Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30008018
Length (bp)1301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30008018) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30008018) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30008018) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30008018) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008018

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30008018SMESG000045575.1 SmedASXL_012403SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008018SMESG000045575.1 dd_Smed_v4_15893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008018SMESG000045575.1 dd_Smed_v4_15893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30008018SMESG000045575.1 SMED30008018smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 308.916 bits (790), Expect = 2.114e-101
Identity = 151/365 (41.37%), Postives = 218/365 (59.73%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP-----LKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E I F  LY  ISL+YR +L G  K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD +  L+++ + G+D    ++RR ++RY+NL+ +L  RS+S    K     + ++      ++E KLF+ + S   +Y++P +W  NL  K   EGRI+  +  ++L+ E+  YR   + LF YDWV  PLVYTQ  T++VY +F   L  +QFLDP K Y     D Y+P+F++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ KD  W++S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCI-PSFLGSTV 364          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 308.916 bits (790), Expect = 4.301e-98
Identity = 151/365 (41.37%), Postives = 218/365 (59.73%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP-----LKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E I F  LY  ISL+YR +L G  K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD +  L+++ + G+D    ++RR ++RY+NL+ +L  RS+S    K     + ++      ++E KLF+ + S   +Y++P +W  NL  K   EGRI+  +  ++L+ E+  YR   + LF YDWV  PLVYTQ  T++VY +F   L  +QFLDP K Y     D Y+P+F++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ KD  W++S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCI-PSFLGSTV 364          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 294.664 bits (753), Expect = 1.800e-93
Identity = 139/343 (40.52%), Postives = 206/343 (60.06%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MT+ Y  ++A+++   F ++L  W+GSIYK+ + E + F   Y II  IYR  L  + +  FE   ++CDS    IP++F++GFYVT++  RWW Q+ N+PWPD +  LV+ ++ G D +  ++RR +IRY NL  +L LRS+S    K     + L+        E K  +K+S   N +++P +W  NL  K +L GRI+  I  ++L+ E+   R +   L+ YDW++ PLVYTQ  T++VY +FLT L  +QFL+P K YP    D  VPVF+  Q FFY GWLKVAE LINPFGEDDDDF++  +++RNL      +       P++  D  WN+  P
Sbjct:    1 MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNKPEP 343          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 289.271 bits (739), Expect = 2.983e-92
Identity = 143/341 (41.94%), Postives = 203/341 (59.53%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F   Y  +S  YRFVL    K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  NL  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI++Y YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 289.271 bits (739), Expect = 2.983e-92
Identity = 143/341 (41.94%), Postives = 203/341 (59.53%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F   Y  +S  YRFVL    K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  NL  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI++Y YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 246.514 bits (628), Expect = 3.143e-75
Identity = 131/358 (36.59%), Postives = 204/358 (56.98%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPN---RHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESL--PLKIDDFIIDP 1144
            MTV Y+  +ASS  F   ++LF WKGSI+K  W EL+ +  LYA++S+IYR +L  K +  FE  CIF D+  N+IP+ F++GFYV+ +  RWW+ F NI W D   L +  YI G   R   +RRN IRY  L+  +  R ++   +K       L++  L   +E   F+ + S   +Y+ P+ W  +++     EG I ++I   +L+ ++  +R  +  L  +DWV  PLVYTQ   ++V  YFL +LF +Q+L P     N   +  D YVP+ S+ Q  F+ GW+KVAE L+NP GEDDDDF+   +++RNL      + +  + +P + KD+ W +++  PL   +  + P
Sbjct:    1 MTVTYSLDVASSSFFCLYKLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYRCLLTMKQRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKGETERAKCVRRNCIRYSILTQAMVYRDVAASVRKRFPTFNHLVTAGLMTEKEMAEFESIPSPHAKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEKDQFWEDAIAEPLYTAESAMRP 358          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 236.498 bits (602), Expect = 7.348e-72
Identity = 124/349 (35.53%), Postives = 197/349 (56.45%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHF--DYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKID 1126
            MTV Y+  +A+S  F  +++L  WKGS++K  W EL+ +   Y+I+S+IYR +L    +E FE  C F D+   +IPV F++GFYV+++  RW K F N+ W D  AL +  YI G   +  +IRRN +RY+ ++ ++  R +SP  ++     + LI   L   +E   FD ++S  ++Y+ PI W  +LV     EG I       +LI ++  +R K+  L  +D V  PLVYTQ   ++V  YF+ +LF +QFL+     P   +  D Y P+ +  Q+ F  GWLKV+E ++NP GEDD+DF++  +I RNL   +  +      +P + +D  W +  P  +D
Sbjct:    1 MTVAYSLDVATSGLFTQIKVLLRWKGSVWKSIWSELLIWLLCYSILSVIYRILLNKAQREVFEQLCTFFDTFSVFIPVTFMLGFYVSIVYNRWTKVFDNVGWIDTSALTIAQYIRGTSEKARLIRRNCVRYMIVAQVMVFRDVSPAIRRRFPTIKHLIGAGLLTEDELTEFDAITSPQSKYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQFLENNNNIPGAKWKIDIYFPIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYPTLKRDPFWEDETPQTMD 349          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-7 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q18303])

HSP 1 Score: 234.187 bits (596), Expect = 3.954e-71
Identity = 125/345 (36.23%), Postives = 200/345 (57.97%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESL-PL 1117
            MT +Y+  +A+S+    ++++F WKGS++K  + +LI +   YA IS+IYR+ L    ++ FE F  FC+   +YIP+ F++GF+VT +  RW  QF N+   DN+AL  + Y+SGND R  ++RR+I+R   +S  +  R I    +K     E +++  +  S E K +++V S + +Y++   W+ NL+ +   EGRI++      +  EI  +R  L+ ++ YDWV  PL+Y Q   ++++ Y+L  L S+QF+           D  VP  +I +  FY GWLKVA  L+NPFGED+DDFD   LI+RNLT     +       P + KD  WN+++ PL
Sbjct:    1 MTYNYHYDLATSQRKVILKLIFKWKGSLWKAIYLDLIVWCFCYAFISVIYRYALDRSQQDTFERFMQFCNRRLDYIPINFMLGFFVTTVINRWMTQFANLGMIDNIALFTSMYLSGNDERGRILRRSIVRMCVMSQTMVFRDIHIGVRKRFPTLETMVAAGIMTSSELKKYNEVESRYAKYWLGFNWTFNLLNEARREGRIESAYTQNAIAEEIRTFRSGLSLIWTYDWVPIPLMYPQLVFMAIHCYYLVCLVSRQFVINSDAVNTTEIDLGVPFMTIIEFIFYMGWLKVAMDLLNPFGEDEDDFDCNFLIDRNLTVAMGIVDDSHDDGPILEKDMFWNDTVSPL 345          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-21 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q9NA59])

HSP 1 Score: 220.32 bits (560), Expect = 2.046e-67
Identity = 116/342 (33.92%), Postives = 197/342 (57.60%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARN-LIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV+YN+ ++S   F F+++L  W+GSI+K   +EL  +   +A++ ++YR+++    ++ FE   I  +    +IP+ F++GF+VT++  RW   F NI + +NVAL V   ++G D    ++RR IIRY+ LS +L LR IS + ++     E L+S      +E +   K  + +N+Y++P  W+  LV K   E +    +++ N +++ I  +R+ +  L  YDWV  P+ Y Q   ++V +YF+  L S+Q+L      P       VP+ +I Q  F+ GW+KVAEAL+NP GEDDDDF+   LI+RN+++    + +     P +  D+  +ES
Sbjct:    1 MTVNYNQEVSSVNSFTFVKLLMTWRGSIWKSVRWELTMWVIAFAVVQMVYRYLMTEDQQKFFEYSAIHLNVRLIHIPLTFMLGFFVTIVVDRWRSVFTNIGFIENVALSVGTLVAGTDHAAKVLRRTIIRYLVLSQVLVLRDISMRVRRRFPTMESLVSGGFLYRDELERMYKCDTMYNKYWLPTHWANQLVHKAMFETKNVDSVQSMNSVLMNIKEFRQSMEMLTKYDWVPIPIAYPQVVFLAVRVYFIICLVSRQYL---LSAPPTEAQSIVPIMTILQFVFFVGWMKVAEALLNPLGEDDDDFECNWLIDRNMSTGIEIVDTCHDSCPPLKLDEPDDES 339          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 220.705 bits (561), Expect = 7.047e-67
Identity = 123/350 (35.14%), Postives = 192/350 (54.86%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLII-EIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESL-PLKIDD 1129
            ++ +YN  +A+SK    ++++F W+GS+++  + ELI +   Y+++S+IYRF L    K+ FE F  +CD+   Y+P+ F++GF+  +I RRW K + ++   DN+AL V+AY+ G D R   IRRNIIRY  +S  L  R I    ++     E +    +    E + F+ + S + +Y++   W++ L+     E  I  +  ARN I  EI  +R  L  +  YDWV  PL+Y Q   ++V+ YF   +F++QF      +     D Y+P  +I +  FY GWLKVA  L+NPFGED DDFD   LI+RNL      +       P++  D     S+ PL  DD
Sbjct:   44 LSYNYNYDLATSKSLMIVRMIFKWRGSLWQAVYKELIVWICAYSLVSVIYRFALTRSQKDIFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTDDRARQIRRNIIRYCVISQCLVFRDIHVGVRRRFPTLEAVAQAGIMLPHELEKFNSIKSRYQKYWVSFNWALELLNVAKTEKSIDGD-NARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSVDDAYDQLPEVKPDVFTGGSVKPLDSDD 392          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 283.108 bits (723), Expect = 5.313e-88
Identity = 142/380 (37.37%), Postives = 229/380 (60.26%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFK-FMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNR---YFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHF----DYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID*VSIFVIK 1201
            MT+ Y   +A+ + F  F+++L  W+GSIYK+ W +L+ F ++Y  I+++YRF L    KE FE    +CDS    IP++F++GFYV+++  RWW Q+ +IPWPD +A+ V++ + G D R  M+RR I+RY+ L L + L ++SP+ KK      +L+   L N  E  + + ++ +F R   +++PI+W+ +++ +   EGRI+ +   + +I E+  +R +   L  YD ++ PLVYTQ  T++VY YFLT    +Q+ D  K   N  +    D Y PVF+  Q FFY GWLKVAE+LINPFGEDDDDF+   +++RNL   +  +       P+++KD+ W+E  P ++  + I  + F +  P+     I V K
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD-GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWDEVFPNEL-PYTIAAERFRENHPEPSTAKIEVPK 378          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 283.108 bits (723), Expect = 6.959e-88
Identity = 142/380 (37.37%), Postives = 229/380 (60.26%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFK-FMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNR---YFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHF----DYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID*VSIFVIK 1201
            MT+ Y   +A+ + F  F+++L  W+GSIYK+ W +L+ F ++Y  I+++YRF L    KE FE    +CDS    IP++F++GFYV+++  RWW Q+ +IPWPD +A+ V++ + G D R  M+RR I+RY+ L L + L ++SP+ KK      +L+   L N  E  + + ++ +F R   +++PI+W+ +++ +   EGRI+ +   + +I E+  +R +   L  YD ++ PLVYTQ  T++VY YFLT    +Q+ D  K   N  +    D Y PVF+  Q FFY GWLKVAE+LINPFGEDDDDF+   +++RNL   +  +       P+++KD+ W+E  P ++  + I  + F +  P+     I V K
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD-GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWDEVFPNEL-PYTIAAERFRENHPEPSTAKIEVPK 378          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 283.108 bits (723), Expect = 1.424e-87
Identity = 142/380 (37.37%), Postives = 229/380 (60.26%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFK-FMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNR---YFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHF----DYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID*VSIFVIK 1201
            MT+ Y   +A+ + F  F+++L  W+GSIYK+ W +L+ F ++Y  I+++YRF L    KE FE    +CDS    IP++F++GFYV+++  RWW Q+ +IPWPD +A+ V++ + G D R  M+RR I+RY+ L L + L ++SP+ KK      +L+   L N  E  + + ++ +F R   +++PI+W+ +++ +   EGRI+ +   + +I E+  +R +   L  YD ++ PLVYTQ  T++VY YFLT    +Q+ D  K   N  +    D Y PVF+  Q FFY GWLKVAE+LINPFGEDDDDF+   +++RNL   +  +       P+++KD+ W+E  P ++  + I  + F +  P+     I V K
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD-GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWDEVFPNEL-PYTIAAERFRENHPEPSTAKIEVPK 378          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 282.722 bits (722), Expect = 2.398e-87
Identity = 142/380 (37.37%), Postives = 229/380 (60.26%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFK-FMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNR---YFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHF----DYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID*VSIFVIK 1201
            MT+ Y   +A+ + F  F+++L  W+GSIYK+ W +L+ F ++Y  I+++YRF L    KE FE    +CDS    IP++F++GFYV+++  RWW Q+ +IPWPD +A+ V++ + G D R  M+RR I+RY+ L L + L ++SP+ KK      +L+   L N  E  + + ++ +F R   +++PI+W+ +++ +   EGRI+ +   + +I E+  +R +   L  YD ++ PLVYTQ  T++VY YFLT    +Q+ D  K   N  +    D Y PVF+  Q FFY GWLKVAE+LINPFGEDDDDF+   +++RNL   +  +       P+++KD+ W+E  P ++  + I  + F +  P+     I V K
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD-GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYWDEVFPNEL-PYTIAAERFRENHPEPSTAKIEVPK 378          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 263.848 bits (673), Expect = 1.540e-82
Identity = 133/350 (38.00%), Postives = 210/350 (60.00%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFK-FMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNR---YFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKI 1123
            MTV Y   +A+   F  F ++L  W+ SIYKI W +L+ F S +  +++IYR+ L    K  FE   ++C S  N IP++F++GFYV +I  RWW Q+  +PWPD +A+ V+A + G D    ++RR I+RY+ L+L + L  ISP  K+     + LI   L N+ E  +   +   F +   Y++PI+W+ ++V +   EGRI  +   +++I E+  +R   N L  YD ++ PLVYTQ  T++VY YF+ S+F  Q++D   ++ N    YY P+FS  + FF+ GWLKVAE LI PFG+DDDDF+   LI+RNL   +  +    +  P++++D+ W+E  P ++
Sbjct:    1 MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQDEHGRLMRRTIMRYVCLALTMVLSMISPVIKRRFPTYDQLIEVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVRDQYWDEVFPAEL 350          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 317.775 bits (813), Expect = 1.042e-101
Identity = 146/343 (42.57%), Postives = 219/343 (63.85%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+RR+A ++   F ++L  WKGSIYK+ + EL+ F  +Y IIS+ YR VL  + +  FE   ++CD     IPV+F++GFYVT++  RWW QF ++PWPD ++ LV+ ++ G D    +IRR+++RY NLS IL  RS+S    K       L+   L  +EE +   ++ S  N++++P +W V+L  +   EGRI  ++    ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FLT L  +QFLDP + YP  + D+Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  L++RNL      +     L P + +DK W+E+ P
Sbjct:    1 MTVTYSRRVADARLGTFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVLTEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRGADEGARLIRRSLMRYANLSGILIYRSVSTAVYKRFPTMSHLVQAGLMTAEELRQLQELPSPHNKFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWDEAEP 343          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 290.041 bits (741), Expect = 1.117e-94
Identity = 140/343 (40.82%), Postives = 210/343 (61.22%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y  ++A++K   F ++LF WKGSIYK+ + E + F  LY  IS++YR VL    +E F      C+     IP++F++GFYVT   +RWW Q+ + P PDN+ ++V+  + G D R  ++RR ++RY NLS +L LRSIS + +K     ED++      ++E +  + + S FN+Y++P+ W  NL  +   EGR+K +I  R L+ E+ +YR K + LF YDW++ PLVYTQ  T++VY +F  SL  +QF+ P       H D Y+P+F++ + FFY GWLKV E +INPFGEDDDDF++  LI+RN+      +       P + KDK W +  P
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWVDKGP 341          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 292.352 bits (747), Expect = 1.567e-94
Identity = 144/345 (41.74%), Postives = 213/345 (61.74%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMG--FYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y  R+A+++   F ++L  WKGSIYK+ + E + F ++Y  IS+ YRF L    K  FE   I+CD+  + IP++F++G  FYVT++  RWW Q+ +IP PD V  +++  + G+D R  ++RR ++RY +LS +L LRS+S    K     + ++       EE K F+ + S +N+Y+IP +W  NL      EGRIK +   + L+ E+ ++R K + LF YD ++ PLVYTQ  T++VY +FL  L  +QFLDP + YP    D YVP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +       P + +D+ WN+S P
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFLVDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQGSDERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPMMERDRYWNDSNP 345          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 281.567 bits (719), Expect = 9.943e-92
Identity = 134/315 (42.54%), Postives = 201/315 (63.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNL 1030
            MTV Y  ++A++K   F ++LF WKGSIYK+ + E + F  LY  IS++YR VL    +E F      C+     IP++F++GFYVT   +RWW Q+ + P PDN+ ++V+  + G D R  ++RR ++RY NLS +L LRSIS + +K     ED++      ++E +  + + S FN+Y++P+ W  NL  +   EGR+K +I  R L+ E+ +YR K + LF YDW++ PLVYTQ  T++VY +F  SL  +QF+ P       H D Y+P+F++ + FFY GWLKV E +INPFGEDDDDF++  LI+RN+
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNI 313          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 172.94 bits (437), Expect = 7.658e-50
Identity = 78/182 (42.86%), Postives = 118/182 (64.84%), Query Frame = 2
Query:  569 LFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            L  +EE +   ++ S  N++++P +W V+L  +   EGRI  ++    ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FLT L  +QFLDP + YP  + D+Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  L++RNL      +     L P + +DK W+E+ P
Sbjct:    2 LMTAEELRQLQELPSPHNKFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWDEAEP 183          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 300.442 bits (768), Expect = 2.683e-98
Identity = 143/343 (41.69%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+ R+A ++   F ++L  W+GSIYK+ + E + F S Y IIS+ YRF+L  + +  FE   ++CD+    IPV+F++GFYVT++  RWW Q+ ++PWPD +  LV++ + G D R  M+RR ++RY NL+ +L LRS+S          + +++       E   FD + SS N++++P +W  NL      EGRI+  +  + ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FL  L  +QFLDP K YP    D YVPVF++ Q FFY GWLKVAE LINPFG+DDDDF++  LI+RNL      +       P + KD  WN+S P
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDP 343          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 299.671 bits (766), Expect = 5.831e-98
Identity = 143/343 (41.69%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+ R+A ++   F ++L  W+GSIYK+ + E + F S Y IIS+ YRF+L  + +  FE   ++CD+    IPV+F++GFYVT++  RWW Q+ ++PWPD +  LV++ + G D R  M+RR ++RY NL+ +L LRS+S          + +++       E   FD + SS N++++P +W  NL      EGRI+  +  + ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FL  L  +QFLDP K YP    D YVPVF++ Q FFY GWLKVAE LINPFG+DDDDF++  LI+RNL      +       P + KD  WN+S P
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDP 343          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 300.056 bits (767), Expect = 1.345e-97
Identity = 143/343 (41.69%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+ R+A ++   F ++L  W+GSIYK+ + E + F S Y IIS+ YRF+L  + +  FE   ++CD+    IPV+F++GFYVT++  RWW Q+ ++PWPD +  LV++ + G D R  M+RR ++RY NL+ +L LRS+S          + +++       E   FD + SS N++++P +W  NL      EGRI+  +  + ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FL  L  +QFLDP K YP    D YVPVF++ Q FFY GWLKVAE LINPFG+DDDDF++  LI+RNL      +       P + KD  WN+S P
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDP 343          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 300.827 bits (769), Expect = 1.769e-97
Identity = 143/343 (41.69%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+ R+A ++   F ++L  W+GSIYK+ + E + F S Y IIS+ YRF+L  + +  FE   ++CD+    IPV+F++GFYVT++  RWW Q+ ++PWPD +  LV++ + G D R  M+RR ++RY NL+ +L LRS+S          + +++       E   FD + SS N++++P +W  NL      EGRI+  +  + ++ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FL  L  +QFLDP K YP    D YVPVF++ Q FFY GWLKVAE LINPFG+DDDDF++  LI+RNL      +       P + KD  WN+S P
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYWNDSDP 343          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: ifitm3 (interferon induced transmembrane protein 3 [Source:Xenbase;Acc:XB-GENE-5852510])

HSP 1 Score: 303.908 bits (777), Expect = 2.655e-96
Identity = 150/365 (41.10%), Postives = 218/365 (59.73%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES-----LPLKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E + F SLY  +S+IYRF L    K  FE   ++CD     IPV F++GFYVT++  RWW QF N+PWPD +  L+++ + G D    ++RR ++RY+NL+ +L  RS+S    K     + ++      S+E KLFD + S   +Y++P++W  NL  K   EGRI+  I  + ++ E+  +R   + LF YDWV  PLVYTQ  T++VY +F   +  +QFLDP + YP    D Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ +D  WN+S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFLLFTSLYTTLSVIYRFFLTDSQKRYFEKVSMYCDKYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSNVHGRDEYGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTSDERKLFDSLKSPHLKYWVPVIWFGNLASKARSEGRIRDSIDLQMMMNEMNKFRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPKQAYPGHDLDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLMAVDEMHMNLPKMNRDIYWNDSDVRPPYTLAAADYCI-PSFLGSTV 364          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 313.153 bits (801), Expect = 7.964e-100
Identity = 154/365 (42.19%), Postives = 220/365 (60.27%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP-----LKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E I F  LY  ISL+YR +L G  K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD + LL+++ + G+D+   ++RR ++RY+NL+ +L  RS+S    K     + ++      ++E KLFD + S   +Y++P +W  NL  K   EGRI+  +  ++L+ E+  YR   + LF YDWV  PLVYTQ  T++VY +F   L  +QFLDP K Y     D YVP+F++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ KD  W++S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCI-PSFLGSTI 364          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 289.656 bits (740), Expect = 1.052e-93
Identity = 137/343 (39.94%), Postives = 202/343 (58.89%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MT+ Y  ++A+++   F  +L  W+GSIYK+ + E + F  LY  I  +YR VL    +  FE   ++CDS    IP++F++GFYVT++  RWW Q+ N+PWPD + + V++++ G D    ++RR +IRY  L  +L LRSIS    K       L+        E K   K+    N +++P +W  NL  K +L GRI+  +  ++L+ E+   R +  +L+ YDW++ PLVYTQ  T++VY +FL  L  +QFL+P K YP    D  VPVF+I Q  FY GWLKVAE LINPFGEDDDDF++  +I+RNL      +       P + +D  WNE+ P
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYWNEAAP 343          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 290.426 bits (742), Expect = 7.663e-93
Identity = 143/341 (41.94%), Postives = 205/341 (60.12%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F  LY  +S  YRF+L  + K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  +L  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI+VY YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 290.426 bits (742), Expect = 7.663e-93
Identity = 143/341 (41.94%), Postives = 205/341 (60.12%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F  LY  +S  YRF+L  + K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  +L  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI+VY YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 290.426 bits (742), Expect = 7.663e-93
Identity = 143/341 (41.94%), Postives = 205/341 (60.12%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F  LY  +S  YRF+L  + K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  +L  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI+VY YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 5.571e-99
Identity = 154/365 (42.19%), Postives = 220/365 (60.27%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP-----LKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E I F  LY  ISL+YR +L G  K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD + LL+++ + G+D+   ++RR ++RY+NL+ +L  RS+S    K     + ++      ++E KLFD + S   +Y++P +W  NL  K   EGRI+  +  ++L+ E+  YR   + LF YDWV  PLVYTQ  T++VY +F   L  +QFLDP K Y     D YVP+F++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ KD  W++S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCI-PSFLGSTI 364          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8N1M1|BEST3_HUMAN (Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.065e-97
Identity = 151/365 (41.37%), Postives = 218/365 (59.73%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP-----LKIDDFIIDPKFFSDTL 1165
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E I F  LY  ISL+YR +L G  K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD +  L+++ + G+D    ++RR ++RY+NL+ +L  RS+S    K     + ++      ++E KLF+ + S   +Y++P +W  NL  K   EGRI+  +  ++L+ E+  YR   + LF YDWV  PLVYTQ  T++VY +F   L  +QFLDP K Y     D Y+P+F++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       PK+ KD  W++S       L   D+ I P F   T+
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCI-PSFLGSTV 364          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.904e-93
Identity = 140/343 (40.82%), Postives = 205/343 (59.77%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MT+ Y  ++A+++   F ++L  W+GSIYK+ + E   F   Y II  IYR  L  + +  FE   ++CDS    IP++F++GFYVT++  RWW Q+ N+PWPD +  LV+ ++ G D +  ++RR +IRY NL  +L LRS+S    K     + L+        E K  +K+S   N +++P +W  NL  K +L GRI+  I  ++L+ E+   R +   L+ YDW++ PLVYTQ  T++VY +FLT L  +QFL+P K YP    D  VPVF+  Q FFY GWLKVAE LINPFGEDDDDF++  +++RNL      +       P++  D  WNE  P
Sbjct:    1 MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFFIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNEPEP 343          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 8.643e-93
Identity = 139/343 (40.52%), Postives = 206/343 (60.06%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MT+ Y  ++A+++   F ++L  W+GSIYK+ + E + F   Y II  IYR  L  + +  FE   ++CDS    IP++F++GFYVT++  RWW Q+ N+PWPD +  LV+ ++ G D +  ++RR +IRY NL  +L LRS+S    K     + L+        E K  +K+S   N +++P +W  NL  K +L GRI+  I  ++L+ E+   R +   L+ YDW++ PLVYTQ  T++VY +FLT L  +QFL+P K YP    D  VPVF+  Q FFY GWLKVAE LINPFGEDDDDF++  +++RNL      +       P++  D  WN+  P
Sbjct:    1 MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNKPEP 343          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 8.148e-92
Identity = 143/341 (41.94%), Postives = 205/341 (60.12%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y  R+A+++   F Q+L LW+GSIYK+ W EL+ F  LY  +S  YRF+L  + K  FE   I+CD   + IPV+F++GFYVT++  RWW Q+  +P PD +  +V   + G D R  + RR ++RY  LS +L LRS+S    K     + ++       EE K F+ ++SS+N+Y++P +W  +L  +   EGRI+     + L+ E+  +R K   LF YDW++ PLVYTQ  TI+VY YFL  L  +QFLDP + Y +   D  VP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +         + KD  W+ +
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAA 341          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A3Q0KLS6 (Bestrophin homolog OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 2.311e-108
Identity = 155/342 (45.32%), Postives = 223/342 (65.20%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVS-SSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y+  +A++K + F+++LF+WKGS+Y++ WFE + F  +Y+++S+ YRF+L    K  FE+ CI+C   +  +PVAF++GFYV++I +RWW+QF  +PWPD +AL + A+  GN  R   IRRNI+RYINLS  + LR+IS + +     EE L+S  L   EE  ++     S +  YF+P++W++++V K   EG I+ +     L  EI  +R KL  +F YDWVNPPLVYTQT TI+VY YF T L + Q+LDP K+Y     D YVP+F + + FFY GWLKVAE+LINPFGED DDF+   LI RNL   +  +       P +++D  WN +
Sbjct:    1 MTVTYSSVVATAKYWTFIRLLFMWKGSVYRLVWFEFLVFVGIYSVLSVTYRFILSATLKRYFELLCIYCGRYNETVPVAFVLGFYVSLIVQRWWEQFLALPWPDRLALFITAFCHGNAERPTRIRRNIVRYINLSYCIALRAISSRARLRFPTEEHLVSAGLMTQEELDIYRSTQPSEYTLYFVPLVWALDMVTKAREEGYIRFDRAVEILTNEITSFRGKLGTIFAYDWVNPPLVYTQTVTIAVYGYFGTCLLAWQYLDPSKKYEGHDVDIYVPIFGLLRFFFYIGWLKVAESLINPFGEDVDDFEIEYLIERNLQVSYLIVDGMHHEHPDLVRDAYWNTT 342          
BLAST of Bestrophin homolog vs. TrEMBL
Match: C1L441 (Bestrophin homolog OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 9.986e-108
Identity = 155/342 (45.32%), Postives = 222/342 (64.91%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVS-SSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y+  +A++K + F+++LF+WKGS+Y++ WFE + F  +Y+++S+ YRF+L    K  FE  CI+C   +  +PVAF++GFYV++I +RWW+QF ++PWPD +AL + A+  GN  R   IRRNI+RYINLS  + LR+IS + +     EE L+S  L   EE  ++     S +  YF+P++W++++V K   EG I  +     L  EI  +R KL  +F YDWVNPPLVYTQT TI+VY YF T L + Q+LDP K+Y     D YVP+F + + FFY GWLKVAE+LINPFGED DDF+   LI RNL   +  +       P +++D  WN +
Sbjct:    1 MTVTYSSIVATAKYWTFIRLLFMWKGSVYRLVWFEFLVFVGIYSVLSVTYRFILSATLKRYFEQLCIYCGRYNETVPVAFVLGFYVSLIVQRWWEQFLSLPWPDRLALFITAFCHGNAERPTRIRRNIVRYINLSYCIALRAISSRARLRFPTEEHLVSAGLMTQEELDIYRSTQPSQYTLYFVPLVWALDMVTKAREEGYIHFDRAVEILTDEITSFRSKLGTIFAYDWVNPPLVYTQTVTIAVYGYFGTCLLAWQYLDPSKKYEGHEIDIYVPIFGLLRFFFYIGWLKVAESLINPFGEDVDDFEIEYLIERNLQVSYLIVDGMHHEHPDLVRDAFWNTT 342          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A504Z0E6 (Bestrophin homolog OS=Fasciola gigantica OX=46835 GN=FGIG_05512 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.399e-105
Identity = 154/342 (45.03%), Postives = 218/342 (63.74%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVS-SSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y   +A++    F+++LFLWKGS+Y++ WFEL+ F  +Y+I+SL YRF+L G  K  FE  C++C+  +  IPV F++GFYV+++  RWW+QF ++PWPD +AL + AY  GND R   IRR ++RY NL+  + LR+IS + +      E L+S  L   EE  +  K   + +  YF+P++W++N+V +   EG I+ +     L  EI  +R KL  +F YDW+NPPLVYTQ ATI VY YFL  LF+ Q+LD  K YP    D YVPVF + + FFY GWLKVAE+LINPFGED DDF+   LI RNL   +  +       P++++D  W  +
Sbjct:    1 MTVSYASIVATTTYSTFLRLLFLWKGSVYRLIWFELLIFTGIYSILSLTYRFLLTGMMKTYFEWLCLYCNQHNEMIPVPFVLGFYVSLVVTRWWEQFLSLPWPDQLALQMTAYCHGNDERPTRIRRTVMRYTNLAYCIALRAISSRARLRFPTAEHLVSAGLMTEEELDVLVKTEPTEYQLYFVPLVWALNIVSQARQEGHIRFDRAVEILTEEITSFRGKLGTIFAYDWINPPLVYTQMATIVVYSYFLACLFAWQYLDLSKGYPGYDIDIYVPVFGLLRFFFYIGWLKVAESLINPFGEDADDFEIEYLIERNLNVSYLIVDEMHHEHPELVRDAFWGTA 342          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A4E0RID6 (Bestrophin homolog OS=Fasciola hepatica OX=6192 GN=D915_008570 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.001e-105
Identity = 154/342 (45.03%), Postives = 218/342 (63.74%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVS-SSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y   +A++    F+++LFLWKGS+Y++ WFEL+ F  +Y+I+SL YRF+L G  K  FE  C++C+  +  IPV F++GFYV+++  RWW+QF ++PWPD +AL + AY  GND R   IRR ++RY NL+  + LR+IS + +      E L+S  L   EE  +  K   + +  YF+P++W++N+V +   EG I+ +     L  EI  +R KL  +F YDW+NPPLVYTQ ATI VY YFL  LF+ Q+LD  K YP    D YVPVF + + FFY GWLKVAE+LINPFGED DDF+   LI RNL   +  +       P++++D  W  +
Sbjct:    1 MTVSYASIVATTTYSTFLRLLFLWKGSVYRLIWFELLIFTGIYSILSLTYRFLLTGMMKTYFEWLCLYCNQHNEMIPVPFVLGFYVSLVVTRWWEQFLSLPWPDQLALQMTAYCHGNDERPTRIRRTVMRYTNLAYCIALRAISSRARLRFPTAEHLVSAGLMTEEELDVLVKTEPTEYQLYFVPLVWALNIVSQARQEGHIRFDRAVEILTEEITTFRGKLGTIFAYDWINPPLVYTQMATIVVYSYFLACLFAWQYLDLSKGYPGYDIDIYVPVFGLLRFFFYIGWLKVAESLINPFGEDADDFEIEYLIERNLNVSYLIVDEMHHEHPELVRDAFWGTA 342          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A4Z2D171 (Bestrophin homolog OS=Schistosoma japonicum OX=6182 GN=EWB00_005699 PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 6.131e-105
Identity = 151/316 (47.78%), Postives = 212/316 (67.09%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVS-SSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNL 1030
            MTV Y+  +A++K + F+++LF+WKGS+Y++ WFE + F  +Y+++S+ YRF+L    K  FE  CI+C   +  +PVAF++GFYV++I +RWW+QF ++PWPD +AL + A+  GN  R   IRRNI+RYINLS  + LR+IS + +     EE L+S  L   EE  ++     S +  YF+P++W++++V K   EG I  +     L  EI  +R KL  +F YDWVNPPLVYTQT TI+VY YF T L + Q+LDP K+Y     D YVP+F + + FFY GWLKVAE+LINPFGED DDF+   LI RNL
Sbjct:    1 MTVTYSSVVATAKYWTFIRLLFMWKGSVYRLVWFEFLVFVGIYSVLSVTYRFILSATLKRYFEQLCIYCGRYNETVPVAFVLGFYVSLIVQRWWEQFLSLPWPDRLALFITAFCHGNAERPTRIRRNIVRYINLSYCIALRAISSRARLRFPTEEHLVSAGLMTQEELDIYRSTQPSQYTLYFVPLVWALDMVTKAREEGYIHFDRAVEILTNEITSFRSKLGTIFAYDWVNPPLVYTQTVTIAVYGYFGTCLLAWQYLDPSKKYEGHEIDIYVPIFGLLRFFFYIGWLKVAESLINPFGEDVDDFEIEYLIERNL 316          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 324.709 bits (831), Expect = 6.588e-104
Identity = 154/343 (44.90%), Postives = 216/343 (62.97%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+RR+A ++   F  +L  WKGSIYK+ + EL+ F  LY  IS++YRF+L  + +  FE   I+CD     IPV+F++GFYVT++  RWW QF ++PWPD +A LV AY+ G D    +IRR+++RY NLS +L  RSIS    K     E L+   L   EE +  D + S  N++++P +W VNL  +   EGRI  ++    ++ E+   R +  KL+ YDW++ PLVYTQ  T++VY +FL  L  +QFLDP + Y     D+Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  L++RNL      +     L P + +DK WNES P
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWNESEP 343          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 289.271 bits (739), Expect = 4.931e-91
Identity = 142/343 (41.40%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y  R+A+++   F ++L  W+GSIYK+ + E++ F  LY  IS+ YRF L  + K  FE   I+C+   + IP++F++GFYVT+I  RWW Q+ +IP PD++  +++  + G D R  ++RR ++RY +L+ +L LRS+S    K     + ++       EE K F+ + S +N+Y+IP +W  NL      EGRIK +   + L+ E+  +R K + LF YD ++ PLVYTQ  T++VY +FL  L  +QFLDP + YP    D YVP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +       P + +D+ WN+S P
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLDEQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQGGDERGRLLRRTLMRYASLASLLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMFGDLPMMERDRYWNDSNP 343          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 287.73 bits (735), Expect = 5.972e-90
Identity = 143/343 (41.69%), Postives = 202/343 (58.89%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+RR+A ++   F  +L  WKGSIYK+ + EL+ F  LY  IS++YRF+L  + +  FE   I+CD     IPV+F++GFYVT++  RWW QF ++PWPD +A LV AY+ G D    +IRR+++RY NLS +L  RSIS    K     E L+   L   EE +  D + S  N++++P +W VNL  +   EGRI  ++ A + I+ ++                         T++VY +FL  L  +QFLDP + Y     D+Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  L++RNL      +     L P + +DK WNES P
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDV-ALSAILNVV-------------------------TVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYWNESEP 317          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 271.552 bits (693), Expect = 1.743e-87
Identity = 141/342 (41.23%), Postives = 208/342 (60.82%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQ-TATISVYIYFLTSLFSKQFLDPIKRYPNR-HFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNE 1105
            MTV Y   +A+++   F ++LF WKGSIYK+ + E + F  LY++ SLIYR VL    +E FE     C+     IP++F++ FYVT   +RWW Q+ + P PDN+ ++V+  + G+D R  ++RR ++RY NLS +L LRSIS +  K     + ++       EE +  D + S FN+Y++P+ W  NL  K   EGR+K +I  R L+ E+ +YR K + LF YDW++ PLVYTQ   T++VY +F   L  +QF+ P +    + H D YVPVF++ + FFY GWLKV E +INPFGEDDDDF++  LI+RN+      +       P + KDK W +
Sbjct:    1 MTVSYTLEVANARFAGFTKLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVLTDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGSDERGRLLRRTLMRYANLSSVLILRSISTRVHKRFPTLQHIVD-AFMTEEEMRTLDHLYSDFNKYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVHVDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWTD 340          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 166.777 bits (421), Expect = 2.066e-46
Identity = 79/175 (45.14%), Postives = 109/175 (62.29%), Query Frame = 2
Query:  581 EEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNE 1105
            EE K+F+ + S   +Y+IP +W  NL  K   +GRI+  +  + ++ E+  +R   + LF YDWV  PLVYTQ  T++VY +F  S+  +QFLDP + YP    D YVPVF++ Q FFY GWLKVAE LINPFGEDDDDF++   I+RNL      +       P++ KD  WN+
Sbjct:   88 EEKKIFENLKSPHLKYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAVDEMHMNIPRMTKDVYWND 262          

HSP 2 Score: 80.4925 bits (197), Expect = 4.852e-16
Identity = 37/84 (44.05%), Postives = 56/84 (66.67%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGF 337
            MTV Y+ ++A++  F F ++L  W+GSIYK+ + E +FF  LY+I+SL+YR+VL    +  FE   I+CD     IPV F++GF
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDPQRRLFEKLSIYCDRYAEQIPVTFVLGF 84          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 288.115 bits (736), Expect = 8.007e-93
Identity = 139/343 (40.52%), Postives = 202/343 (58.89%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y  R+A+++   F ++L  W+GSIYK+ + E   +  +YA +SL  RF L    K  FE   ++C++  N IPV    GFYV ++  RWW Q+ +IP PD +   V   + G D R  ++RR ++RY NLS +L LRS+S    K     + ++       +E K FD +  S+N+Y++P +W  +L  +   EGR++ ++  + L+ E+  YR     LF YDW++ PLVYTQ  T++VY +FL  L  +QFLDP + YP    D Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RNL      +       P + +D  WN S P
Sbjct:    1 MTVTYTNRVANARLCGFSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFALSEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGVDERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTRDERKRFDGLRCSYNKYWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAVDEMYQNLPLLQRDMYWNASDP 343          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 277.33 bits (708), Expect = 2.153e-90
Identity = 133/343 (38.78%), Postives = 204/343 (59.48%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+ ++A+++   F Q+L  WKGSIYK+ + E   F  L+  +S +YR++L    K  FE   ++C+     IPV+F++GFYVT++  RWW Q+ ++PWPD +  LV   + G D R  ++RR ++RY NLS +L LRS+S    K     + ++        E + FD + S  N++++P +W  NL  +   EGRI   +  + ++ ++ ++R   + L+ YDWV+ PLVYTQ  T++VY +FL  L  +QFL P + YP    D Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++   ++RNL      +       P +  D  W++  P
Sbjct:    1 MTVTYSNKVANARLGGFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQENQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHGADERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTPAERRKFDGLRSPHNKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGP-QGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLMGVDEMYRDLPPLEHDVYWDDISP 342          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 305.834 bits (782), Expect = 7.425e-97
Identity = 151/343 (44.02%), Postives = 214/343 (62.39%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y+RR+A +    F  +L  WKGSIYK+ + ELI F  LY  +SL+Y ++L    +  FE   I+CD     IPV+F++ FYVT++  RWW QF NIPWPD +A LV  ++ G D  + + RR ++RY+NLS +L  RS+S    K     E L+   L  SEE + F+++ S  N++++P +W VNL  +   EGRI  ++    ++ E+   R K  KL+ YDW++ PLVYTQ AT++VY +FL  L  +QFLDP + YP    D+Y+PVF++ Q FFY GWLKVAE LINPFGEDDDDF++  +++RNL      +       P + KD  WN+S P
Sbjct:    1 MTVTYSRRVADAGLGTFFHLLLRWKGSIYKLLYRELIIFTLLYYFLSLVY-YMLDNDQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHVRGTDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRFPTTEHLVQ-ALMTSEELRHFEELPSPHNKFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSVDEMYDSLPLVEKDVYWNDSEP 340          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 301.212 bits (770), Expect = 1.251e-95
Identity = 143/341 (41.94%), Postives = 207/341 (60.70%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y+ ++A++    F ++L  W+GSIYK+ + E + F  LY I+SLIYR  L  + K  FE   I+CD     IPV F++GFYVT++  RWW QF N+PWPD +   +++ + G D    ++RR ++RYINL+ +L  RS+S    K     + ++       EE K+F+ + S   +Y+IP++W  NL  +   EGRI+  I  +N++ E+  +R     LF YDWV  PLVYTQ  T++VY +F   +  +QFLDP + +P    D YVPVF++ Q FFY GWLKVAE LINPFGEDDDDF++  +I+RNL      +       P + KD  WN+S
Sbjct:    1 MTVTYSSKVANATFLSFHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSEQQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGKDEYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRFPTIDHVVEAGFMTPEERKVFENIRSPHLKYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHMTKDIYWNDS 341          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 295.049 bits (754), Expect = 9.815e-94
Identity = 146/343 (42.57%), Postives = 212/343 (61.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLP 1114
            MTV Y  R+A+++   F ++L  WKGSIYK+ + E + F  LYA IS+ YRF LY   K  FE   I+C+   + IP++F++GFYVT+I  RWW Q+ +IP PD +  +++  + GND R  ++RR+++RY +LS +L LRS+S    K     + ++       EE K F+ + S +N+Y+IP +W  NL      EGRI+ +   + L+ E+  +R K + LF YD V+ PLVYTQ  T++VY +FL  L  +QFLDP + Y     D YVP+F++ Q FFY GWLKVAE LINPFGEDDDDF++  LI+RN       +       P + +D+ WN+S P
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYEDQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQGNDERGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFEGLHSPYNKYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPVMERDRYWNDSNP 343          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000045575.1 (SMESG000045575.1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 363/364 (99.73%), Postives = 364/364 (100.00%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID 1177
            MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISG+DRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID
Sbjct:    1 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGSDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID 364          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000040095.1 (SMESG000040095.1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.267e-143
Identity = 194/334 (58.08%), Postives = 257/334 (76.95%), Query Frame = 2
Query:  176 IAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFIIDPKFFSDTLPKID 1177
            + WFEL+ FG LY+ IS++YR +L G YKE FE FCI+CDSI N++P+AFI+ FYVTMIA RWW+QF  IPWPD+VAL VN YI GN  + VM++RN++RY+N+SL+L+LRS+SPQTKK    E  L+   LFN  EF LF+++  ++NRY++PI+W+ NL+KK F++G IKTE R  N+I+EI  +RE+L KLF YDWVNPPLVYTQTATI+VY YF+TSLFS+QFLDP K Y N + D+YVPVF + QL FYFGWLKVAE LINPFGEDDDDFD +GLI RN+T+ F F++      P ++KD  W+   P+K++++  D  FF  ++ ++D
Sbjct:    1 MVWFELVLFGILYSSISIMYRNLLSGLYKEQFERFCIYCDSIGNFMPIAFILSFYVTMIANRWWEQFNIIPWPDHVALFVNTYIPGNSVKLVMLKRNVVRYLNISLLLYLRSVSPQTKKRFPTEASLMDARLFNETEFNLFNQIDPTYNRYYVPIIWASNLIKKAFIDGDIKTEGRLNNIILEISQFRERLIKLFSYDWVNPPLVYTQTATIAVYTYFVTSLFSRQFLDPNKGYRNHNIDFYVPVFFLIQLVFYFGWLKVAECLINPFGEDDDDFDCLGLIERNITANFIFVKPLIEPHPVLMKDVFWDVESPIKLNNYKDDVNFFVGSMVRLD 334          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000054993.1 (SMESG000054993.1)

HSP 1 Score: 300.442 bits (768), Expect = 2.137e-98
Identity = 155/346 (44.80%), Postives = 222/346 (64.16%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKI 1123
            MT+ Y   +A+SK + F+++L  WKGSIYKI WFE+I F +LY  +S +YRF LYG YK+ FE FC F     + IPV F++GFYVT++  RWW QF  IPWPD++A+ V+ +I GND ++VM RR I+RY+NLS  +   SIS + K++  + + LI   L   +E K+ ++  ++  +YF+P LW+ NLV +   E     E     LI EI  +R  L  ++C+DW+NPPLVYTQ ATISV+ YF+  +F++QF+   K       D YVP+F   Q  FY GWLKVAE+LINPFG+DDDDF+   +I+RN+   +  I      +P++ KD  WN +  ++I
Sbjct:    1 MTITYINTVATSKYWTFLRLLLRWKGSIYKIIWFEMIVFATLYTGLSCLYRFGLYGIYKKRFEEFCAFSKKNADMIPVPFVLGFYVTLVVSRWWNQFMEIPWPDSMAIYVSTFILGNDDKSVMYRRTIMRYLNLSFCMTFASISSKAKRMFPDLKTLIENGLLTKDEEKILNEYETNNAKYFVPALWASNLVYQAESEKMTIGERGVETLIEEIGKFRGSLGMIYCFDWINPPLVYTQIATISVHAYFMIFVFAEQFISKDK------VDVYVPMFGFLQFVFYMGWLKVAESLINPFGDDDDDFEIDEMIHRNIKMSYLIIDEMHDSYPELDKDVFWNSNRDIQI 340          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000057100.1 (SMESG000057100.1)

HSP 1 Score: 262.692 bits (670), Expect = 1.454e-84
Identity = 134/344 (38.95%), Postives = 201/344 (58.43%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVL---YGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNES 1108
            MTV Y+  +     +    IL  WKGS++K+  FE + F S+Y  +SLIYRFVL   + K +  F   C +C  I N IPVAF++GFYV+++   W +QF ++PWPD++AL ++A++ G     V++RR I+RY+N+ +I+  R IS  T K+    E +    L N  E K    +  S+N+Y++P++W+ NL++    +  IK + +   L+  +  +R  L  LF + W++PPLVYTQ ATI+VY YFL +L + QF+       +   DY  P F + Q  FY GWLKVAE L++PFGE DDDFD   LI RN+   +  +       P+I KD  W + 
Sbjct:    1 MTVIYSGSLGKVHFWTVFAILLRWKGSVFKLVRFEALIFFSIYGSLSLIYRFVLVPYHTKSEFVFSFMCQYCIEIMNRIPVAFVLGFYVSIVINWWSEQFKSLPWPDDIALQLSAFLQGETDEIVLLRRTIVRYVNMGMIIAFRGISKSTLKLFSTLESMKKAGLMNMSELKALQSIDRSYNKYYVPLVWAANLIRDARRKNLIKDDRQLDVLVETLTSFRGILCDLFVHQWISPPLVYTQVATITVYCYFLAALMAWQFI-------SGKDDYIFPFFGMLQFLFYVGWLKVAENLLDPFGEKDDDFDMTFLIERNVQMAYLIVDDMHRDIPEIKKDVYWKDE 337          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000069980.1 (SMESG000069980.1)

HSP 1 Score: 261.536 bits (667), Expect = 1.101e-83
Identity = 135/335 (40.30%), Postives = 197/335 (58.81%), Query Frame = 2
Query:   86 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKD 1090
            MTV Y  ++A+S  F+  ++L  WKGSIYK    EL  +  L A+ISL++ F L G Y+  FE FC FC     +IPV  ++GFYVT++ +RW  QF  +PWPD++A+ VN +I G      +IRR+I+RY+ +S IL   SIS + K++    + L+   L  +EE    +K  ++ N++F+PI W+  LV K   E  +    R   L  E+  +R++L  LF YDW+NPPL+YTQ A I++Y YF+ S+F KQF+           + YVPVF   +   Y GWLKVA+ LINPFG+D+DDF+   +I RN    F  +       P + +D
Sbjct:    1 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTSQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQD 334          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST32.114e-10141.37bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST34.301e-9841.37bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST11.800e-9340.52bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST22.983e-9241.94bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.983e-9241.94bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-33.143e-7536.59Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-47.348e-7235.53Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-73.954e-7136.23Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
best-212.046e-6733.92Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
best-57.047e-6735.14Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best15.313e-8837.37gene:FBgn0040238 transcript:FBtr0082183[more]
Best16.959e-8837.37gene:FBgn0040238 transcript:FBtr0337020[more]
Best11.424e-8737.37gene:FBgn0040238 transcript:FBtr0114590[more]
Best12.398e-8737.37gene:FBgn0040238 transcript:FBtr0306023[more]
Best31.540e-8238.00gene:FBgn0036492 transcript:FBtr0075618[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.042e-10142.57bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best41.117e-9440.82bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best21.567e-9441.74bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best49.943e-9242.54bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best17.658e-5042.86bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best12.683e-9841.69bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best15.831e-9841.69bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.345e-9741.69bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.769e-9741.69bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
ifitm32.655e-9641.10interferon induced transmembrane protein 3 [Source... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best37.964e-10042.19bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
Best11.052e-9339.94bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best27.663e-9341.94bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best27.663e-9341.94bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best27.663e-9341.94bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6H1V1|BEST3_MOUSE5.571e-9942.19Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
sp|Q8N1M1|BEST3_HUMAN2.065e-9741.37Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1... [more]
sp|Q6UY87|BEST1_MACFA2.904e-9340.82Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|O76090|BEST1_HUMAN8.643e-9340.52Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE8.148e-9241.94Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KLS62.311e-10845.32Bestrophin homolog OS=Schistosoma mansoni OX=6183 ... [more]
C1L4419.986e-10845.32Bestrophin homolog OS=Schistosoma japonicum OX=618... [more]
A0A504Z0E61.399e-10545.03Bestrophin homolog OS=Fasciola gigantica OX=46835 ... [more]
A0A4E0RID62.001e-10545.03Bestrophin homolog OS=Fasciola hepatica OX=6192 GN... [more]
A0A4Z2D1716.131e-10547.78Bestrophin homolog OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best16.588e-10444.90bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best24.931e-9141.40bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best15.972e-9041.69bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best41.743e-8741.23bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
BEST32.066e-4645.14bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best28.007e-9340.52bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best12.153e-9038.78bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
best17.425e-9744.02bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
BEST31.251e-9541.94bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best29.815e-9442.57bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045575.10.000e+099.73SMESG000045575.1[more]
SMESG000040095.11.267e-14358.08SMESG000040095.1[more]
SMESG000054993.12.137e-9844.80SMESG000054993.1[more]
SMESG000057100.11.454e-8438.95SMESG000057100.1[more]
SMESG000069980.11.101e-8340.30SMESG000069980.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008018 ID=SMED30008018|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1301bp
TGACAATCGATATTGTGAGCAAAGCCTAATTGAAAAATTGAAGCCTCGAT
AGAATTGATCGTCGTATTCAAAGCCCTTTATCAACATGACAGTTGACTAT
AACAGGCGTATGGCATCTTCAAAATGCTTTAAATTCATGCAAATTTTGTT
TCTATGGAAAGGAAGCATTTATAAAATCGCGTGGTTTGAATTGATATTTT
TCGGTTCACTTTATGCTATAATTTCTTTAATTTATCGTTTTGTTCTCTAC
GGTAAATACAAAGAAAACTTTGAAATTTTCTGTATTTTCTGCGACAGTAT
CGATAATTATATTCCGGTGGCGTTTATTATGGGATTCTATGTGACAATGA
TAGCCAGACGATGGTGGAAACAATTCTATAACATCCCATGGCCAGATAAT
GTGGCTCTGTTGGTAAATGCGTACATATCTGGAAACGACAGGCGAACGGT
CATGATTAGAAGAAATATTATAAGATATATTAATTTATCACTAATACTGT
TTTTGAGAAGCATTTCTCCGCAAACTAAGAAAATTATCAAAGAAGAAGAA
GATTTGATAAGTTACGAACTTTTCAATTCGGAAGAATTTAAACTTTTCGA
CAAAGTTAGCTCCTCTTTCAACAGGTATTTTATACCAATACTTTGGTCTG
TAAATTTAGTCAAAAAAATGTTTCTTGAAGGACGAATCAAAACCGAAATC
AGAGCTCGTAATTTAATAATTGAAATAATACATTATCGAGAAAAGCTCAA
CAAATTATTTTGCTACGACTGGGTTAATCCTCCTCTTGTCTATACCCAAA
CGGCAACTATATCTGTTTATATCTATTTCCTTACATCGCTTTTTAGTAAA
CAATTTCTTGATCCGATCAAACGCTATCCAAACCGACATTTTGATTATTA
TGTCCCAGTGTTTTCGATTGCTCAACTGTTTTTCTATTTCGGATGGCTGA
AAGTCGCTGAAGCTCTCATTAATCCCTTTGGAGAAGACGATGACGACTTC
GATAGTATCGGGTTGATTAATCGAAATTTAACATCGTTTTTCTTTTTCAT
TCGATCTAAAGAAAGCCTCTTTCCAAAAATAATCAAAGACAAAAAATGGA
ATGAAAGTCTTCCATTAAAAATTGATGATTTTATAATAGATCCTAAATTT
TTCTCGGACACATTACCCAAAATTGACTAAGTCAGCATTTTTGTCATTAA
ATTAAGGTTTTTGGATTATCTACAATATTATCGATTAGCACTTTATTATC
GATTGGCGTCGATTCAATTGATTATTTTTAAAAATCATTTAAAATTAATT
G
back to top

protein sequence of SMED30008018-orf-1

>SMED30008018-orf-1 ID=SMED30008018-orf-1|Name=SMED30008018-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIY
RFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNI
PWPDNVALLVNAYISGNDRRTVMIRRNIIRYINLSLILFLRSISPQTKKI
IKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGR
IKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLT
SLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGE
DDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKDKKWNESLPLKIDDFI
IDPKFFSDTLPKID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 9..315
e-value: 1.9E-84
score: 283.6
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 1..343
NoneNo IPR availableTMHMMTMhelixcoord: 271..288
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..343