTAT
CGTTTAAAATTATCCAAGCATTTGCTTTAAGAGGTCGACGTCATAAGCTT
ATTGTGAGTCAAGAAGATCGAGAATATGAAAGAAAAACTGAAATAAAAAC
AATGAAAAAAGCAATAGAAAAAATAAAACATAACTTGGATCAACAAGGTG
TAAAATTCTTATAGAATTCTAAAATTATGGTTTGGAAATCTAGAAATATT
TTAATAAAAGTTTAATCATTCTTTA
back to top

protein sequence of SMED30008055-orf-1

>SMED30008055-orf-1 ID=SMED30008055-orf-1|Name=SMED30008055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=845bp
MIDIYSTLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIE
WCREKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIA
VQNSRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLI
KKSEQLIAKSFDDITPLELVCNDKRKLKDIKKNKKINLNHLLKQIDKISN
GLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSS
KEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPS
IKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCL
ICQNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIIS
GFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPAL
KFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQI
YIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAG
LFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIV
RDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGD
IFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIM
LMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNIFEI
IFEIIYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFAL
RGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLDQQGVKFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 40..193
e-value: 4.9E-12
score: 47.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 85..335
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 176..839
NoneNo IPR availablePANTHERPTHR13800:SF12coord: 176..839
NoneNo IPR availableTMHMMTMhelixcoord: 560..582
NoneNo IPR availableTMHMMTMhelixcoord: 516..538
NoneNo IPR availableTMHMMTMhelixcoord: 329..351
NoneNo IPR availableTMHMMTMhelixcoord: 452..474
NoneNo IPR availableTMHMMTMhelixcoord: 478..495
NoneNo IPR availableTMHMMTMhelixcoord: 603..625
NoneNo IPR availableTMHMMTMhelixcoord: 684..706
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 92..171
score: 9.967