Secretory carrier-associated membrane protein

Overview
NameSecretory carrier-associated membrane protein
Smed IDSMED30008035
Length (bp)979
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secretory carrier-associated membrane protein (SMED30008035) t-SNE clustered cells

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30008035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secretory carrier-associated membrane protein (SMED30008035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30008035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008035SMESG000037804.1 SmedASXL_006636SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30008035SMESG000037804.1 dd_Smed_v4_8593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008035SMESG000037804.1 dd_Smed_v4_8593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008035SMESG000037804.1 dd_Smed_v4_8593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30008035SMESG000037804.1 dd_Smed_v4_8593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008035SMESG000037804.1 dd_Smed_v6_8593_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008035SMESG000037804.1 OX_Smed_1.0.07829ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 191.045 bits (484), Expect = 4.209e-58
Identity = 115/273 (42.12%), Postives = 154/273 (56.41%), Query Frame = 2
Query:   11 NPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            NPF+     V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S        FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L+QN   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   16 NPFKPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDS---ARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 284          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 187.193 bits (474), Expect = 1.566e-56
Identity = 108/231 (46.75%), Postives = 147/231 (63.64%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L   ++  NN+PPL SFCP + CF+QDI++EIP ++   V+  Y+LW+     L+LN  A L  F   +N    G  FG SIL  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V+ V+QA+GI   G  GW++ L++   N      ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:   72 ELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNN---GAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 299          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 187.193 bits (474), Expect = 1.566e-56
Identity = 108/231 (46.75%), Postives = 147/231 (63.64%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L   ++  NN+PPL SFCP + CF+QDI++EIP ++   V+  Y+LW+     L+LN  A L  F   +N    G  FG SIL  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V+ V+QA+GI   G  GW++ L++   N      ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:   72 ELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNN---GAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 299          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 187.193 bits (474), Expect = 2.476e-56
Identity = 115/279 (41.22%), Postives = 155/279 (55.56%), Query Frame = 2
Query:    5 DINPFQKGKQI----VQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S        FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L+QN   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 EYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDS---ARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 187.578 bits (475), Expect = 2.883e-56
Identity = 108/231 (46.75%), Postives = 147/231 (63.64%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L   ++  NN+PPL SFCP + CF+QDI++EIP ++   V+  Y+LW+     L+LN  A L  F   +N    G  FG SIL  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V+ V+QA+GI   G  GW++ L++   N      ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:   98 ELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNN---GAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 325          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 156.377 bits (394), Expect = 7.569e-45
Identity = 103/279 (36.92%), Postives = 150/279 (53.76%), Query Frame = 2
Query:    5 DINPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNS-----DTKKMYEDLEKKQKELDLRASELDRREREQS-------HLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCL---LFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            D NPF          G  N QP  +  T S    S     +  +  +DLE++ +EL +R  ELDRR+R  +       +  N++   +N+PPL +  P + CFYQDI VEIP Q+   VT  Y++++     L++N+ ASL Y I       AG S G   L C+   LF P S++ WFRP+Y AF+NDSS NF +FFF++F   + + +Q LG+    +CGW+N L   + +      ML++A  FT+        L+KVHRLYR    S +KA+ EF
Sbjct:   36 DFNPF------ANRAGGSNAQPTTHQSTGSLGNKSAGMDDELFRKQQDLERRAQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMI------FAGGSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEF 301          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 149.828 bits (377), Expect = 3.849e-43
Identity = 96/245 (39.18%), Postives = 142/245 (57.96%), Query Frame = 2
Query:  128 EDLEKKQKELDLRASELDRREREQS-------HLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCL---LFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGI--YWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF--GVNAASSV 820
            +DLE++ +EL +R  ELDRR+R  +       +  N++   +N+PPL +  P + CFYQDI VEIP Q+   VT  Y++++     L++N+ ASL Y I       AG S G   L C+   LF P S++ WFRP+Y AF+NDSS NF +FFF++F   + + +Q LG+  Y   +CGW+N L   + +      ML++A  FT+        L+KVHRLYR    S +KA+ EF  GV + + V
Sbjct:   10 QDLERRAQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMI------FAGGSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY---ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSDAGV 245          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 88.5817 bits (218), Expect = 6.785e-21
Identity = 61/149 (40.94%), Postives = 86/149 (57.72%), Query Frame = 2
Query:  365 LMLNLFASLGYFITSSNATMAGTSFGSSILVCL---LFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGI--YWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            L++N+ ASL Y I       AG S G   L C+   LF P S++ WFRP+Y AF+NDSS NF +FFF++F   + + +Q LG+  Y   +CGW+N L   + +      ML++A  FT+        L+KVHRLYR    S +KA+ EF
Sbjct:    6 LVVNVLASLFYMI------FAGGSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY---ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEF 145          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0332591)

HSP 1 Score: 162.925 bits (411), Expect = 3.260e-47
Identity = 106/279 (37.99%), Postives = 156/279 (55.91%), Query Frame = 2
Query:    5 DINPFQKGK----QIVQTEGMENYQPF-KNAPTSST------AKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLL-SFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNR---FAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            D NPF++      QI  T      QP  +N P   T      A ++  +   E+L+++Q+ELD +A+ELDRRE++   L  +   +NN+PPL  +FC  K CFYQD  VEIPP++  +V R Y++WI     L+ N+   L     +        +F  +I   +LF PASYVCWFRP Y AF+NDSS NF +FFFI F Q + S++QA+G   +G CG++  +            G  +L  A  FT ++V   + + K+H +YR+T AS  KA++EF
Sbjct:   42 DYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEELQRRQEELDRKAAELDRREQQ---LQGNVPQLNNWPPLPDNFC-VKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEFE----TFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEF 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0074079)

HSP 1 Score: 162.925 bits (411), Expect = 3.260e-47
Identity = 106/279 (37.99%), Postives = 156/279 (55.91%), Query Frame = 2
Query:    5 DINPFQKGK----QIVQTEGMENYQPF-KNAPTSST------AKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLL-SFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNR---FAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            D NPF++      QI  T      QP  +N P   T      A ++  +   E+L+++Q+ELD +A+ELDRRE++   L  +   +NN+PPL  +FC  K CFYQD  VEIPP++  +V R Y++WI     L+ N+   L     +        +F  +I   +LF PASYVCWFRP Y AF+NDSS NF +FFFI F Q + S++QA+G   +G CG++  +            G  +L  A  FT ++V   + + K+H +YR+T AS  KA++EF
Sbjct:   42 DYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEELQRRQEELDRKAAELDRREQQ---LQGNVPQLNNWPPLPDNFC-VKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEFE----TFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEF 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 183.726 bits (465), Expect = 4.112e-55
Identity = 110/280 (39.29%), Postives = 153/280 (54.64%), Query Frame = 2
Query:    5 DINPFQKGKQIVQTEGMENYQPFKNAPT------SSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF--GVNAASSV 820
            D  P   G          N QP    PT      + + +  D  +   +L ++Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFY DI+V+IP +Y   V   Y+LW+   G L  N+F  L +F   ++    G  FG ++L  +LF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA+GI   G+ GW++ L  L+ +   G  M++ A  FT  +V   +   KVH LYR T ASFEKA+ EF  GV A  +V
Sbjct:   42 DTKPVPPGSAPKSVPPTTNTQPAIMKPTEEPPAYTQSQQTPDQSRAQAELLRRQEELERKAAELDRREREMQSLNASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEYQKTVKIMYYLWMFHTGTLFANIFGCLSWFCVDASR---GVDFGLAMLWFMLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGITGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHALYRTTGASFEKAQQEFATGVMANKTV 318          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp3 (secretory carrier membrane protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-33])

HSP 1 Score: 183.341 bits (464), Expect = 6.676e-55
Identity = 113/255 (44.31%), Postives = 152/255 (59.61%), Query Frame = 2
Query:   89 SSTAKNSDTKKMYEDLEKKQKELDLRASELDRRERE-QSHLLND-SSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVISGTRYSAT 847
            S +A N+ T     DL KKQ+EL+ +A EL+RRERE  +H L   +S  NN+PPL SFCP   CFYQDIN+EI   +   VT  Y+ W+     L++NL + L  F    N    G  FG +IL  LLF P S+VCW+RP+Y AF++DSS NFF FFF+ FAQ+V+ V+  +GI   G  GW+  L  L  ++  G  M++ A  FT       V L +VH +YR T+ASFEKA++EF     S+     R +AT
Sbjct:   81 SQSAVNATTA----DLLKKQEELERKAQELERRERELNAHALGSGASRQNNWPPLPSFCPVGPCFYQDINLEISQSFQRTVTTMYYYWMFTACTLLINLISCLAVFCVDPNN---GVGFGLAILWFLLFTPCSFVCWYRPVYKAFRSDSSFNFFAFFFVFFAQLVLYVMMTIGIPGWGFSGWIVSLAALSTSKAVGAIMMMNAVLFTAQLAMGIVLLKRVHSMYRQTEASFEKAQAEFATGVLSN--QAVRQAAT 326          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp2l (secretory carrier membrane protein 2, like [Source:ZFIN;Acc:ZDB-GENE-030131-6432])

HSP 1 Score: 179.104 bits (453), Expect = 1.927e-53
Identity = 114/289 (39.45%), Postives = 164/289 (56.75%), Query Frame = 2
Query:    2 MDINPFQKGK--QIVQT--EGMENYQPF--------KNAPTSSTAKNSDTKKMYE------------DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            +D+NPFQ     Q+  T  +G+  Y PF        +  P S+T++ +  +   E            +L ++Q EL+ +A+EL+R+E+E           NN+PPL  F P K CFYQD N EIP +Y  +    Y+LW+     L LNL A L YF  S   T  G  FG SIL  +LF P ++VCW+RP+Y AFK+DSS +FF FFFI   Q++V +IQ++GI   G+ GW+  + ++  N     FM+V A  FT+ +VF  + L  VH +YR+T ASF+KA+ EF
Sbjct:   13 VDVNPFQDPSVTQVTNTSADGIGEYNPFTAGALDGHRTVPLSATSQPAVLQTTVEPSPQASVASGQAELLRQQAELERKAAELERKEQELRDRDAARGKENNWPPLPKFLPIKPCFYQDFNEEIPVEYQRVCKMMYYLWMYHSVTLFLNLLACLVYFTVS---TQNGVDFGLSILWFILFTPVAFVCWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPGWGNSGWITAISVIKTNIALSVFMMVVAGFFTVNAVFSVILLKMVHSMYRHTGASFQKAQEEF 298          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp2 (secretory carrier membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2702])

HSP 1 Score: 169.474 bits (428), Expect = 1.062e-49
Identity = 114/288 (39.58%), Postives = 162/288 (56.25%), Query Frame = 2
Query:    2 MDINPFQKGK--QIVQT--EGMENYQPFKNAPTSSTAKNSDTKKMYEDLE-------------------KKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            +D+NPFQ     Q+  +  + +E++ PF +    ST   S        L+                   K+Q+EL+ +A+EL+RRE+E       +   NN+PPL    P + CFYQD + EIP ++  +    Y+LW+  C  L LN+ A L  F T+S A   G  FG SIL  +LF P S++CWFRP+Y AF++DSS NFF FFF+ FAQIV+SVIQA+GI   G+ GW++ + ++  N+  G  M+V A  FT  +    V L  VH  YR T ASF+KA+ EF
Sbjct:   13 VDVNPFQDPSVTQVTNSGVDHIESFSPFPDGNQGSTIPASSAPTQPAVLQPSVEPSPQATAAAAQASLIKQQEELERKAAELERREQELQSRGAPTGKQNNWPPLPKRFPIQPCFYQDFSEEIPQEHQRLCKMIYYLWMWECVTLFLNVLACLADFTTNSEA---GVDFGLSILWFILFAPCSFICWFRPVYKAFRSDSSFNFFFFFFVFFAQIVISVIQAVGIPKWGNSGWISAISVIGSNKAVGAIMMVVAAFFTAAAALSVVLLKMVHSHYRRTGASFQKAQQEF 297          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp5a (secretory carrier membrane protein 5a [Source:NCBI gene;Acc:324467])

HSP 1 Score: 147.517 bits (371), Expect = 1.762e-42
Identity = 87/193 (45.08%), Postives = 111/193 (57.51%), Query Frame = 2
Query:  230 NNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNA 808
            NNFPPL  F P K CFYQD N EIP Q+  +  R Y+LWI     L +NL   L +      AT    +FG +IL  +LF P SYVCWFRP+Y AFK+DSS NF  FFF+  AQ+V+S+IQ +GI   G CGWL  +     N  +   ML+    FT ++V   + L KVH  YR +  S  KA+ E+   A
Sbjct:    4 NNFPPLPRFIPLKPCFYQDFN-EIPDQHRTMCKRLYYLWILNSATLAVNLIGCLAWMCGGGGAT----NFGMAILWLILFTPCSYVCWFRPIYKAFKSDSSFNFMAFFFVFMAQVVISIIQTVGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSGGSMSKAQEEWTSGA 191          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 182.57 bits (462), Expect = 1.350e-54
Identity = 117/301 (38.87%), Postives = 157/301 (52.16%), Query Frame = 2
Query:   11 NPFQKGKQIVQT-----EGMENYQPFKNAPTSSTAK------------------------NSDTKK---MYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            NPF K   + Q       G+E Y PF ++ T   AK                        N  +K+      +L K+Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFYQD +V+IP ++   V   Y+LW+     L +N+F  L +F   S     G  FG +IL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G    G+CGW++ L  L+Q+   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   16 NPF-KDPSVTQVTRNVPSGLEEYNPFSDSQTPQPAKVKMPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSG---RGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 182.57 bits (462), Expect = 1.565e-54
Identity = 117/301 (38.87%), Postives = 157/301 (52.16%), Query Frame = 2
Query:   11 NPFQKGKQIVQT-----EGMENYQPFKNAPTSSTAK------------------------NSDTKK---MYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            NPF K   + Q       G+E Y PF ++ T   AK                        N  +K+      +L K+Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFYQD +V+IP ++   V   Y+LW+     L +N+F  L +F   S     G  FG +IL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G    G+CGW++ L  L+Q+   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   16 NPF-KDPSVTQVTRNVPSGLEEYNPFSDSQTPQPAKVKMPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSG---RGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 182.57 bits (462), Expect = 2.944e-54
Identity = 117/301 (38.87%), Postives = 157/301 (52.16%), Query Frame = 2
Query:   11 NPFQKGKQIVQT-----EGMENYQPFKNAPTSSTAK------------------------NSDTKK---MYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            NPF K   + Q       G+E Y PF ++ T   AK                        N  +K+      +L K+Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFYQD +V+IP ++   V   Y+LW+     L +N+F  L +F   S     G  FG +IL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G    G+CGW++ L  L+Q+   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   16 NPF-KDPSVTQVTRNVPSGLEEYNPFSDSQTPQPAKVKMPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSG---RGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp2 (secretory carrier membrane protein 2 [Source:NCBI gene;Acc:407901])

HSP 1 Score: 178.718 bits (452), Expect = 4.408e-53
Identity = 106/270 (39.26%), Postives = 151/270 (55.93%), Query Frame = 2
Query:    5 DINPFQKGKQIVQTEGM------ENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            + NPF +G  +               QP    P+      +        L ++Q+EL+ +A++LDR+E+E  ++ N +   NN+PPL   CP K CFYQDI+V+IP  Y       Y+LW+     L LNL A L YF   S     G  FG SIL  ++F P +++CW+RP+Y AF+ DSS +FF+FF I F QIV+ +IQA+GI   G  GW+  L M+  N      M+V A+ FT+ SVF    L +VH +YR T ASF++A+ EF
Sbjct:   36 EFNPFSEGSHLTNPNQKTIPAQPAQSQPAVLQPSVEPTPQAAAMAAQTGLLQQQEELERKAADLDRKEQEMRNV-NINLRQNNWPPLPPKCPIKPCFYQDISVDIPADYQRTCKMLYYLWMLHTFTLFLNLLACLSYFTAVSTG---GVDFGLSILWFVMFTPCAFLCWYRPIYKAFRTDSSFSFFVFFIIFFCQIVIYIIQAVGIPGWGDSGWIMALSMIKTNIAVTVIMIVVASFFTVCSVFSLFLLKRVHSMYRRTGASFQRAQEEF 301          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp5 (secretory carrier membrane protein 5 gene 2 [Source:NCBI gene;Acc:779947])

HSP 1 Score: 146.747 bits (369), Expect = 5.410e-42
Identity = 85/197 (43.15%), Postives = 109/197 (55.33%), Query Frame = 2
Query:  218 SSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNA 808
            S   NNFPPL  F P K CFYQD + +IP  +     R Y+LW+     L +NL   L + I   +AT    +FG + L  +LF P SYVCWFRP+Y AFK DSS NF  FFF    Q+V+S+IQA+GI   G CGW+  +     +  A   ML+    FT ++V   V L KVHR YR    S  KA+ E+   A
Sbjct:    2 SDKPNNFPPLPRFIPLKPCFYQDFDTDIPDLHRTTAKRLYYLWMLNSITLGVNLIGCLAWLIGGGSAT----NFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFNFMAFFFTFTGQLVISIIQAVGIPGWGVCGWIATISFFGTSIGAAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGA 194          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 184.882 bits (468), Expect = 3.903e-56
Identity = 110/257 (42.80%), Postives = 149/257 (57.98%), Query Frame = 2
Query:   59 NYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S+  +    FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L++N   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:    6 NTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAV---DFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 184.882 bits (468), Expect = 3.903e-56
Identity = 110/257 (42.80%), Postives = 149/257 (57.98%), Query Frame = 2
Query:   59 NYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S+  +    FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L++N   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:    6 NTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAV---DFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 186.037 bits (471), Expect = 5.172e-56
Identity = 114/279 (40.86%), Postives = 157/279 (56.27%), Query Frame = 2
Query:    5 DINPFQKGKQI----VQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S+  +    FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L++N   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 EYNPFSDSRTPPPGSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAV---DFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp3 (secretory carrier membrane protein 3 [Source:MGI Symbol;Acc:MGI:1346346])

HSP 1 Score: 175.637 bits (444), Expect = 7.411e-52
Identity = 108/231 (46.75%), Postives = 146/231 (63.20%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L    +  NN+PPL SFCP K CF+QDI++EIP ++   V+  Y+LW+     L+LN FA L  F      T +G+ FG S+L  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V  V+QA+GI   G  GW+  L+++         ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:  100 ELLKKQEELNRKAEELDRRERELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFFACLARFCVD---TGSGSGFGLSMLWLLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLKRIHSLYRQTGASFQKAQQEFAAGVFSN 327          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp3 (secretory carrier membrane protein 3 [Source:MGI Symbol;Acc:MGI:1346346])

HSP 1 Score: 175.637 bits (444), Expect = 7.519e-52
Identity = 108/231 (46.75%), Postives = 146/231 (63.20%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L    +  NN+PPL SFCP K CF+QDI++EIP ++   V+  Y+LW+     L+LN FA L  F      T +G+ FG S+L  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V  V+QA+GI   G  GW+  L+++         ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:  101 ELLKKQEELNRKAEELDRRERELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFFACLARFCVD---TGSGSGFGLSMLWLLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLKRIHSLYRQTGASFQKAQQEFAAGVFSN 328          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q58DR5|SCAM3_BOVIN (Secretory carrier-associated membrane protein 3 OS=Bos taurus OX=9913 GN=SCAMP3 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 2.474e-56
Identity = 110/232 (47.41%), Postives = 152/232 (65.52%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYF-ITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L + ++  NN+PPL SFCP + CF+QDI++EIP ++   V+  Y+LW+     L+LN  A L  F + +SN    G+ FG SIL  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V+ V+QA+GI   G  GW++ L++L  N      ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:   98 ELLKKQEELNRKAEELDRRERELQHAALGSTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETSN----GSGFGLSILWILLFTPCSFVCWYRPMYKAFRSDSSSNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVLKVNTAVAVLMLLVALFFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 325          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15126|SCAM1_HUMAN (Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 1.189e-55
Identity = 115/279 (41.22%), Postives = 155/279 (55.56%), Query Frame = 2
Query:    5 DINPFQKGKQI----VQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S        FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L+QN   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 EYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDS---ARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O14828|SCAM3_HUMAN (Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3)

HSP 1 Score: 187.578 bits (475), Expect = 1.384e-55
Identity = 108/231 (46.75%), Postives = 147/231 (63.64%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRREREQSH--LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L KKQ+EL+ +A ELDRRERE  H  L   ++  NN+PPL SFCP + CF+QDI++EIP ++   V+  Y+LW+     L+LN  A L  F   +N    G  FG SIL  LLF P S+VCW+RP+Y AF++DSS NFF+FFFI F Q V+ V+QA+GI   G  GW++ L++   N      ML+ A  FT ++V   V L ++H LYR T ASF+KA+ EF     S+
Sbjct:   98 ELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNN---GAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 325          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q8K021|SCAM1_MOUSE (Secretory carrier-associated membrane protein 1 OS=Mus musculus OX=10090 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.618e-55
Identity = 114/279 (40.86%), Postives = 157/279 (56.27%), Query Frame = 2
Query:    5 DINPFQKGKQI----VQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S+  +    FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L++N   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 EYNPFSDSRTPPPGSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAV---DFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|P56603|SCAM1_RAT (Secretory carrier-associated membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.657e-55
Identity = 114/279 (40.86%), Postives = 157/279 (56.27%), Query Frame = 2
Query:    5 DINPFQKGKQI----VQTEGMENYQPFKNAPTSSTAKNSDTKKMYE----DLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      V+   + N QP    PT      +   K +     +L K+Q+EL+ +A+ELDRRERE  +L +     NN+PPL S  P   CFYQD +V+IP ++   V   Y+LW+     L LN+F  L +F   S+  +    FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA G +  G+CGW++ L  L++N   G  M++ A  FT  +V   V   KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 EYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNL-SQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAV---DFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A4S2KAL2 (Secretory carrier-associated membrane protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011151 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.055e-68
Identity = 124/275 (45.09%), Postives = 174/275 (63.27%), Query Frame = 2
Query:   38 VQTEGMENYQPFK---NAPTSSTAKNSDTKKMYE----------DLEKKQKELDLRASELDRREREQSHLLND--SSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +QT  + +Y PF+   +  T + A N D    Y           +LE++QKELD +A+EL RRE EQ+ L        + N+PPL SF PC+ CFYQDI++EI  +Y  IV  GY+LW++  G+L++N   +L YF  +  +   G+ FG SI++C+   PAS++CWFRPLY AF++DSSINFFIFF +  AQI+V +IQALGI   GSCGW+ GL  + +    GG  L  A  FT ++V   ++LI+VHR+YRNT ASF KA+ EF    +S+
Sbjct:   35 IQTGALGDYNPFERDTSTLTGTIASNPDFPPPYSSLEAQRLTTTELERRQKELDAKAAELARREAEQNRLAEQVRQGPIKNWPPLPSFFPCEPCFYQDIDLEINSEYRRIVRFGYYLWVAYAGLLLINFLGALLYFAGTGRSD-GGSLFGVSIIICIFCIPASFICWFRPLYKAFRSDSSINFFIFFIVFGAQILVLIIQALGILNWGSCGWITGLAAVKETPAIGGITLAIACFFTGMAVACALYLIRVHRIYRNTGASFGKAREEFARGVSSN 308          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A075AJ61 (Secretory carrier-associated membrane protein OS=Opisthorchis viverrini OX=6198 GN=T265_01121 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.308e-67
Identity = 128/283 (45.23%), Postives = 176/283 (62.19%), Query Frame = 2
Query:   38 VQTEGMENYQPFK---NAPTSSTAKNSDTKKMYE----------DLEKKQKELDLRASELDRREREQSHLL-----NDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF--GVNAASSVIS 826
            +QT  + +Y PF+   +  T + A N D    Y           +LE++QKELD +A+EL RRE EQ+ L           + N+PPL SF PC  CFYQDI++EI  +Y  IV  GY+LW++  G+L++N F +L YF  +  +   G+ FG SI+VC+   PAS++CWFRPLY AF++DSSINFFIFF +  AQI+V +IQ+LGI   GSCGW+ GL  +      GG  L  A  FT ++V    +LI+VHR+YRNT ASF KA+ EF  GV++  +V S
Sbjct:   48 IQTGALGDYNPFERDTSTLTGTIASNPDFPPPYSSLEAQRLTTTELERRQKELDAKAAELARREAEQNRLAEQVRQGSQGPIKNWPPLPSFFPCGPCFYQDIDLEINSEYRRIVRFGYYLWVAYAGLLLINFFGALLYFAGTGRSD-GGSLFGVSIIVCIFCIPASFICWFRPLYKAFRSDSSINFFIFFIVFGAQILVLIIQSLGILNWGSCGWITGLAAVKDTPAIGGITLAIACVFTGMAVACAFYLIRVHRIYRNTGASFGKAREEFTRGVSSNPTVQS 329          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267H8C9 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003135g2 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.058e-66
Identity = 115/244 (47.13%), Postives = 162/244 (66.39%), Query Frame = 2
Query:  128 EDLEKKQKELDLRASELDRREREQSHLLNDSS-------TVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITS--SNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF--GVNAASSVIS 826
            ++LE++Q+EL+ ++ EL+RRE EQ     +SS       + NN+PPL + CP   CFYQD + EIP +Y  +V  GY+LW+    +L++N+  +L YFI S  ++A  +GT FG S+LVC++  P SY+CWFRPLY AFKNDSS NFF FF +   QI V ++Q LGI +LGSCGW+NG   L     AG FM+V A  FT+L + + + +I+VHR+YR++ ASF KA+ E   GV A  +V S
Sbjct:   53 DELERRQRELEAKSRELERREAEQRQREAESSAGAAGSQSPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTDAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLFAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAANETVRS 296          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A3S5A8H2 (Secretory carrier-associated membrane protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS16156 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.328e-66
Identity = 126/302 (41.72%), Postives = 183/302 (60.60%), Query Frame = 2
Query:   38 VQTEGMENYQPFKNAPTSS---------------TAKNSDTKKMY-EDLEKKQKELDLRASELDRREREQSHLLNDSSTVN------NFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLI----------------KVHRLYRNTDASFEKAKSEF--GVNAASSVI 823
            V++EG++NY PF+N  TS+               +  + D +K+  E+LEK+Q+ELD RA+EL RRE EQ  L   +   +      N+PPL SF PC+ CFYQ+I +EI  +Y  +V  GY LW+   G+L++N+F S+ YF  +      G+ FG ++L  +LF P SYVCWFRPLY AF++DSS NFF+FFF+ FAQ++V VIQ+LGI  LG+CGW+ GL  + +  + G  +L  A  FT ++V    FL+                K+HR+YR T AS +KA+ EF  G+++  +VI
Sbjct:   40 VKSEGLDNYNPFENKVTSTLSSSEPNMTPLNDTGSPASQDIRKITNEELEKRQRELDARAAELQRREEEQRRLDERARAGDYNGAKKNWPPLPSFLPCRPCFYQNIEIEISEEYQKVVRMGYFLWMCYAGLLLINVFGSIFYFAGTQKPD-GGSVFGVALLTAILFAPLSYVCWFRPLYKAFRSDSSFNFFVFFFVFFAQVIVMVIQSLGITSLGACGWIVGLAAVREVGWVGAIVLAIAALFTSIAVVSGFFLVHIKITHDIVIQGTLFFKIHRIYRATGASLDKARQEFVSGMSSNPAVI 340          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267H8L5 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032262g1 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.528e-66
Identity = 115/244 (47.13%), Postives = 163/244 (66.80%), Query Frame = 2
Query:  128 EDLEKKQKELDLRASELDRREREQSHLLNDSS-------TVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITS--SNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF--GVNAASSVIS 826
            ++LE++Q+EL+ ++ EL+RRE EQ     +SS       + NN+PPL + CP   CFYQD + EIP +Y  +V  GY+LW+    +L++N+  +L YFI S  ++A  +GT FG S+LVC++  P SY+CWFRPLY AFKNDSS NFF FF ++  QI V ++Q LGI +LGSCGW+NG   L     AG FM+V A  FT+L + + + +I+VHR+YR++ ASF KA+ E   GV A  +V S
Sbjct:   45 DELERRQRELEAKSRELERREAEQRQREAESSAGAAGSQSPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTDAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLIAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAANETVRS 288          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:103021636])

HSP 1 Score: 187.963 bits (476), Expect = 7.369e-57
Identity = 112/254 (44.09%), Postives = 145/254 (57.09%), Query Frame = 2
Query:   56 ENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
             NY  +     + +A  +D  +  E+LE+K KEL+ R  ELD + R        SS  NN+PPL SFCP   CFYQDINVEI   +   VT  Y+ W+    +L  NL + L  F    +    G   G +IL  LLF P S+VCW+RP+Y AF++DSS NFF FFFI FAQ+VV VI  +GI   G  GW+ GL  L +N   G  ML+ A  FT  +    V L KVH +YR TDASF+KA++EF     S+
Sbjct:   71 RNYGSYGTQQAAVSATTADLLRKQEELERKAKELERRERELDSQSRS-----TGSSRQNNWPPLPSFCPVGPCFYQDINVEISQAFQRTVTIMYYFWMFTASVLAFNLISCLSLFCVDPSG---GVGLGLAILWILLFTPCSFVCWYRPVYKAFRSDSSFNFFAFFFIFFAQVVVYVIMTIGIPGWGFSGWIVGLYALKKNVAVGVIMLLNAVLFTAQAAMGVVMLKKVHSMYRQTDASFQKAQAEFATEVFSN 316          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:103025528])

HSP 1 Score: 184.496 bits (467), Expect = 1.854e-55
Identity = 109/277 (39.35%), Postives = 149/277 (53.79%), Query Frame = 2
Query:    5 DINPFQKGKQIVQTEGMENYQPFKNAPT------SSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            D  P   G          N QP    PT      S + +  D  +   +L ++Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFY DI+V+IP ++   V   Y+LW+   G L LN+F  L +F         G  FG ++L  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  V V+QA+GI   G+ GW++ L  L+ +   G  M++ A  FT  +V   +   KVH LYR T ASFEKA+ EF     S+
Sbjct:   42 DTKPAPPGSAPKAMPPTTNTQPAIMKPTEEPPAYSQSQQTQDQARAQAELMRRQEELERKAAELDRREREMQSLSASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEFQKTVKIMYYLWMFHTGTLFLNIFGCLAWFCVDP---YRGVDFGLAMLWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGIAGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHGLYRTTGASFEKAQQEFATGVMSN 315          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 175.637 bits (444), Expect = 3.509e-52
Identity = 113/292 (38.70%), Postives = 159/292 (54.45%), Query Frame = 2
Query:    2 MDINPFQKGKQIVQT----EGMENYQPFKNA-----------------------PTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            +D+NPFQ       T    + M+ Y PF  +                       P+   +  +       +L ++Q+EL+ +A+ELDRRE+E  +    +   NN+PPL    P K CFYQD + EIPP++  I    Y+LW+  C  L LN+ A L +F   +     G  FG SIL  +LF P S++CWFRP+Y AF+ DSSINFF FFFI FAQ+VV+VIQ++GI   G+ GW++ + ++  N      M+V A  FT+ +    V L  VH  YR T ASFEKA+ EF
Sbjct:   13 VDVNPFQDPSVTEVTHSGVDHMDQYTPFPASDTGNLTGSTIPASAVPSQPAVLQPSVEPSPQATAAAAQANLLRQQEELERKAAELDRREQELQNRDRTTGKENNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTADAGY---GVDFGLSILWFILFTPCSFLCWFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEF 301          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 174.096 bits (440), Expect = 4.565e-52
Identity = 110/267 (41.20%), Postives = 154/267 (57.68%), Query Frame = 2
Query:    2 MDINPFQKGKQIVQTEGMENYQPFKNAPTS-STAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFG 799
            +D+NPFQ               P + +P S     ++       +L ++Q+EL+ +A+ELDRRE+E  +    +   NN+PPL    P K CFYQD + EIPP++  I    Y+LW+  C  L LN+ A L +F   +     G  FG SIL  +LF P S++CWFRP+Y AF+ DSSINFF FFFI FAQ+VV+VIQ++GI   G+ GW++ + ++  N      M+V A  FT+ +    V L  VH  YR T ASFEKA+ EF 
Sbjct:   13 VDVNPFQ-------------VSPCRRSPHSLPLFPSATAAAAQANLLRQQEELERKAAELDRREQELQNRDRTTGKENNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTADAGY---GVDFGLSILWFILFTPCSFLCWFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEFS 263          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2l (secretory carrier-associated membrane protein 2-like [Source:NCBI gene;Acc:103024986])

HSP 1 Score: 172.555 bits (436), Expect = 4.574e-51
Identity = 111/291 (38.14%), Postives = 157/291 (53.95%), Query Frame = 2
Query:    2 MDINPFQKGK--QIVQT--EGMENYQPFKN----------------------APTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            +D+NPFQ     Q+  T  EG+E + PF                         PT   +  +       DL K+Q EL+ +A+EL R+E +           NN+PPL  F P K CFYQD N EIP ++  +    Y+LW+  C  L LN+ A L  F  ++     G  FG SIL  LLF PA+++CW+RP+Y AFK+DSS +FF FFFI   Q++V +IQ++GI   G+ GW++ + +L+ N     FML+ A  FT+ +V   + L  VH  YR T ASF+KA+ EF
Sbjct:   13 VDVNPFQDPSVTQVTNTNTEGLEEFNPFSARALDDLSGSTIPITAASQPAVLQPTVEPSPRAAAAAAQADLLKQQAELERKAAELQRKEEDLQSRDTARGKENNWPPLPKFLPIKPCFYQDFNEEIPVEFHRVCKMMYYLWMYHCVTLFLNVLACLACFTVNAQK---GIDFGLSILWFLLFSPAAFICWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPSWGNSGWISAISVLNFNIGVAVFMLLVAMFFTVNAVLAVILLKMVHSKYRRTGASFQKAQEEF 300          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 184.111 bits (466), Expect = 4.792e-56
Identity = 117/281 (41.64%), Postives = 158/281 (56.23%), Query Frame = 2
Query:    5 DINPFQKGKQ----------IVQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            D NPF  G +          ++ T      QP +  P   T  ++       DL ++Q+EL+ +A+ELDRRERE       +   NN+PPL + CP   CFYQDI VEIP ++   V   Y++W+     L LNL   L +F  +   T  G  FG +IL  LLF P S+VCWFRP+Y AF++DSS NFF+FFFI F Q VV V+Q++GI   G+CGW+  L  L+ +   G  +++ A  FT  +V   V L KVH LYR T ASFEKA+ EF     S+
Sbjct:   36 DYNPFGDGSKPGALVGATPAVLPTSQPAVMQPTEEPP-PYTGPSASAAAAQADLLRRQEELEKKAAELDRREREM-QTQPGAVKKNNWPPLPTQCPVGPCFYQDIPVEIPVEFQKTVRMLYYMWMFHAVTLFLNLLGCLAWFCVN---TARGIDFGMAILWFLLFTPCSFVCWFRPVYKAFRSDSSFNFFLFFFIFFCQFVVHVMQSIGIPGWGNCGWIASLEALNHSIGVGIILMLLAAFFTGSAVLSVVMLKKVHSLYRQTGASFEKAQQEFATGVMSN 311          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 139.043 bits (349), Expect = 3.981e-40
Identity = 84/194 (43.30%), Postives = 109/194 (56.19%), Query Frame = 2
Query:  227 VNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNA 808
            VNNFPPL  F   K CFYQD N +IP  +   V R Y+LWI     L++NL   L + I   +A     +FG +IL  +LF P SYVCWFR +Y  F++DSS N+ +FFF    Q+V+++IQA+GI   G CGW+  +     N   G  ML     FT L+V   + LIKVH  YR    S  KA+ EF   A
Sbjct:    5 VNNFPPLPKFVRLKPCFYQDFNEDIPEPHRLSVKRLYYLWIMHGITLVVNLIGCLAWLIGGGSAV----NFGLAILWLILFTPCSYVCWFRAVYKGFRSDSSFNYMLFFFTFSGQVVLNIIQAVGIPGWGVCGWIATISYFGTNIGVGVVMLFPTIMFTGLAVISFLALIKVHSFYRGGGGSVGKAQQEFSTGA 194          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 97.0561 bits (240), Expect = 1.403e-25
Identity = 50/99 (50.51%), Postives = 63/99 (63.64%), Query Frame = 2
Query:  230 NNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLW-ISLCGI-LMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFK 520
            NNFPPL  F   K CFYQDI  +IPP +   V R Y+LW +S+ G+ L +NL   L + I   +A    T+FG +I+  LLF P SYVCWFRP+Y AFK
Sbjct:    8 NNFPPLPKFIRLKPCFYQDIEGDIPPPHTQTVKRLYYLWDVSVQGLTLAVNLIGCLAWIIGGGSA----TNFGLAIVWLLLFTPCSYVCWFRPIYKAFK 102          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Match: EDO31962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE3])

HSP 1 Score: 145.206 bits (365), Expect = 6.429e-41
Identity = 83/232 (35.78%), Postives = 126/232 (54.31%), Query Frame = 2
Query:  128 EDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATM-AGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSV-FETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            E+L K+Q++L+ +A+EL R+E+E   +       NNFPPL  +  CK CFY DI V+IP +Y  +    +  W +   ++  N   +L    TS+      G +FG SIL  +   PAS++CW+RP Y A KNDSS ++ IFF I F  I +++   LG+   GSCG++      H    A   M+       +  V  + + ++KVHR+YR   AS EKA+ EF    A++
Sbjct:   92 ENLRKRQEDLERKAAELQRKEQELQRMQYSGYRENNFPPLPKWFKCKPCFYHDIQVDIPIEYQKLCRFLFIRWQAYSFVMFYNFIVALALLSTSATGNHNEGKTFGLSILYLVWNVPASFLCWYRPAYKALKNDSSFSYIIFFLIFFLHISINIYYTLGMPGGGSCGFITATDTWHGTNKAVSIMMFICAAMLLAGVGIDCILIVKVHRIYRQAGASLEKAQGEFAKGVATN 323          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:101169127])

HSP 1 Score: 187.963 bits (476), Expect = 7.645e-57
Identity = 105/250 (42.00%), Postives = 145/250 (58.00%), Query Frame = 2
Query:   65 QPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAAS 814
            +P    P  S  +  +  +   +L ++Q+EL+ +A+ELDRRERE   L       NN+PPL    P   CFY DI+V+IP ++  IV   Y+LW+   G L+ NL A L +F   +     G  FG SIL  LLF P S+VCW+RPLY AF++DSS  FF+FFF+   Q  + VIQ +GI   G+ GW++ LM L+ +   G  M++ A  FT L+V   +   K+H LYR T ASFEKA+ EF     S
Sbjct:   67 KPSDEPPAYSQPQGQEATRAAAELLRRQEELERKAAELDRREREMQTLSASGGRKNNWPPLPENLPVAPCFYHDISVDIPVEFQKIVKIMYYLWMFHTGTLLANLIACLSWFCVDATH---GVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYVCQFGIYVIQCIGISGWGASGWISALMGLNTSIPVGIIMILVAALFTSLAVMSLIMFKKIHALYRTTGASFEKAQQEFATGVMS 313          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 185.652 bits (470), Expect = 7.399e-56
Identity = 113/288 (39.24%), Postives = 158/288 (54.86%), Query Frame = 2
Query:    5 DINPFQKGKQIVQTEG-------MENYQPFKNAPTS---------STAKNSDTKKMYEDLEKKQKELDLRASELDRRERE-QSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            + NPF   +      G        +N QP    PT          +  +  D  +   +L ++Q+EL+ +A+ELDRRERE Q+H    +   NN+PPL    P   CFY DI V+IP ++   V   Y+LW+   G L +N+F  L +FI  ++    G  FG ++L  LLF P S++CW+RPLY AF++DSS  FF+FFFI   Q  V V+QA+GI   G+CGW+  L  L+ +   G  ML+ A  FT L+V   +   KVH LYR T ASFEKA+ EF     S+
Sbjct:   37 EYNPFTDARTAAPGSGPKSAPAPSQNTQPAIMKPTEEPPAYTQQQTQRRTEDQARAQAELLRRQEELEKKAAELDRRERELQTH--GAAGRKNNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFIVDASR---GVDFGLAMLWFLLFTPCSFICWYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 319          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:101156986])

HSP 1 Score: 184.496 bits (467), Expect = 1.806e-55
Identity = 122/261 (46.74%), Postives = 155/261 (59.39%), Query Frame = 2
Query:   50 GMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRRERE-QSHLLNDSST-VNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVIS 826
            G  N QP  NA TS             DL +KQ+EL+ +A EL+RRERE QSH L   +T  NN+PPL SFCP   CFYQDI+VEI  ++   V+  Y+ W+   G L+ NL +S   F   S+ +  G   G SIL  LLF P S+VCW+RP+Y AF+ DSS NFFIFFFI FAQ+ V VI  +GI   G  GW+  L  L  +   G  M++ A  FT  +    V L K+H LYR TDASF+KA++EF    AS V+S
Sbjct:   73 GSYNSQPAVNAATS-------------DLLRKQEELERKAQELERRERELQSHSLGPGATRQNNWPPLPSFCPVGPCFYQDIDVEIAQRFQRTVSTMYYFWMVCAGALLFNLISSFANFC--SDPSGGGVGLGLSILWALLFTPCSFVCWYRPVYKAFRTDSSFNFFIFFFIFFAQVCVFVIMTIGIPGWGFSGWIVSLAALRTSTGVGVIMVMNAIVFTGQAAMGVVMLKKIHSLYRQTDASFQKAQAEF----ASGVMS 314          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 181.03 bits (458), Expect = 1.952e-54
Identity = 103/230 (44.78%), Postives = 142/230 (61.74%), Query Frame = 2
Query:  131 DLEKKQKELDLRASELDRRERE-QSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +L ++Q+EL+ +A+ELDRRERE Q+H    +   NN+PPL    P   CFY DI V+IP ++   V   Y+LW+   G L +N+F  L +FI  ++    G  FG ++L  LLF P S++CW+RPLY AF++DSS  FF+FFFI   Q  V V+QA+GI   G+CGW+  L  L+ +   G  ML+ A  FT L+V   +   KVH LYR T ASFEKA+ EF     S+
Sbjct:   62 ELLRRQEELEKKAAELDRRERELQTH--GAAGRKNNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFIVDASR---GVDFGLAMLWFLLFTPCSFICWYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:101162341])

HSP 1 Score: 179.489 bits (454), Expect = 1.363e-53
Identity = 102/239 (42.68%), Postives = 150/239 (62.76%), Query Frame = 2
Query:   83 PTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRRERE-QSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEF 796
            P+S  +  +   +   DL ++Q+EL+ +A+ELDRRE+E QS     +   NN+PPL    P K CFYQD + EIP +Y  +    Y+LW+  C  L LNL A + +FIT S     G  FG SIL  +LF P S++CW+RP+YNAFK DSS +FF FFF+ F Q+VV +IQ++G+   G+ GW+  + ++  N+  GG M++ +  FT+ +    + L  VH +YR+T ASF+KA+ EF
Sbjct:   70 PSSDPSPQASAARAQADLLRQQEELERKAAELDRREQELQSR--GSTGKENNWPPLPKSFPIKPCFYQDFSEEIPVEYQRVCKMTYYLWMFNCVTLFLNLLACMAHFITDSKY---GVDFGLSILWLILFSPCSFICWYRPVYNAFKTDSSFSFFTFFFVFFCQVVVFIIQSVGLPNWGNSGWIAAISIIGSNKAVGGIMIIVSILFTLCAAVSIILLKMVHSMYRHTGASFQKAQQEF 303          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000037804.1 (SMESG000037804.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 283/284 (99.65%), Postives = 284/284 (100.00%), Query Frame = 2
Query:    2 MDINPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVISGTRYSATAQ 853
            MDINPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELD+RASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSINFFIFFFIMFAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVISGTRYSATAQ
Sbjct:    1 MDINPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDMRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSINFFIFFFIMFAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVISGTRYSATAQ 284          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000075964.1 (SMESG000075964.1)

HSP 1 Score: 199.134 bits (505), Expect = 1.590e-61
Identity = 128/290 (44.14%), Postives = 182/290 (62.76%), Query Frame = 2
Query:    5 DINPFQ---------KGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKK---------MYEDLEKKQKELDLRASELDRREREQSH-LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            D NPF            K  VQTE + ++ PF+N P    A  ++ KK            DLE++Q+EL+ RA+EL R+E EQ    +     + NFPPL S+ P K CFYQ+I+VEIP +Y  +V  G+++WI+   I+ +N+F +L Y I+ +    +GT FG S+L+ LLF PASY+CWFR LY AF++DSS NFF+FFFI FAQ+++ +IQ LGI  LGSCGW+  L  L ++   G FM + +  +T + V  ++   KVHR+YR+T ASFEKAK+EF  + AS+
Sbjct:    9 DFNPFAVPPSKNDPPPYKPTVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADLERRQRELEERANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEGSSGTLFGMSLLLFLLFSPASYICWFRSLYKAFRSDSSFNFFMFFFIFFAQLIILIIQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 298          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000035622.1 (SMESG000035622.1)

HSP 1 Score: 181.415 bits (459), Expect = 8.155e-55
Identity = 112/271 (41.33%), Postives = 160/271 (59.04%), Query Frame = 2
Query:   20 QKGKQIVQTEGMENYQPFKNAPT---SSTAKNSDTKKMYEDLEKKQKELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAG--GFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 817
            +K +  V+T  +++Y+PF N P    +     +  K   +DLE+ Q++L+ R+  L   E E+ +    ++T NNFPPL   CP K CFYQ I+VEIP QY  IV  G+ LWI     L +N+F +L Y I+ +    +G  FG S+L   LF P SYV WFRPLY AFKN+SS NFF+FF I  +QI+V +IQ LGI +LG+CGW+   M    N+  G   FML+ A  F++        +I+V+  +R +  S +KAK EF  +A S+
Sbjct:   20 KKFQPTVKTNVIDDYEPFNNEPAILQTEATPVAKPKVTVDDLERMQRDLEERSQRL-AEEEERLNKPEYAATRNNFPPLPKCCPLKPCFYQAIDVEIPEQYRLIVKLGFILWICYSMTLFINIFGALSYMISINLKDESGPLFGLSMLYFFLFVPLSYVFWFRPLYKAFKNNSSFNFFLFFIIFGSQIIVLIIQVLGIKYLGACGWVVSFM---ANKTPGVMAFMLIIAAAFSLNLAASFYIIIRVNLYFRTSGGSLQKAKEEFHKDALSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000064285.1 (SMESG000064285.1)

HSP 1 Score: 147.902 bits (372), Expect = 3.330e-42
Identity = 90/273 (32.97%), Postives = 149/273 (54.58%), Query Frame = 2
Query:   38 VQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQKEL--------DLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSXXXXXXXXXXXAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKA-KSEFGVNAASSVISG 829
            V  + ++ Y PF     +      +     E++E  +K L        + +    D   +E + L++  S  NN+PP  + CP + CFY D +++IP ++  +V   Y++WI+    ++ N+F SL Y+IT  N+ ++G++FG++++  +LFP  S++ WF PLY A + DSS N+F+FF I+  QIV++ IQ LGI WLGSCG++N L M  ++   G  M      F+ L     + L KV+ +YR+      +A  S+F  N    VIS 
Sbjct:    5 VVYDALDEYNPFNENNKAQQPAVINVTNNPEEVEPTKKSLLSNSSNKKNFQGEREDGSYKESTKLID--SPGNNWPPFPTCCPIRPCFYIDFDLDIPEKHRGLVKFAYYIWITYAIAIVFNVFGSLAYYITE-NSMISGSTFGTALIFGILFPVLSFILWFWPLYKAIRWDSSTNYFMFFIIICCQIVITGIQMLGIDWLGSCGFINSLKMFRKDILTGCIMFFIGLWFSALFTLFLILLFKVNYIYRHAIVPDAQADNSKFSTNILKGVISA 274          
The following BLAST results are available for this feature:
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP14.209e-5842.12secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP31.566e-5646.75secretory carrier membrane protein 3 [Source:HGNC ... [more]
SCAMP31.566e-5646.75secretory carrier membrane protein 3 [Source:HGNC ... [more]
SCAMP12.476e-5641.22secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP32.883e-5646.75secretory carrier membrane protein 3 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scm-17.569e-4536.92Secretory carrier-associated membrane protein [So... [more]
scm-13.849e-4339.18Secretory carrier-associated membrane protein [So... [more]
scm-16.785e-2140.94Secretory carrier-associated membrane protein [So... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Scamp3.260e-4737.99gene:FBgn0040285 transcript:FBtr0332591[more]
Scamp3.260e-4737.99gene:FBgn0040285 transcript:FBtr0074079[more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp14.112e-5539.29secretory carrier membrane protein 1 [Source:ZFIN;... [more]
scamp36.676e-5544.31secretory carrier membrane protein 3 [Source:ZFIN;... [more]
scamp2l1.927e-5339.45secretory carrier membrane protein 2, like [Source... [more]
scamp21.062e-4939.58secretory carrier membrane protein 2 [Source:ZFIN;... [more]
scamp5a1.762e-4245.08secretory carrier membrane protein 5a [Source:NCBI... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp11.350e-5438.87secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp11.565e-5438.87secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp12.944e-5438.87secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp24.408e-5339.26secretory carrier membrane protein 2 [Source:NCBI ... [more]
scamp55.410e-4243.15secretory carrier membrane protein 5 gene 2 [Sourc... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scamp13.903e-5642.80secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp13.903e-5642.80secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp15.172e-5640.86secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp37.411e-5246.75secretory carrier membrane protein 3 [Source:MGI S... [more]
Scamp37.519e-5246.75secretory carrier membrane protein 3 [Source:MGI S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58DR5|SCAM3_BOVIN2.474e-5647.41Secretory carrier-associated membrane protein 3 OS... [more]
sp|O15126|SCAM1_HUMAN1.189e-5541.22Secretory carrier-associated membrane protein 1 OS... [more]
sp|O14828|SCAM3_HUMAN1.384e-5546.75Secretory carrier-associated membrane protein 3 OS... [more]
sp|Q8K021|SCAM1_MOUSE3.618e-5540.86Secretory carrier-associated membrane protein 1 OS... [more]
sp|P56603|SCAM1_RAT3.657e-5540.86Secretory carrier-associated membrane protein 1 OS... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KAL21.055e-6845.09Secretory carrier-associated membrane protein OS=O... [more]
A0A075AJ611.308e-6745.23Secretory carrier-associated membrane protein OS=O... [more]
A0A267H8C91.058e-6647.13Secretory carrier-associated membrane protein (Fra... [more]
A0A3S5A8H21.328e-6641.72Secretory carrier-associated membrane protein OS=P... [more]
A0A267H8L51.528e-6647.13Secretory carrier-associated membrane protein (Fra... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp37.369e-5744.09secretory carrier membrane protein 3 [Source:NCBI ... [more]
scamp11.854e-5539.35secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp23.509e-5238.70secretory carrier-associated membrane protein 2 [S... [more]
scamp24.565e-5241.20secretory carrier-associated membrane protein 2 [S... [more]
scamp2l4.574e-5138.14secretory carrier-associated membrane protein 2-li... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scamp14.792e-5641.64secretory carrier membrane protein 1 [Source:ZFIN;... [more]
SCAMP53.981e-4043.30secretory carrier membrane protein 5 [Source:HGNC ... [more]
SCAMP51.403e-2550.51secretory carrier membrane protein 5 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319626.429e-4135.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp17.645e-5742.00secretory carrier membrane protein 1 [Source:NCBI ... [more]
SCAMP17.399e-5639.24secretory carrier-associated membrane protein 1 [S... [more]
scamp31.806e-5546.74secretory carrier membrane protein 3 [Source:NCBI ... [more]
SCAMP11.952e-5444.78secretory carrier-associated membrane protein 1 [S... [more]
scamp21.363e-5342.68secretory carrier-associated membrane protein 2 [S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000037804.10.000e+099.65SMESG000037804.1[more]
SMESG000075964.11.590e-6144.14SMESG000075964.1[more]
SMESG000035622.18.155e-5541.33SMESG000035622.1[more]
SMESG000064285.13.330e-4232.97SMESG000064285.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008035 ID=SMED30008035|Name=Secretory carrier-associated membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=979bp
AATGGATATCAATCCTTTTCAAAAGGGCAAACAAATAGTTCAAACCGAAG
GAATGGAAAATTATCAACCATTCAAAAACGCCCCAACGAGCAGCACAGCG
AAAAATTCAGATACTAAAAAAATGTACGAAGATTTGGAGAAGAAACAGAA
AGAATTGGATCTGAGAGCTTCGGAATTGGATCGTCGAGAAAGAGAGCAAA
GCCATTTGTTGAATGACAGCTCGACTGTCAACAACTTCCCTCCTCTTCTA
TCGTTTTGTCCATGCAAATCATGCTTCTATCAAGATATAAATGTTGAAAT
TCCTCCACAATATATCAACATTGTCACTCGAGGATATCATTTATGGATAT
CCCTTTGTGGTATACTGATGTTAAATTTGTTTGCTAGCCTCGGTTACTTT
ATTACATCATCCAACGCTACGATGGCAGGAACTAGTTTTGGAAGCTCGAT
TTTAGTGTGTCTTCTATTCCCACCGGCATCCTACGTTTGCTGGTTTCGCC
CGCTTTACAACGCTTTCAAAAATGATAGTTCTATCAATTTTTTTATTTTT
TTCTTTATAATGTTCGCACAAATAGTGGTTTCCGTAATACAGGCATTGGG
TATTTATTGGTTGGGTTCATGTGGCTGGCTCAATGGATTAATGATGCTGC
ACCAAAATCGGTTCGCGGGCGGATTTATGCTTGTGACAGCCACGGGATTT
ACGATTCTATCGGTTTTCGAAACTGTTTTCCTAATAAAGGTGCACAGGCT
TTATAGGAACACCGATGCTAGTTTTGAGAAAGCCAAATCGGAATTCGGCG
TTAACGCCGCGTCAAGCGTCATTTCTGGAACACGTTATTCCGCTACAGCA
CAATAAGTTGTTATGTCTATGTTTGGTCATAATATTTGTTATTCATTGTT
AATATTGATTTCGTGATTTCGTCAATGTGCGCATTTATTATTAATCTATA
ATGTAATACATTTATATTTTGGTCTTGAA
back to top

protein sequence of SMED30008035-orf-1

>SMED30008035-orf-1 ID=SMED30008035-orf-1|Name=SMED30008035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MDINPFQKGKQIVQTEGMENYQPFKNAPTSSTAKNSDTKKMYEDLEKKQK
ELDLRASELDRREREQSHLLNDSSTVNNFPPLLSFCPCKSCFYQDINVEI
PPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSI
LVCLLFPPASYVCWFRPLYNAFKNDSSINFFIFFFIMFAQIVVSVIQALG
IYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRL
YRNTDASFEKAKSEFGVNAASSVISGTRYSATAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR007273SCAMP
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006810transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 35..65
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 8..36
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..39
NoneNo IPR availablePANTHERPTHR10687:SF6SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN 3coord: 33..271
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 181..203
IPR007273SCAMPPFAMPF04144SCAMPcoord: 77..254
e-value: 2.2E-56
score: 190.9
IPR007273SCAMPPANTHERPTHR10687SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN SCAMPcoord: 33..271