Discoidin domain-containing receptor 2

Overview
NameDiscoidin domain-containing receptor 2
Smed IDSMED30008007
Length (bp)3213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Discoidin domain-containing receptor 2 (SMED30008007) t-SNE clustered cells

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30008007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Discoidin domain-containing receptor 2 (SMED30008007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30008007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008007SMESG000066441.1 Contig3618GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30008007SMESG000066441.1 dd_Smed_v4_6578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 142.895 bits (359), Expect = 5.217e-34
Identity = 122/467 (26.12%), Postives = 200/467 (42.83%), Query Frame = 1
Query: 1687 NNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSH--RSIPMYGPAR-----VSIQGPLRNSKLQSITTVNDPEIM----------FSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            NN   + S+    S YD + P+  +        EPS   R +P + P         +  P++ S  + +    + +I+          +S+ ++  DL S  +VA+E      L + + +    FG +H+ E        +E  +KF+  ++  L  S    +             + ++K+L  +  +  +N+F KEIK +  L     P I+      + D    +++E         Y++N  L +    H       +  + +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE  T C++QPY +L++EQVI N+        R   LP P          +  C   +   RPSF EI + L
Sbjct:  456 NNRSSSPSEQGSNSTYDRIFPLRPD------YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------VEGMEKFKDKDF-ALDVSANQPV-------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIHLLAVCITDDPLCMITE---------YMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 127.872 bits (320), Expect = 2.351e-29
Identity = 91/349 (26.07%), Postives = 162/349 (46.42%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGW-DKQKTNQ-VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +  ++PD   T SS + E    K+ R  +   + AWCP   +  D  ++FL IDL  ++ + ++ T+G     HG   A  Y I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+V+  P  +    +C+ +++YGC ++  ++ Y         +  GS + L D  YDG    S ++ GLG+L      L  D F   ++         VGW ++  TN  ++I F F + +NF+ + +  +   +K VK+F  +Q  F  +   ++   +     +D+      F +VP  L + +   +K    F   W++   I FQSD
Sbjct:   25 VNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-TRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYS-MTEGLGQLTDGVSGL--DDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVP--LHHRMASAIKCQYHFADTWMMFSEITFQSD 367          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 142.895 bits (359), Expect = 5.217e-34
Identity = 122/467 (26.12%), Postives = 200/467 (42.83%), Query Frame = 1
Query: 1687 NNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSH--RSIPMYGPAR-----VSIQGPLRNSKLQSITTVNDPEIM----------FSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            NN   + S+    S YD + P+  +        EPS   R +P + P         +  P++ S  + +    + +I+          +S+ ++  DL S  +VA+E      L + + +    FG +H+ E        +E  +KF+  ++  L  S    +             + ++K+L  +  +  +N+F KEIK +  L     P I+      + D    +++E         Y++N  L +    H       +  + +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE  T C++QPY +L++EQVI N+        R   LP P          +  C   +   RPSF EI + L
Sbjct:  456 NNRSSSPSEQGSNSTYDRIFPLRPD------YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------VEGMEKFKDKDF-ALDVSANQPV-------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIHLLAVCITDDPLCMITE---------YMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 127.872 bits (320), Expect = 2.351e-29
Identity = 91/349 (26.07%), Postives = 162/349 (46.42%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGW-DKQKTNQ-VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +  ++PD   T SS + E    K+ R  +   + AWCP   +  D  ++FL IDL  ++ + ++ T+G     HG   A  Y I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+V+  P  +    +C+ +++YGC ++  ++ Y         +  GS + L D  YDG    S ++ GLG+L      L  D F   ++         VGW ++  TN  ++I F F + +NF+ + +  +   +K VK+F  +Q  F  +   ++   +     +D+      F +VP  L + +   +K    F   W++   I FQSD
Sbjct:   25 VNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-TRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYS-MTEGLGQLTDGVSGL--DDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVP--LHHRMASAIKCQYHFADTWMMFSEITFQSD 367          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 142.895 bits (359), Expect = 5.217e-34
Identity = 122/467 (26.12%), Postives = 200/467 (42.83%), Query Frame = 1
Query: 1687 NNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSH--RSIPMYGPAR-----VSIQGPLRNSKLQSITTVNDPEIM----------FSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            NN   + S+    S YD + P+  +        EPS   R +P + P         +  P++ S  + +    + +I+          +S+ ++  DL S  +VA+E      L + + +    FG +H+ E        +E  +KF+  ++  L  S    +             + ++K+L  +  +  +N+F KEIK +  L     P I+      + D    +++E         Y++N  L +    H       +  + +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE  T C++QPY +L++EQVI N+        R   LP P          +  C   +   RPSF EI + L
Sbjct:  456 NNRSSSPSEQGSNSTYDRIFPLRPD------YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------VEGMEKFKDKDF-ALDVSANQPV-------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIHLLAVCITDDPLCMITE---------YMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 127.872 bits (320), Expect = 2.351e-29
Identity = 91/349 (26.07%), Postives = 162/349 (46.42%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGW-DKQKTNQ-VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +  ++PD   T SS + E    K+ R  +   + AWCP   +  D  ++FL IDL  ++ + ++ T+G     HG   A  Y I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+V+  P  +    +C+ +++YGC ++  ++ Y         +  GS + L D  YDG    S ++ GLG+L      L  D F   ++         VGW ++  TN  ++I F F + +NF+ + +  +   +K VK+F  +Q  F  +   ++   +     +D+      F +VP  L + +   +K    F   W++   I FQSD
Sbjct:   25 VNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-TRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYS-MTEGLGQLTDGVSGL--DDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVP--LHHRMASAIKCQYHFADTWMMFSEITFQSD 367          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 138.272 bits (347), Expect = 1.349e-32
Identity = 101/396 (25.51%), Postives = 173/396 (43.69%), Query Frame = 1
Query: 1861 LQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELS------DLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D +                 SL   +   N+ +  P   + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL    +++++    D   +L    L++ +      D     G   IS   L+++A+QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  540 LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLV-----------------SLDFPL---NVRKGHP--LLVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPL---CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQG-PTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 873          

HSP 2 Score: 106.686 bits (265), Expect = 1.059e-22
Identity = 71/311 (22.83%), Postives = 135/311 (43.41%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS--YLN----LTDFNYDG-----DKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W  ++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G   YL+    L D  YDG      +         G + L+    S++         VGW      +  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++          +V V L   V +F++    F   W++   I F SD  N+
Sbjct:   62 SRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNN 371          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 138.272 bits (347), Expect = 1.349e-32
Identity = 101/396 (25.51%), Postives = 173/396 (43.69%), Query Frame = 1
Query: 1861 LQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELS------DLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D +                 SL   +   N+ +  P   + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL    +++++    D   +L    L++ +      D     G   IS   L+++A+QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  540 LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLV-----------------SLDFPL---NVRKGHP--LLVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPL---CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQG-PTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 873          

HSP 2 Score: 106.686 bits (265), Expect = 1.059e-22
Identity = 71/311 (22.83%), Postives = 135/311 (43.41%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS--YLN----LTDFNYDG-----DKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W  ++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G   YL+    L D  YDG      +         G + L+    S++         VGW      +  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++          +V V L   V +F++    F   W++   I F SD  N+
Sbjct:   62 SRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNN 371          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-1 (Discoidin domain-containing receptor A [Source:UniProtKB/Swiss-Prot;Acc:Q18163])

HSP 1 Score: 131.339 bits (329), Expect = 6.591e-31
Identity = 104/358 (29.05%), Postives = 173/358 (48.32%), Query Frame = 1
Query:   82 ILISLELLFTATITNT---KSCSDKLLENKNK-VPDSAFTESSY--KEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFN---YDGDK--SDSYLSGGLGKLVLNSDTLSKDPF--NTKNDQLVGWDKQKTN-QVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNF---HSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS 1098
            I + L  ++  T TNT     C +  L  +N  + DS  T SS   K+    + AR  +     AWCP  +I+ K  +FL + L D +++  + T+G   +G     AS Y+I+Y R   S W  Y++R     + GN D  T     LDP I+A  ++  P +    T+C+  +I+GCK+        + DGS L+  DF    ++  +  ++S +  GLG L+ +       PF  N  N+  +GW++  T+ ++ I F F +  NF+ +++  + F ++       I + FS DG T+      Q S  E + +NN    +   V L N  G+ V+IS+ F+S W+ L  + F S
Sbjct:    3 IALVLLAIYGTTTTNTLRIDQCGENALGMQNGDIADSQITASSSFDKQSVGPQNARLHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDYLRPG-SQWIRYKNRTGHVYMDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCKHEGVTYYSTVPDGSRLDTLDFKDSMFEDSQIYTESGIKRGLG-LLTDGFVAQASPFEKNQMNNSWIGWNRDTTDGRITILFEFEEVHNFTDVVL--ATFGNR----IDGIDVIFSQDGKTF--PLFSQISSSERQSLNNTSRRYDFRVPLHNRAGRKVRISIKFSSDWMFLTEVHFTS 350          

HSP 2 Score: 57.7658 bits (138), Expect = 3.909e-8
Identity = 27/93 (29.03%), Postives = 54/93 (58.06%), Query Frame = 1
Query: 2701 IRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILP-VPNNYSKEFSDFITHCMHFNESTRPSF 2976
            +R+   ++++   F++KSD ++   T +E+   CR++PY ELTNEQ++ N+    L  +   ++P +P  ++ E    +T C   ++  RP+F
Sbjct:  666 LRYSAPESIVNNEFTHKSDAWAVATTVYEMAYQCRQRPYEELTNEQIVDNA-CALLDHQPNAVVPLMPTVFNYEILQLLTRCFRVDQLERPTF 757          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 125.561 bits (314), Expect = 4.716e-29
Identity = 96/345 (27.83%), Postives = 176/345 (51.01%), Query Frame = 1
Query:  109 TATITNTKSCSDKLLENKNKVPDSAFT-ESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDG---SYLNLTDFNYDGDKSDS-YLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRV-INNFHSVPVDLKNNVGKFVKISLTF--NSIWIILKYIEFQSDPTN 1110
            T      + CS +L  +  K+ D   +  SS+  +  G + AR        AWCP N+I+   +++L I      ++  + T+G      G   A+++ I+Y R + + W  Y+   + + I  N D        LD AIIAR ++I P +N   T+C+ ++++GC +   ++ Y +D G   S ++  DF+YDG+ ++S +L+GG+GKL      + K+     + + VGW +++   V++ F F++ +N S +LI  S    K+ K FS   + FS +G  + +  V   + ++T   +  +  +PV+  N + K  KI L F  +S W+ +  + F+S+ TN
Sbjct:   16 TVVALELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHARAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDLQSGISYHDFSYDGNLANSPHLTGGIGKLY--DGEVGKNNVFVNHHKWVGWRRKRNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVN--NRIAKVAKIRLNFGTDSDWLFISEVNFESNHTN 356          

HSP 2 Score: 118.242 bits (295), Expect = 9.033e-27
Identity = 72/231 (31.17%), Postives = 112/231 (48.48%), Query Frame = 1
Query: 2332 YLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGD--------ERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQ 3000
            Y++N  LK      Y      I  S  I + +Q+A G+ +LE    VHRD++ RN L+ + +  +KI+D  +A   +S +Y                                 ++    VLPIRWM W+ALL G FS  SDV+ FGVT WE+ +LC ++PY ++T++ V+   NLQ++           R R+ P     SK +++ I  C ++  S RPSF  + + LQ
Sbjct:  601 YMENGDLKS-----YILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLV-DGEGNVKIADFGMARSLYSQEYY--------------------------------KVEGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVV--ENLQSMSSTGSLKQVLSRPRMCP-----SKLYNEQILPCWNYESSRRPSFENVHLHLQ 786          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 122.865 bits (307), Expect = 2.608e-28
Identity = 88/311 (28.30%), Postives = 141/311 (45.34%), Query Frame = 1
Query: 2098 TGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIG 3015
            +GI T  +F   PE    ++K    + T   + +  +EI+ + + +H   P ++K       D+ +++        + Y+ +  L EL  +      ++ G    + +  +Y+A+QIA GM++L  +  VHRDL+ RN L+  D   IKI+D  +    + SDY          +H+S                          +P+RWM  +A+ QG FS  SDV+SFGVT WE+ +  R QPY   +N+QVI    L A       +L  P+N        +  C H N   RP+F EI   LQ  S+ 
Sbjct:  447 SGIYTSGLFA--PEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDH---PNVIKLIGVCYMDNSLLA-------VFEYMVHGDLHELLKVRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLV-GDTRTIKIADFGLMRTSYGSDYYKM-------LHRSW-------------------------MPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGR-QPYEGASNQQVI---ELVA----NRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLA 704          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 122.865 bits (307), Expect = 3.610e-28
Identity = 88/311 (28.30%), Postives = 141/311 (45.34%), Query Frame = 1
Query: 2098 TGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIG 3015
            +GI T  +F   PE    ++K    + T   + +  +EI+ + + +H   P ++K       D+ +++        + Y+ +  L EL  +      ++ G    + +  +Y+A+QIA GM++L  +  VHRDL+ RN L+  D   IKI+D  +    + SDY          +H+S                          +P+RWM  +A+ QG FS  SDV+SFGVT WE+ +  R QPY   +N+QVI    L A       +L  P+N        +  C H N   RP+F EI   LQ  S+ 
Sbjct:  606 SGIYTSGLFA--PEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDH---PNVIKLIGVCYMDNSLLA-------VFEYMVHGDLHELLKVRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLV-GDTRTIKIADFGLMRTSYGSDYYKM-------LHRSW-------------------------MPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGR-QPYEGASNQQVI---ELVA----NRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLA 863          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 122.865 bits (307), Expect = 4.086e-28
Identity = 88/311 (28.30%), Postives = 141/311 (45.34%), Query Frame = 1
Query: 2098 TGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIG 3015
            +GI T  +F   PE    ++K    + T   + +  +EI+ + + +H   P ++K       D+ +++        + Y+ +  L EL  +      ++ G    + +  +Y+A+QIA GM++L  +  VHRDL+ RN L+  D   IKI+D  +    + SDY          +H+S                          +P+RWM  +A+ QG FS  SDV+SFGVT WE+ +  R QPY   +N+QVI    L A       +L  P+N        +  C H N   RP+F EI   LQ  S+ 
Sbjct:  580 SGIYTSGLFA--PEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDH---PNVIKLIGVCYMDNSLLA-------VFEYMVHGDLHELLKVRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLV-GDTRTIKIADFGLMRTSYGSDYYKM-------LHRSW-------------------------MPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGR-QPYEGASNQQVI---ELVA----NRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLA 837          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 152.525 bits (384), Expect = 4.312e-37
Identity = 97/297 (32.66%), Postives = 149/297 (50.17%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHT-ALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLA--IANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            + ++  L       L+ EF  + K++  L+    P + +     L D    +V +++  L D   +LQ   + E S L      K +S   L+Y+A+QIA GMKHLE +  VHRDL+ R+ +I   +L +K+  +   I    ++SDY      T              QS P               +PIRWM W+++L G F+ KSDV+SF V  WE+LT  R+QPY  L+++ VI N  L     +   +LP+P N  +E  D +  C   +ES+RPSF EI ++LQ K++G K
Sbjct:  785 LVAVATLRPGANDHLRKEFRSKAKQLAQLSD---PNVARLVGACLRDEPICIVQDYSHCLGDLNQFLQEH-VAETSGL---MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCII-GPELCVKVCSIGTVINRSAYASDYCQLEGFTGR------------QSQP---------------MPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK 1046          

HSP 2 Score: 142.124 bits (357), Expect = 6.202e-34
Identity = 94/341 (27.57%), Postives = 160/341 (46.92%), Query Frame = 1
Query:  133 SCSDKLLENKNKVPDSAFTESSYKE--EFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR----MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNT------KNDQLVGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPT 1107
            +C   L      + D   T SS  +      + AR        AWCP + +     ++L +DL  ++++  I T+G      G     +Y+IEY R     W  +RS   ++ + GN +  +E    L P++ A  V++YPY+  + T+CL  +I GC +   I+ Y     M  G  ++L+D  YDG +   +   GLG+LV       KD F        K  + +GW  D      V+I F F   +N S ++I  +   SK+V++F H ++ FS  G  +  + V Q S     V+++   V + L + +G++V++ L F + W+++  I F S P 
Sbjct:  105 TCKQALGMESGAIADFQITASSAHDMGNVGPQHARLKIDNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGMQRGMDIDLSDKTYDGYEEGDHYVNGLGQLV--DGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPV-QFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 152.525 bits (384), Expect = 4.312e-37
Identity = 97/297 (32.66%), Postives = 149/297 (50.17%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHT-ALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLA--IANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            + ++  L       L+ EF  + K++  L+    P + +     L D    +V +++  L D   +LQ   + E S L      K +S   L+Y+A+QIA GMKHLE +  VHRDL+ R+ +I   +L +K+  +   I    ++SDY      T              QS P               +PIRWM W+++L G F+ KSDV+SF V  WE+LT  R+QPY  L+++ VI N  L     +   +LP+P N  +E  D +  C   +ES+RPSF EI ++LQ K++G K
Sbjct:  785 LVAVATLRPGANDHLRKEFRSKAKQLAQLSD---PNVARLVGACLRDEPICIVQDYSHCLGDLNQFLQEH-VAETSGL---MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCII-GPELCVKVCSIGTVINRSAYASDYCQLEGFTGR------------QSQP---------------MPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK 1046          

HSP 2 Score: 142.124 bits (357), Expect = 6.202e-34
Identity = 94/341 (27.57%), Postives = 160/341 (46.92%), Query Frame = 1
Query:  133 SCSDKLLENKNKVPDSAFTESSYKE--EFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR----MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNT------KNDQLVGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPT 1107
            +C   L      + D   T SS  +      + AR        AWCP + +     ++L +DL  ++++  I T+G      G     +Y+IEY R     W  +RS   ++ + GN +  +E    L P++ A  V++YPY+  + T+CL  +I GC +   I+ Y     M  G  ++L+D  YDG +   +   GLG+LV       KD F        K  + +GW  D      V+I F F   +N S ++I  +   SK+V++F H ++ FS  G  +  + V Q S     V+++   V + L + +G++V++ L F + W+++  I F S P 
Sbjct:  105 TCKQALGMESGAIADFQITASSAHDMGNVGPQHARLKIDNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGMQRGMDIDLSDKTYDGYEEGDHYVNGLGQLV--DGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPV-QFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329980)

HSP 1 Score: 142.51 bits (358), Expect = 2.118e-34
Identity = 101/364 (27.75%), Postives = 176/364 (48.35%), Query Frame = 1
Query:   79 LILISLELLFTATIT---NTKSCSDKLLENKNKVPDSAFTESSYKE-EFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSY----LNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNT------KNDQLVGWDKQKTN----QVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPT 1107
            L++ S  L+  A  T   +  +C+  L      + D+  T SS  +  F G + AR  T     AWCP + + +  +++L +DL   +++  I T+G      G     +Y++EY R     W  +++   ++ + GN +  +E   +L P I A  ++IYPY   + T+CL  +I GC +   I+ Y +  G      ++L+D  YDG++       GLG+LV       KD F T      K  + +GW           V+I F F   +NFS +++  +   +K+V++F H ++ FS  G  +  + V    + +T ++++   V + L + VGK++KI+L F   WI+L  I F S P 
Sbjct:   56 LVIASGCLMLNAPTTMAFDIATCNVPLGMESLLITDAQITASSAHDMAFVGPQHARLKTDNDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKGVQRGMEVDLSDKTYDGNEQGDRYVDGLGQLV--DGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDT-IMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPA 416          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0112617)

HSP 1 Score: 142.51 bits (358), Expect = 2.118e-34
Identity = 101/364 (27.75%), Postives = 176/364 (48.35%), Query Frame = 1
Query:   79 LILISLELLFTATIT---NTKSCSDKLLENKNKVPDSAFTESSYKE-EFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSY----LNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNT------KNDQLVGWDKQKTN----QVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPT 1107
            L++ S  L+  A  T   +  +C+  L      + D+  T SS  +  F G + AR  T     AWCP + + +  +++L +DL   +++  I T+G      G     +Y++EY R     W  +++   ++ + GN +  +E   +L P I A  ++IYPY   + T+CL  +I GC +   I+ Y +  G      ++L+D  YDG++       GLG+LV       KD F T      K  + +GW           V+I F F   +NFS +++  +   +K+V++F H ++ FS  G  +  + V    + +T ++++   V + L + VGK++KI+L F   WI+L  I F S P 
Sbjct:   56 LVIASGCLMLNAPTTMAFDIATCNVPLGMESLLITDAQITASSAHDMAFVGPQHARLKTDNDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKGVQRGMEVDLSDKTYDGNEQGDRYVDGLGQLV--DGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDT-IMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPA 416          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329979)

HSP 1 Score: 142.51 bits (358), Expect = 4.028e-34
Identity = 101/364 (27.75%), Postives = 176/364 (48.35%), Query Frame = 1
Query:   79 LILISLELLFTATIT---NTKSCSDKLLENKNKVPDSAFTESSYKE-EFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSY----LNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNT------KNDQLVGWDKQKTN----QVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPT 1107
            L++ S  L+  A  T   +  +C+  L      + D+  T SS  +  F G + AR  T     AWCP + + +  +++L +DL   +++  I T+G      G     +Y++EY R     W  +++   ++ + GN +  +E   +L P I A  ++IYPY   + T+CL  +I GC +   I+ Y +  G      ++L+D  YDG++       GLG+LV       KD F T      K  + +GW           V+I F F   +NFS +++  +   +K+V++F H ++ FS  G  +  + V    + +T ++++   V + L + VGK++KI+L F   WI+L  I F S P 
Sbjct:   56 LVIASGCLMLNAPTTMAFDIATCNVPLGMESLLITDAQITASSAHDMAFVGPQHARLKTDNDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKGVQRGMEVDLSDKTYDGNEQGDRYVDGLGQLV--DGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDT-IMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPA 416          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2a [Source:ZFIN;Acc:ZDB-GENE-090316-2])

HSP 1 Score: 152.91 bits (385), Expect = 2.392e-37
Identity = 118/389 (30.33%), Postives = 174/389 (44.73%), Query Frame = 1
Query: 1861 LQSITTVNDPEIMFSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            LQ +T  N     +++ +L  DL S  +VA+E      L + + +    FG +H+ E     D  M+ +  F   E  T+                     + ++K+L  +  +  +N+F KEIK +  L     P I++          V      L     Y++N  L +    H   G       A  +S SNL +MASQIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+LT C++QPY +L++EQVI N+  +   D+R +I LP P          +  C H N   RPSF EI
Sbjct:  541 LQGVTGGN----TYAVPALTMDLLSGKDVAVEEFSRKLLTFKEKLGEGQFGEVHLCEAEGMQD-FMDKDFSFDVTENQTV---------------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIRL-------LAVCMSSDPLCMITEYMENGDLNQFLSRHEPEGMIALLSNAPTVSYSNLHHMASQIASGMKYLSSLNFVHRDLATRNCLV-GKNFTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTSSDVWAFGVTLWEMLTFCKEQPYSQLSDEQVIENTG-EFFRDQRRQIYLPQPPMCPDPVYKLMLSCWHRNTKERPSFQEI 859          

HSP 2 Score: 125.561 bits (314), Expect = 8.637e-29
Identity = 103/389 (26.48%), Postives = 182/389 (46.79%), Query Frame = 1
Query:   67 RMNFLILISLELLFTA-TITNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMD-------DGSYLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPN 1173
            +M+F +LI L L     +  N   C   L  ++ ++ D   + SS + E    K+ R      + AWCP      +  ++FL IDL  ++ + ++ T+G    G  +  A +Y I+Y R+  S W  +R+R  ++ I+GN++      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y          +G ++ L D  YDG  S S ++ GLG+L      L+  TLS           VGW  +      V+I F F + +NF+ + +  +   S+ VK F  +   F  + + ++   V     +D+      F  V V L N++   +K    F+ IW++   I FQSD       + P   +T  P T +P 
Sbjct:   14 KMHFPLLILLYLSGAVQSQVNPGVCRSPLGMSRGQILDEDISASSQWSESTAAKYGRLDCEEGDGAWCPEIPAEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRDG-SRWISWRNRQGKEVIEGNRNAYDIVLKDLEPPIIARFVRFMPVIDHSMNVCMRVELYGCEWLDGLVSYNSPLGQQMSLNGQHIYLNDSVYDGAMSYS-MTEGLGQLTDGMCGLDDFTLSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSRRVKTFQKVVCYFRSE-LDWEATPVSFSPVMDDVNPSARF--VTVSLYNHMASAIKCQYYFSDIWMMFSEITFQSDTAMYNTTLTP--PRTDPPLTNQPG 395          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2b (discoidin domain receptor tyrosine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060503-361])

HSP 1 Score: 140.584 bits (353), Expect = 1.555e-33
Identity = 93/287 (32.40%), Postives = 143/287 (49.83%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLI-MNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            + ++K L ++  +  +N+F KEI+ I  L     P I++      E  PL    +++E+    D   +L    L+E      +  +  IS   LI MASQI+ GMK+L  L  VHRDL+ RN L+ MN+  +IKI+D  ++   +  DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+LTLC++QPY + T+EQVI N+  +   D+  ++ L  P    +     + +C   N   RP+F+EI
Sbjct:  594 LVAVKTLREDADKNARNDFMKEIRIISRLRD---PNIIRLLAVCVESDPL---CMITEYMENGDLNQFLSRHQLQEDG---VQADSTSISYGTLINMASQISSGMKYLSSLNFVHRDLATRNCLVGMNN--IIKIADFGMSRNLYRGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYAQFTDEQVIENTG-EFFRDQNKQVYLLRPACCPESLYSLMLNCWRRNAKERPTFLEI 836          

HSP 2 Score: 112.849 bits (281), Expect = 7.406e-25
Identity = 95/364 (26.10%), Postives = 158/364 (43.41%), Query Frame = 1
Query:  100 LLFTA--TITNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIHDKR-RDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLN-------LTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND--------QLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASI-------FPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
            LLF A  +  N   C   L  N  ++ D   + SS + E    ++ R      + AWCP+        ++FL IDL  ++ + ++ T+G    G  +  A  Y I+Y R+  + W  +R R  ++ I+GN +      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y    G  +        L D  YDG  S S ++ GLG+L   S  L  D F TK+           VGW         V++TF F + +NF+ + I   +         +  VK+F      F  D          +   D       F  + V L N +   ++    F+ IW++   I FQSD
Sbjct:   12 LLFGAVNSQVNPAVCRYPLGMNGGQIQDEDISASSQWSESTAARYGRLDFDDGDGAWCPDVMAEAHSLKEFLQIDLRTLHFVTLVGTQGRHADGVGNEFAQRYRIKYSRDG-TRWVSWRDRQGRQIIEGNSNAYDIVLKDLEPPIIARFVRFMPVTDPSMIVCMRVELYGCEWLDGLVSYSAPAGQQMTFRGQQIYLNDTVYDGAVSSS-MAEGLGQLTDGSWGL--DDF-TKSQVYGVWPGYDYVGWTNASLPGGSVEMTFEFDRVRNFTSMKINLLVQQVHCNNMYAWGVKMFRQAVCSFRSDADWEPNPVFFKPKADSISPSARF--ITVALGNRMASAIRCRFAFSDIWMMFSEIAFQSD 368          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 137.117 bits (344), Expect = 2.400e-32
Identity = 110/383 (28.72%), Postives = 170/383 (44.39%), Query Frame = 1
Query: 1861 LQSITTVNDPEIMFSLGSLF------NDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSF 2976
            LQ +T  N    M+S+ +L        D+S A    + L + + +    FG +H+                  C E   L + L  G     + +Q     + ++K L  + T   +N+F KEIK +  LN+   P I++         PL    +V+E+    D   +L    ++  S L +      +S ++L++M+ QI+ GMK+L  L  VHRDL+ RN L ++  L IKISD  ++   +SSDY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+ TLC++QPY  L++EQVI N+        R   L  P          +  C   + + RPSF
Sbjct:  532 LQGVTGSN----MYSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHL------------------C-EAEGLAEFLGEGAP---LPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNN---PNIIQLLCVCVSSDPL---CMVTEYMENGDLNMFLSQREIE--STLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCL-LDRHLTIKISDFGMSRNLYSSDYY--------------------------------RIQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSF 847          

HSP 2 Score: 115.161 bits (287), Expect = 1.372e-25
Identity = 92/360 (25.56%), Postives = 159/360 (44.17%), Query Frame = 1
Query:  136 CSDKLLENKNKVPDSAFTESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYL--------NLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQL------VGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQ--QSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVI 1152
            C   L     ++ +   T SS   +  G ++AR +    E AWC   ++      +L IDL  +  L ++ T+G      G   A  Y +EY R+ +  W  +R+R   + I GN +        L P II R++++ P  +   T+C+ ++++GC +   +M Y   +G  +        +L D  YDG      LSGGLG+L      L  D   ++  +L      VGW  D      V++ F+F + +NF+ + + ++   S  VK+FS +   F    ++  E   ++    ID+      + +VP  LK+     ++    F   W++   I FQS     + IV PT    V+
Sbjct:   11 CRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGH-RWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLD-DFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDRNPSARYVTVP--LKHRSATALRCRFYFADTWMMFSEISFQS-----VTIVLPTKKPPVL 361          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: BX088694.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 136.732 bits (343), Expect = 2.441e-32
Identity = 111/391 (28.39%), Postives = 174/391 (44.50%), Query Frame = 1
Query: 1861 LQSITTVNDPEIMFSLGSLF------NDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQ 3000
            LQ +T  N    M+S+ +L        D+S A    + L + + +    FG +H+                  C E   L + L  G     + +Q     + ++K L  + T   +N+F KEIK +  LN+   P I++         PL    +V+E+    D   +L    ++  S L +      +S ++L++M+ QI+ GMK+L  L  VHRDL+ RN L ++  L IKISD  ++   +SSDY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+ TLC++QPY  L++EQVI N+        R   L  P          +  C   + + RPSF ++   L+
Sbjct:  522 LQGVTGSN----MYSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHL------------------C-EAEGLAEFLGEGAP---LPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNN---PNIIQLLCVCVSSDPL---CMVTEYMENGDLNMFLSQREIE--STLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCL-LDRHLTIKISDFGMSRNLYSSDYY--------------------------------RIQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLHQALR 845          

HSP 2 Score: 115.161 bits (287), Expect = 1.361e-25
Identity = 91/360 (25.28%), Postives = 159/360 (44.17%), Query Frame = 1
Query:  136 CSDKLLENKNKVPDSAFTESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYL--------NLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQL------VGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQ--QSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVI 1152
            C   L     ++ +   T SS   +  G ++AR +    E AWC   ++      +L IDL  +  L ++ T+G      G   A  Y +EY R+ +  W  +R+R   + I GN +        L P II R++++ P  +   T+C+ ++++GC +   +M Y   +G  +        +L D  YDG      LSGGLG+L      L  D   ++  +L      VGW  D      V++ F+F + +NF+ + + ++   S  VK+FS +   F    ++  E   ++    ID+      + ++P  LK+     ++    F   W++   I FQS     + IV PT    V+
Sbjct:   23 CRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGH-RWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLD-DFVESRQYRLWPGYDYVGWRNDGLGPGYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDRNPSARYVTIP--LKHRSATALRCRFYFADTWMMFSEISFQS-----VTIVLPTKKPPVL 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: FP015875.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 136.732 bits (343), Expect = 2.527e-32
Identity = 110/383 (28.72%), Postives = 170/383 (44.39%), Query Frame = 1
Query: 1861 LQSITTVNDPEIMFSLGSLF------NDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSF 2976
            LQ +T  N    M+S+ +L        D+S A    + L + + +    FG +H+                  C E   L + L  G     + +Q     + ++K L  + T   +N+F KEIK +  LN+   P I++         PL    +V+E+    D   +L    ++  S L +      +S ++L++M+ QI+ GMK+L  L  VHRDL+ RN L ++  L IKISD  ++   +SSDY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+ TLC++QPY  L++EQVI N+        R   L  P          +  C   + + RPSF
Sbjct:  522 LQGVTGSN----MYSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHL------------------C-EAEGLAEFLGEGAP---LPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNN---PNIIQLLCVCVSSDPL---CMVTEYMENGDLNMFLSQREIE--STLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCL-LDRHLTIKISDFGMSRNLYSSDYY--------------------------------RIQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSF 837          

HSP 2 Score: 115.161 bits (287), Expect = 1.446e-25
Identity = 92/360 (25.56%), Postives = 159/360 (44.17%), Query Frame = 1
Query:  136 CSDKLLENKNKVPDSAFTESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYL--------NLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQL------VGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQ--QSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVI 1152
            C   L     ++ +   T SS   +  G ++AR +    E AWC   ++      +L IDL  +  L ++ T+G      G   A  Y +EY R+ +  W  +R+R   + I GN +        L P II R++++ P  +   T+C+ ++++GC +   +M Y   +G  +        +L D  YDG      LSGGLG+L      L  D   ++  +L      VGW  D      V++ F+F + +NF+ + + ++   S  VK+FS +   F    ++  E   ++    ID+      + +VP  LK+     ++    F   W++   I FQS     + IV PT    V+
Sbjct:   23 CRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGH-RWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLD-DFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDRNPSARYVTVP--LKHRSATALRCRFYFADTWMMFSEISFQS-----VTIVLPTKKPPVL 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 244.588 bits (623), Expect = 3.632e-67
Identity = 254/1022 (24.85%), Postives = 425/1022 (41.59%), Query Frame = 1
Query:   82 ILISLELLFT-------ATITNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHS----VPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFS----FINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVND---PEIMFSLGSLFNDLSYANVALE-----NLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFP-EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILK--FEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKS 3009
            I+IS+ LL+        A +  T  C   L  +   +PD   T SS + E    K+ R  +   + AWCP   +  ++  +FL IDL  ++ + ++ T+G     HG   A  + I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+++  P  +    +CL +++YGC ++  ++ Y         + +G  + L D  YDG    S ++ GLG+L      L+  TL+ +         VGW  +      V+I F F + +NF+ + +  +   SK VK+F  +Q  F  D   ++       SI  T V+++ +     V V L N++ + +K    F   W++   I FQSD       + P    +V P T  P +  D+    I +   + I+  ++          + +++  +++  K  ++A RR   EE    LT+S     DS              S+ N N R       + S++ S+ ESN   D+   + P++      I   P     T       N    ++  +     A  VP+Y              +  D+VN                                      LQ +T  N    P I   L      LS   VA+E     +L + + +    FG +H+ E         E  ++F               ++ + I +  P +  + ++K+L  +  +  +N+F KEIK +  L       +L     E PL    +++E         Y++N  L +    H E   K   +++L +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++F VT WE LT CR+QPY E+++EQVI N+  +   D+  ++ LP PN   +     +  C       RPSF EI   LQ +S
Sbjct:    2 IIISMALLYLFRTVAPWALLLFTSVCRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDG-TRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDGAIGYS-MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWE-----ANSISSTLVLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASV-PTTYDPTLKVDDSNTRILIGCLVAIIFILVA---------IIVIILWRQFWQKMLEKASRRMLDEE----LTVSLSLPSDS--------------SMYNTNRR-------HDSVSASEQESNSTYDRIFPLGPDYQEPTRLIRKLPEFTAQTVGEEETGNSAGKSALPA----SADGVPHY--------------AEADIVN--------------------------------------LQGVTGGNTYSVPAITMDL------LSGKEVAVEEFPRKHLTFKEKLGEGQFGEVHLCE--------AEGVEEF---------------LDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCIAEDPL---CMITE---------YMENGDLNQFLSRHRENNVK-FHKNDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLV-GRNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTG-EFFRDQGKQVYLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQSES 849          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 233.802 bits (595), Expect = 1.053e-63
Identity = 246/988 (24.90%), Postives = 412/988 (41.70%), Query Frame = 1
Query:  169 VPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHS----VPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFS----FINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVND---PEIMFSLGSLFNDLSYANVALE-----NLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFP-EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILK--FEETPLGDSVVVSEHTALDDAYSYLQNFTLKE-LSDLHYETGAKVIS-QSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKS 3009
            +PD   T SS + E    K+ R  +   + AWCP   +  ++  +FL IDL  ++ + ++ T+G     HG   A  + I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+++  P  +    +CL +++YGC ++  ++ Y         + +G  + L D  YDG    S ++ GLG+L      L+  TL+ +         VGW  +      V+I F F + +NF+ + +  +   SK VK+F  +Q  F  D   ++       SI  T V+++ +     V V L N++ + +K    F   W++   I FQSD       + P    +V P T  P +  D+    I +   + I+  ++          + +++  +++  K  ++A RR   EE    LT+S     DS              S+ N N R       + S++ S+ ESN   D+   + P++      I   P     T       N    ++  +     A  VP+Y              +  D+VN                                      LQ +T  N    P I   L      LS   VA+E     +L + + +    FG +H+ E         E  ++F               ++ + I +  P +  + ++K+L  +  +  +N+F KEIK +  L       +L     E PL    +++E         Y++N  L + LS    E G    +  ++L +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++F VT WE LT CR+QPY E+++EQVI N+  +   D+  ++ LP PN   +     +  C       RPSF EI   LQ +S
Sbjct:    6 IPDEDITASSQWSESTAAKYGRLDSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDG-TRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDGAIGYS-MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWE-----ANSISSTLVLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASV-PTTYDPTLKVDDSNTRILIGCLVAIIFILVA---------IIVIILWRQFWQKMLEKASRRMLDEE----LTVSLSLPSDS--------------SMYNTNRR-------HDSVSASEQESNSTYDRIFPLGPDYQEPTRLIRKLPEFTAQTVGEEETGNSAGKSALPA----SADGVPHY--------------AEADIVN--------------------------------------LQGVTGGNTYSVPAITMDL------LSGKEVAVEEFPRKHLTFKEKLGEGQFGEVHLCE--------AEGVEEF---------------LDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCIAEDPL---CMITE---------YMENGDLNQFLSRQQPEGGLPAATLYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLV-GRNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTG-EFFRDQGKQVYLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQSES 820          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 140.584 bits (353), Expect = 1.868e-33
Identity = 118/416 (28.37%), Postives = 184/416 (44.23%), Query Frame = 1
Query: 1792 SHRSIPMYGPAR-VSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALE-----NLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFP-EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILK--FEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKS 3009
            S   +P Y  A  V++QG      +    T + P I   L      LS   VA+E     +L + + +    FG +H+ E         E  ++F               ++ + I +  P +  + ++K+L  +  +  +N+F KEIK +  L       +L     E PL    +++E+    D    L  F  ++  +         IS ++L +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++F VT WE LT CR+QPY E+++EQVI N+  +   D+  ++ LP PN   +     +  C       RPSF EI   LQ +S
Sbjct:  413 SADGVPHYAEADIVNLQG------VTGGNTYSVPAITMDL------LSGKEVAVEEFPRKHLTFKEKLGEGQFGEVHLCE--------AEGVEEF---------------LDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCIAEDPL---CMITEYMENGD----LNQFLSRQQPEGGLPAATLPISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLV-GRNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTG-EFFRDQGKQVYLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQSES 752          

HSP 2 Score: 120.939 bits (302), Expect = 2.805e-27
Identity = 91/350 (26.00%), Postives = 164/350 (46.86%), Query Frame = 1
Query:  169 VPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHS----VPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTV 1149
            +PD   T SS + E    K+ R  +   + AWCP   +  ++  +FL IDL  ++ + ++ T+G     HG   A  + I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+++  P  +    +CL +++YGC ++  ++ Y         + +G  + L D  YDG    S ++ GLG+L      L+  TL+ +         VGW  +      V+I F F + +NF+ + +  +   SK VK+F  +Q  F  D   ++       SI  T V+++ +     V V L N++ + +K    F   W++   I FQS       I+E  +  T+
Sbjct:    6 IPDEDITASSQWSESTAAKYGRLDSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDG-TRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDGAIGYS-MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWE-----ANSISSTLVLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSGKKQLKNIMEVWVNPTL 348          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 140.584 bits (353), Expect = 2.120e-33
Identity = 118/416 (28.37%), Postives = 184/416 (44.23%), Query Frame = 1
Query: 1792 SHRSIPMYGPAR-VSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALE-----NLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFP-EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILK--FEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKS 3009
            S   +P Y  A  V++QG      +    T + P I   L      LS   VA+E     +L + + +    FG +H+ E         E  ++F               ++ + I +  P +  + ++K+L  +  +  +N+F KEIK +  L       +L     E PL    +++E+    D    L  F  ++  +         IS ++L +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++F VT WE LT CR+QPY E+++EQVI N+  +   D+  ++ LP PN   +     +  C       RPSF EI   LQ +S
Sbjct:  464 SADGVPHYAEADIVNLQG------VTGGNTYSVPAITMDL------LSGKEVAVEEFPRKHLTFKEKLGEGQFGEVHLCE--------AEGVEEF---------------LDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCIAEDPL---CMITEYMENGD----LNQFLSRQQPEGGLPAATLPISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLV-GRNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTG-EFFRDQGKQVYLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQSES 803          

HSP 2 Score: 119.398 bits (298), Expect = 1.017e-26
Identity = 87/343 (25.36%), Postives = 160/343 (46.65%), Query Frame = 1
Query:  169 VPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHS----VPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITK 1143
            +PD   T SS + E    K+ R  +   + AWCP   +  ++  +FL IDL  ++ + ++ T+G     HG   A  + I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+++  P  +    +CL +++YGC ++  ++ Y         + +G  + L D  YDG      L+ G+    L+  TL+ +         VGW  +      V+I F F + +NF+ + +  +   SK VK+F  +Q  F  D   ++       SI  T V+++ +     V V L N++ + +K    F   W++   I FQS       I+E  +++
Sbjct:    6 IPDEDITASSQWSESTAAKYGRLDSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDG-TRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDGAIGLGQLTDGVSG--LDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWE-----ANSISSTLVLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSGKKQLKNIMEVWVSR 340          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 140.198 bits (352), Expect = 2.735e-33
Identity = 111/389 (28.53%), Postives = 173/389 (44.47%), Query Frame = 1
Query: 1861 LQSITTVNDPEIMFSLGSLFNDL-SYANVALE-----NLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFP-EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILK--FEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQ 3000
            LQ +T  N     +S+ ++  DL S   VA+E     +L + + +    FG +H+ E         E  ++F               ++ + I +  P +  + ++K+L  +  +  +N+F KEIK +  L       +L     E PL    +++E+    D    L  F  ++  +         IS ++L +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++F VT WE LT CR+QPY E+++EQVI N+        +   LP PN   +     +  C       RPSF EI   LQ
Sbjct:  490 LQGVTGGN----TYSVPAITMDLLSGKEVAVEEFPRKHLTFKEKLGEGQFGEVHLCE--------AEGVEEF---------------LDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCIAEDPL---CMITEYMENGD----LNQFLSRQQPEGGLPAATLPISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLV-GRNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQVYLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 811          

HSP 2 Score: 124.405 bits (311), Expect = 2.338e-28
Identity = 95/363 (26.17%), Postives = 169/363 (46.56%), Query Frame = 1
Query:  169 VPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHS----VPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDN 1188
            +PD   T SS + E    K+ R  +   + AWCP   +  ++  +FL IDL  ++ + ++ T+G     HG   A  + I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+++  P  +    +CL +++YGC ++  ++ Y         + +G  + L D  YDG    S ++ GLG+L      L+  TL+ +         VGW  +      V+I F F + +NF+ + +  +   SK VK+F  +Q  F  D   ++       SI  T V+++ +     V V L N++ + +K    F   W++   I FQSD       + P    +V P T  P +  D+
Sbjct:    6 IPDEDITASSQWSESTAAKYGRLDSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDG-TRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDGAIGYS-MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWE-----ANSISSTLVLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASV-PTTYDPTLKVDD 360          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 141.739 bits (356), Expect = 7.575e-34
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  526 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 871          

HSP 2 Score: 116.701 bits (291), Expect = 5.069e-26
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 141.354 bits (355), Expect = 1.105e-33
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  563 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 908          

HSP 2 Score: 116.701 bits (291), Expect = 5.585e-26
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 141.354 bits (355), Expect = 1.105e-33
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  563 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 908          

HSP 2 Score: 116.701 bits (291), Expect = 5.585e-26
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 141.354 bits (355), Expect = 1.105e-33
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  563 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 908          

HSP 2 Score: 116.701 bits (291), Expect = 5.585e-26
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 141.354 bits (355), Expect = 1.105e-33
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  563 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 908          

HSP 2 Score: 116.701 bits (291), Expect = 5.585e-26
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q16832|DDR2_HUMAN (Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 2.505e-33
Identity = 122/467 (26.12%), Postives = 200/467 (42.83%), Query Frame = 1
Query: 1687 NNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSH--RSIPMYGPAR-----VSIQGPLRNSKLQSITTVNDPEIM----------FSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHTALDDAYSYLQNFTLKELSDLH-----YETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            NN   + S+    S YD + P+  +        EPS   R +P + P         +  P++ S  + +    + +I+          +S+ ++  DL S  +VA+E      L + + +    FG +H+ E        +E  +KF+  ++  L  S    +             + ++K+L  +  +  +N+F KEIK +  L     P I+      + D    +++E         Y++N  L +    H       +  + +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE  T C++QPY +L++EQVI N+        R   LP P          +  C   +   RPSF EI + L
Sbjct:  456 NNRSSSPSEQGSNSTYDRIFPLRPD------YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------VEGMEKFKDKDF-ALDVSANQPV-------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIHLLAVCITDDPLCMITE---------YMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 127.872 bits (320), Expect = 1.129e-28
Identity = 91/349 (26.07%), Postives = 162/349 (46.42%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGW-DKQKTNQ-VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +  ++PD   T SS + E    K+ R  +   + AWCP   +  D  ++FL IDL  ++ + ++ T+G     HG   A  Y I Y R+  + W  +R+R  ++ + GN +      + L+P I+AR+V+  P  +    +C+ +++YGC ++  ++ Y         +  GS + L D  YDG    S ++ GLG+L      L  D F   ++         VGW ++  TN  ++I F F + +NF+ + +  +   +K VK+F  +Q  F  +   ++   +     +D+      F +VP  L + +   +K    F   W++   I FQSD
Sbjct:   25 VNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-TRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYS-MTEGLGQLTDGVSGL--DDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVP--LHHRMASAIKCQYHFADTWMMFSEITFQSD 367          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 7.727e-33
Identity = 104/412 (25.24%), Postives = 175/412 (42.48%), Query Frame = 1
Query: 1801 SIPMYGPARVSIQGPLRNSKLQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSY--LQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            S+P Y  A +          LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D ++ ++     H+ + L                     + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL       E+  L+   S   L+N   + LS          IS   L+++ +QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  563 SVPHYAEADIVT--------LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQD-LVSSDFPISVHKGHPL---------------------LVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDAL 908          

HSP 2 Score: 116.701 bits (291), Expect = 3.907e-25
Identity = 75/312 (24.04%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGL-----GKLVLNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W +++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G  + L+       D  YDG  +     GGL     G + L+    S++         VGW  Q   T  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++  +       ++ V L  +VG+F++    F   W++   I F SD  ND
Sbjct:   63 SRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q62371|DDR2_MOUSE (Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 7.089e-32
Identity = 111/391 (28.39%), Postives = 170/391 (43.48%), Query Frame = 1
Query: 1861 LQSITTVND---PEIMFSLGSLFNDLSYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGA----KVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            LQ +T  N    P +   L      LS  +VA+E      L + + +    FG +H+ E        +E  +KF+  ++  L  S    +             + ++K+L  +  +  +N+F KEIK +  L     P I++        +V ++E   L     Y++N  L +    H    +      +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE  T C++QPY +L++EQVI N+        R   LP P          +  C       RPSF EI + L
Sbjct:  529 LQGVTGGNTYCVPAVTMDL------LSGKDVAVEEFPRKLLAFKEKLGEGQFGEVHLCE--------VEGMEKFKDKDF-ALDVSANQPV-------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIRLL------AVCITED-PLCMITEYMENGDLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLL 848          

HSP 2 Score: 130.183 bits (326), Expect = 2.295e-29
Identity = 93/349 (26.65%), Postives = 162/349 (46.42%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYR--------MDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGW-DKQKTNQ-VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRV-LQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +   +PD   T SS + E    K+ R  +   + AWCP   +  D  ++FL IDL  ++ + ++ T+G     HG   A  Y I Y R+  S W  +R+R  ++ + GN +      + L+P I+AR+V++ P  +    +C+ +++YGC ++  ++ Y         +  GS + L D  YDG    S ++ GLG+L      L  D F   ++         VGW ++  TN  ++I F F + +NF+ + +  +   +K VK+F  +Q  F  +   ++   V     +D+      F +VP  L + +   +K    F   W++   I FQSD
Sbjct:   25 VNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-SRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYS-MTEGLGQLTDGVSGL--DDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVP--LHHRMASAIKCQYHFADTWMMFSEITFQSD 367          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q7YR43|DDR1_PANTR (Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes OX=9598 GN=DDR1 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 8.977e-32
Identity = 101/396 (25.51%), Postives = 173/396 (43.69%), Query Frame = 1
Query: 1861 LQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELS------DLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D +                 SL   +   N+ +  P   + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL    +++++    D   +L    L++ +      D     G   IS   L+++A+QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  573 LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLV-----------------SLDFPL---NVRKGHP--LLVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPL---CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQG-PTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 906          

HSP 2 Score: 105.531 bits (262), Expect = 1.311e-21
Identity = 70/307 (22.80%), Postives = 133/307 (43.32%), Query Frame = 1
Query:  238 TSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS--YLN----LTDFNYDG-----DKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W  ++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G   YL+    L D  YDG      +         G + L+    S++         VGW      +  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++          +V V L   V +F++    F   W++   I F SD  N+
Sbjct:   62 SSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNN 367          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q08345|DDR1_HUMAN (Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 9.132e-32
Identity = 101/396 (25.51%), Postives = 173/396 (43.69%), Query Frame = 1
Query: 1861 LQSITTVNDPEI-MFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELS------DLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            LQ +T  N   +     G++ +     +     L++ + +    FG +H+ E   P D +                 SL   +   N+ +  P   + ++K+L  + T+  +N+F KE+K +  L     P I++      ++ PL    +++++    D   +L    L++ +      D     G   IS   L+++A+QIA GM++L  L  VHRDL+ RN L+  ++  IKI+D  ++   ++ DY                                  +    VLPIRWM W+ +L G F+  SDV++FGVT WE+L LCR QP+ +LT+EQVI N+        R   L  P    +   + +  C       RP F ++  FL   ++
Sbjct:  577 LQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLV-----------------SLDFPL---NVRKGHP--LLVAVKILRPDATKNARNDFLKEVKIMSRLKD---PNIIRLLGVCVQDDPL---CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQG-PTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV-GENFTIKIADFGMSRNLYAGDY--------------------------------YRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 910          

HSP 2 Score: 106.301 bits (264), Expect = 6.091e-22
Identity = 71/311 (22.83%), Postives = 135/311 (43.41%), Query Frame = 1
Query:  226 ARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS--YLN----LTDFNYDG-----DKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND 1113
            +R  +S  + AWCP   +  K  ++L +DL  ++++ ++ T+G    G     + SY + Y R+    W  ++ R  Q+ I GN+D      + L P ++AR V+ YP A+   ++CL +++YGC +   ++ Y    G   YL+    L D  YDG      +         G + L+    S++         VGW      +  V++ F F + + F  + +  +   +   +L   ++ +F        E   ++ ++          +V V L   V +F++    F   W++   I F SD  N+
Sbjct:   62 SRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNN 371          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: K1QMW4 (Discoidin domain-containing receptor 2 OS=Crassostrea gigas OX=29159 GN=CGI_10019822 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.010e-88
Identity = 274/1025 (26.73%), Postives = 449/1025 (43.80%), Query Frame = 1
Query:  118 ITNTKSCSDKLLENKNKVPDSAFT-ESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSY--------LNLTDFNYDGDKSDSYLSGGLGKLV--------LNSDTLSKDPFNTKNDQLVGWDKQKTNQ---VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTN-DIRIVEPTITKTV-----------IPFTQKPNIPFDNDF------FSIPLAYTXXXXXXXXXXXXXXXXPCVT----ILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESN---CNSDKPQCIAPNFSFINTCPIIN------PLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNP---NESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF--EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIG 3015
            I +   C   L      +PD A T  SSYKE   G + AR        AWCP N ++    ++L IDL  + ++  + T+G   +G        +++EY+RE +  W  +R+R   +    N +  T +   + P IIA+ V+  PY     T+C+ +++YGC +   ++ Y M  G          L   DF YDG   + +L  G+G+L+          SD  ++     K  + VGW  +  +    VQI F+F   +NF+ L I A+ F  K+V +FS   + FS  G+ Y +   +    +    +    +V + L+N VGK+VK+ L F+  W+++  + F+S+ T  ++ +  P +T  V           +P  +  NI    D        S+           I II+  +    VT     ++     R+K+ K+   RH  +   R + L+    ++  N      VSN N               +Y S+A  + ES+   CN  +  C +P++S      +        P  +   S S DY+    T   S     +P +     +  S  N  +   M N ++  P   +  +A  +  H ++P       ++QG   N    ++  V + E++ +L     + +      ENL+++  +    FG +H+ E +     I +        +Y   R S  T             K + ++K+L +N   + + +F KEIK +  L       +L     E PL    ++ E+    D   +L +   +  S +   T AK +S   L+YMASQIA GMK+LE L +VHRDL+ RN L+   +  IKISD  ++   +S+DY                                  I    VLPIRWM W+++L G F+ KSDV+SF VT WE+LT  + QP+  LT+EQVI N+      D +   L +P N  KE  D +  C + NE+ RP+F E+ MFLQ K++G
Sbjct:   10 IVHAGQCQTALGMESGAIPDDAITASSSYKEGSVGPESARIRKEWQGGAWCPKNILNKNSYEYLQIDLYKLMVITKVETQGRFGNGLGQEFTEKFLLEYQREDDGEWIRFRNRQAAEHFSANYNTHTAEMNEVSPPIIAKRVRFIPYTETPRTVCMRVELYGCTWNDGVLSYSMPQGDRRGKHSSDELAFLDFTYDGIIKEDHLYNGIGQLMDGEEGQANFRSDLQAR---GIKGYEWVGWKTENPDDNIPVQIVFKFDDVRNFTLLNIHANNFYDKDVSVFSMAHVYFSVSGIYY-QPNYIDHKFERDSWMEYARTVSIPLENRVGKYVKVELFFDRKWMLISEVSFKSEVTKANVTMELPPLTPAVHTTKAPTIGERLPVDRNINIQIGQDSQQHVEDRSVQTKEATTENDMIGIIVGTLSALIVTLLVVAVIVIILIRHKRSKQNNNRHCLKPVERHIALNMNGMRNMQNG----KVSNGN---------------MYNSVAQEEMESDRELCNGGEKLCKSPSYSEPQDSLVGGRDLPDLPGCAAGNSDSRDYAVPDVTK--SALIVALPPHTQTP-IRVSPANNGTPIMMNNCLTEKPPTYDALYAAADIVHVNVPNIP----NLQGVSGN----NVYAVPNAELLLTL-----EHAVVQFPRENLQFVDVLGEGQFGEVHLCEAVNVDGYISD--------DYFMNRASTHT------------PKVLVAVKMLRRNADDRARADFSKEIKIMSQLKDPNIVRVLGVCTREEPL---CMIVEYMKYGDLNQFLLDHVPE--SPVAMATNAKTLSYGCLVYMASQIASGMKYLESLNMVHRDLATRNCLV-GTNYTIKISDFGMSRSLYSADY--------------------------------YRIEGRAVLPIRWMAWESILLGKFTTKSDVWSFAVTLWEILTFAKDQPFDTLTDEQVIENAGHYYRNDNKEVYLSLPPNCPKEIYDLMVECWNRNEACRPTFREVHMFLQRKNMG 937          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A194QW37 (Discoidin domain-containing receptor 2 OS=Papilio machaon OX=76193 GN=RR48_15321 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 6.000e-67
Identity = 246/1002 (24.55%), Postives = 428/1002 (42.71%), Query Frame = 1
Query:  100 LLFTATITNTKSCSDKLLENKNKVPDSAFTESS-------------YKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGL--SRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDG----SYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQ-KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTND---IRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCI--APNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIIN-SNLQALGD-----ERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
             +  A +  T  C   L      +PD   T SS               +E KG            AWCP ++I  +  ++L ++L  ++++    T+G   +  G   A +Y++EY R     W  YR    Q+ + GN +   EK   L P I A  ++  PY++   T+C+ +++YGC +   I+ Y M  G    + + LTD  YDG   +  L GGLG+LV       +     +N   VGW K+ + N   ITF F + + FS +    +    ++V++FS   I FS  G  + ++ + + S  E  +  +  +V + L + +GK+V+I L F + WI++  + F SD          V+ T  K     +   ++P        PL   +V+ +   +++LL     V + +   ++R++KC       F    A+  T+SQ++      NP                  MM ++ +     G D +S+   +  Q +  AP FS+      +            D+   S T L S+ ++Y       A    S   L +   + + +S    +   + +P      M   AR S    +R+    S  + +  E++  L       +        L+ I  ++   FG++++ E     D + E N                 GI T        EK++ ++K L  + T K + +F ++++ + +L+      +L    TP     VV E+  L D  ++L++              A   S  +L+++A+QIA GM++LE L  VHRDL+ RN+LI      IKISD    NE +  DY                                 ++   + +P+RW  W+ LL G+++ KSDV++F VT  E+ T CR++PY  LT+ +V+ N ++LQA        ERA  +P      ++  + +  C   ++  RP FVE+++FLQ KS+
Sbjct:    7 FILIAELNKTAQCIAPLGMENGLIPDKDLTASSSFNDGNVGPQNGRLNQEIKGG-----------AWCPKSQITTESTEWLEVNLHTVHVITGAGTQGRFGNGQGQEYAEAYVLEYWRPKLGKWVRYRGADGQEILTGNANTYLEKKNHLQPPIWASKIRFIPYSSHRRTVCMRVELYGCYWSVGIVAYSMPKGDKRSNGIELTDMTYDGQWGEE-LRGGLGQLVDGQYGGDEIREAARNSAWVGWKKESRPNPPVITFEFDKVREFSAVHFYCNNRFMRDVQVFSEAIISFSIGGRHFQDEPI-RYSYVEDSIFESSRNVSIKLHHRIGKWVRIELRFAASWILISEVVFDSDVAQGNYTPETVKATGGKEKTKSSTTKDLPISTAHQEDPLYMAIVVGVLTALVILL----AVAVFLIVHRHRHRKC-------FASPLAKS-TISQKRTVTDTYNPC--------------GTSMMPDNKMILD-CGLDVKSDEYQEPYQALKCAPYFSYSTVLLEM-----------KDFVKDSSTPL-SDSSNY-----EYAVPELSSAPLLTKRRLADSLSGRTTDPLTDHDPE-----MGLGARRSAPASIRSK--HSTRSPSQQEVLTDLKRRLETTNVIEFPRHRLRMISKLAEGAFGTVYVAE----ADGVPEYN-----------------GIVTS-------EKRLVAVKFLCHDATPKEREDFERDVRILAALSSPHLARVLGACRTP--PLAVVLEYLELGDLCAFLRS--------------APPPSIGSLLHIATQIATGMQYLESLNFVHRDLAARNILI-GKGYQIKISDFGTDNEAYICDYY--------------------------------KVEGRVPIPLRWAAWETLL-GHYTTKSDVWAFAVTLHEIFTFCRRRPYEHLTDNEVLENLAHLQADDGLFECIERAPGIP------RDLYELMRECWKHDQLERPDFVEVNLFLQRKSL 860          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: H3D6L6 (Discoidin domain receptor tyrosine kinase 2a OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 5.312e-66
Identity = 253/996 (25.40%), Postives = 406/996 (40.76%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDF-------NYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTK-------NDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFS----FINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVND---PEIMFSLGSLFNDLSYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQ--ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
             NT  C   L  +  ++ D   + SS + E    ++ R      + AWCP   +  D  ++FL IDL  ++ + ++ T+G    G  +  A  Y I+Y R+  S W  +R+R  ++ I+GN++      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y    G  +NL  F        YDG  + S ++ GLG+  L       D F              VGW  +   +  V+I F F + +NF+ + +  +   S +VK+F  +   F  +        +   + DE      F  V V L N++   +K    F   W++   I FQSD       + P   KT +P    PN P   D           I+I  L+ ++ I +  + I++ RQ ++ K  ++A RR   +E    L++  + F           V N N                  S   S+ ES+   ++   + P++     FI   P   P     GS +   S TS  ++  +G   VP+Y              +  D+VN                                      LQ +T  N    P +   L      LS  +VA+E      L + + +    FG +H+ E         E   KF               ++ E +F   PE Q  + ++K+L  +  +  +++F KEIK +  L     P I++     L    + S+   +     Y++N  L +    H   G       A  +S SNL YMA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+L  C++QPY +LT+EQVI N+       +R   LP P          +  C   N   RPSF EI
Sbjct:   25 VNTGVCRYPLGMSGGQIQDEDISASSQWSESTAARYGRLDFEEGDGAWCPETTVEPDSLKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQMYKIKYSRDG-SRWISWRNRQGEQVIEGNRNTYDIVLKDLEPPIIARFVRFMPVTDHSMNVCMRVELYGCEWLDGLVSYNAPAGEQMNLPSFLVYVNDSVYDGAVTHS-MTEGLGQ--LTDGVFGLDDFTNSCVYKAWPGYDYVGWSNESFPSGYVEIMFEFDRIRNFTTMKVHCNNMFSNHVKVFRQVLCHFRSESDWEPSPLLFSPAADEKNPSARF--VTVSLANHMASAIKCQFYFADTWMLFSEITFQSDTAMYNTTLAP--PKTGLP----PNTPPGEDPTHKVDDSNTRILIGCLVAIIFILVAIIVIMLWRQVWQ-KMLEKASRRMLDDELITSLSIQSETF-----------VYNHN-----------------QSSGASEQESSSTYERIFPLGPDYQEPSRFICKLPEFAPSLEEPGSTAASKSTTS--TVAQDG---VPHY--------------AEADVVN--------------------------------------LQGVTGSNTYAIPAVTMDL------LSGKDVAVEEFPRKMLTFKEKLGEGQFGEVHLCE--------AEGMHKF---------------MDKEFLF-DVPEDQPVLVAVKMLRSDANKNARSDFLKEIKIMSRLKD---PNIIR-----LLAVCICSDPLCM--ITEYMENGDLNQFLSRHEPEGQLALISNASTVSFSNLCYMAAQIASGMKYLSSLNFVHRDLATRNCLV-GKNFTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPGLCPDSLYKVMLSCWRRNAKERPSFQEI 849          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: Q4S3E4 (Chromosome 1 SCAF14751, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00024683001 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 6.915e-66
Identity = 253/996 (25.40%), Postives = 406/996 (40.76%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDF-------NYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTK-------NDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFS----FINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVND---PEIMFSLGSLFNDLSYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQ--ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
             NT  C   L  +  ++ D   + SS + E    ++ R      + AWCP   +  D  ++FL IDL  ++ + ++ T+G    G  +  A  Y I+Y R+  S W  +R+R  ++ I+GN++      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y    G  +NL  F        YDG  + S ++ GLG+  L       D F              VGW  +   +  V+I F F + +NF+ + +  +   S +VK+F  +   F  +        +   + DE      F  V V L N++   +K    F   W++   I FQSD       + P   KT +P    PN P   D           I+I  L+ ++ I +  + I++ RQ ++ K  ++A RR   +E    L++  + F           V N N                  S   S+ ES+   ++   + P++     FI   P   P     GS +   S TS  ++  +G   VP+Y              +  D+VN                                      LQ +T  N    P +   L      LS  +VA+E      L + + +    FG +H+ E         E   KF               ++ E +F   PE Q  + ++K+L  +  +  +++F KEIK +  L     P I++     L    + S+   +     Y++N  L +    H   G       A  +S SNL YMA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+L  C++QPY +LT+EQVI N+       +R   LP P          +  C   N   RPSF EI
Sbjct:   20 VNTGVCRYPLGMSGGQIQDEDISASSQWSESTAARYGRLDFEEGDGAWCPETTVEPDSLKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQMYKIKYSRDG-SRWISWRNRQGEQVIEGNRNTYDIVLKDLEPPIIARFVRFMPVTDHSMNVCMRVELYGCEWLDGLVSYNAPAGEQMNLPSFLVYVNDSVYDGAVTHS-MTEGLGQ--LTDGVFGLDDFTNSCVYKAWPGYDYVGWSNESFPSGYVEIMFEFDRIRNFTTMKVHCNNMFSNHVKVFRQVLCHFRSESDWEPSPLLFSPAADEKNPSARF--VTVSLANHMASAIKCQFYFADTWMLFSEITFQSDTAMYNTTLAP--PKTGLP----PNTPPGEDPTHKVDDSNTRILIGCLVAIIFILVAIIVIMLWRQVWQ-KMLEKASRRMLDDELITSLSIQSETF-----------VYNHN-----------------QSSGASEQESSSTYERIFPLGPDYQEPSRFICKLPEFAPSLEEPGSTAASKSTTS--TVAQDG---VPHY--------------AEADVVN--------------------------------------LQGVTGSNTYAIPAVTMDL------LSGKDVAVEEFPRKMLTFKEKLGEGQFGEVHLCE--------AEGMHKF---------------MDKEFLF-DVPEDQPVLVAVKMLRSDANKNARSDFLKEIKIMSRLKD---PNIIR-----LLAVCICSDPLCM--ITEYMENGDLNQFLSRHEPEGQLALISNASTVSFSNLCYMAAQIASGMKYLSSLNFVHRDLATRNCLV-GKNFTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPGLCPDSLYKVMLSCWRRNAKERPSFQEI 844          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A0N0U7T2 (Discoidin domain-containing receptor 2 OS=Melipona quadrifasciata OX=166423 GN=WN51_00089 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 3.811e-65
Identity = 231/893 (25.87%), Postives = 394/893 (44.12%), Query Frame = 1
Query:  466 GNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDG----SYLNLTDFNYDGDKSDSYLSGGLGKLV---LNSDTLSKD-PFNTKNDQLVGWDKQKTNQ----VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS--DPTNDIRIVEPTITKTVIPFTQKP----NIPFDNDFF------------SIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQK---YRNKKCKEALR-RHFQEEHARFLTLSQQQFKDSVNN----PTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIA-PNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMIL--KFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            GN +  +EK +  DPAI+A  ++  PY +    +C+ +++YGC ++  ++ Y M  G    S ++L+D  YDG +   YLSGGLG+LV      D    D   N K  + VGW     +     V+ITF F   +NF+ + +  + + +K+V++FS+ ++     G  ++ + V    I +  V+     V + L +  G+F+K+ L F + WI+L  + F+S     N+    EP     ++  T  P      P   D              ++P           + +++ I    + +L+       YRN++ K AL    F ++H       Q++ +D        P  +  + +  + P ++  +   S    S+  ++   +C  D+ + I   + +F    P +      +    N    T  T     GA+     +N   +AR    ++ +     PI   P + +A+ E    S+P   P+      P  ++K  S  T   PE M +           +   E L  ++ +   +FG +HI E     D+    ++ F+    NT                      +  +K L   ++  L+ EF +E KR+  L  +    +L    E+ P+    +V E+    D   YLQ+  + E S +H    AK +S   L+YMA+QIA GMKHLE +  VHRDL+ RN L+ +    +K+SDL      +++DY                                  ++    LPIRWM W+++L G  ++KSDV+SF VT WE+LT  R+QP+ EL + +++ N+      D+R  ILP+P N  K+  + +  C H N+  RPSF EI MFLQ K++  K
Sbjct:   72 GNNNPYSEKEQVFDPAIVATKIRFIPYTSHMRMVCIRVELYGCPWIEGLVSYSMPQGIKRGSEVDLSDRTYDGREEAGYLSGGLGQLVDGQKGPDNFRLDVSGNGKGYEWVGWRNDTPSMLGRPVEITFEFDYSRNFTAIHLHMNNYFTKDVQVFSYAKVYLGAGGNQFNGEPVHFSYIPDL-VLEQARDVTIKLHSRAGRFLKLQLYFAARWIMLSEVIFESVISEWNNTDDEEPRNKSAIVLATGSPYQNNEGPLQRDEVKATFNKEENNDNALPDKSKEPESRQFVGLVIGILTTVIVMLLAAIMFIFYRNRRLKAALAPSTFYDQHGDLKVSVQEEGEDKGPICPPLPAQYHPATYTTTTPQLHKTITDYSGCSRSINHANRTPDCIRDRFKVILLRSLNFYIPMPYVRCRFDVKLHRRNQRIIT-ITLWDHGGAAGYNTAIN---LARPIPPVQEYPSNPPPIPPPPEKYYASTEICKNSLPPLPPSPTPSTPPPMSAKASSSMTSYSPEDMLTEEEDEVPECILDFPREKLNIVENLGCGYFGDVHICEV----DRFPGYDEVFR----NT-------------------SSDLVIVKSLRPGSSDALRIEFQQEAKRLARLADRNVARLLGASLEDDPM---CIVLENGEYGDLNQYLQSH-IAETSTVH---TAKTLSFGTLVYMATQIASGMKHLEEMDFVHRDLATRNCLV-SRGYTVKVSDLGSGRNAYAADY--------------------------------FRVDGRPPLPIRWMAWESMLMGRHTSKSDVWSFAVTLWEILTFAREQPFEELPDHRIVENATYFYQEDDRRIILPLPKNCPKDIYELMRECWHRNDVDRPSFREIHMFLQRKNLSYK 892          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 152.91 bits (385), Expect = 2.067e-37
Identity = 122/419 (29.12%), Postives = 186/419 (44.39%), Query Frame = 1
Query: 1783 DEPSHRS---IPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEI-DMFLQHKS 3009
            DEP + S   +P Y  A +  Q    +S   S+T V  P      G+L           E L + + +    FG +H+ E     D + E                   G+E E I        + ++K L ++ T+  +N+F KEI+ +  L     P I++      E  PL    +++E+    D   +L    L++  +   +T +  IS S LI MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +  DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE LTLC++QPY +L+++QVI N+  +   D+  ++ LP P          +  C   N   RPSF  I    LQH++
Sbjct:  502 DEPPNNSTEEVPHYAEADIVNQQEAVSSPGYSVTAVPVPLPPGRDGAL------EEFPREKLTFKEKLGEGQFGEVHLCEANGMQDFMKEDED----------------GVENEPI--------LVAVKTLREDATKNTRNDFLKEIRIMSRLRD---PNIIRLLAVCVESDPL---CMITEYMENGDLNKFLSRHKLQDSGEEQKDT-SSTISYSTLIRMATQIASGMKYLSSLNFVHRDLATRNCLV-GTNYTIKIADFGMSRNLYRGDY--------------------------------YRIQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWETLTLCKEQPYSQLSDDQVIENTG-EFFRDQNKQVYLPRPACCPDAVHSLMQSCWRRNAKERPSFQHIHSTLLQHQA 849          

HSP 2 Score: 112.849 bits (281), Expect = 7.119e-25
Identity = 89/359 (24.79%), Postives = 158/359 (44.01%), Query Frame = 1
Query:   76 FLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIHDKR-RDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-------YLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS 1098
            FL+++S  +    +  N   C   L     K+ D   + SS + E    ++ R      + AWCP+     K  ++FL IDL  ++ + ++ T+G    G  +  A SY I+Y R+    W  +  R   + I GNK+      + L+P IIAR+V+  P ++   T+C+ +++YGC+++  ++ Y    G        ++ L D  YDG   D  ++ GLG+L      L++ T S+          VGW      +  V++ F F + +NF+ + +  +   +  V+ F      F  +          +   D T     F  V V L + +   +K    F+  W++   I FQS
Sbjct:    9 FLVILSGAV---RSQVNPGVCRYPLGMTGGKIQDEDISASSQWSESTAARYGRLDFDDGDGAWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQGRHADGMGNEFAQSYRIKYSRDG-VRWVSWHDRNGGQVIDGNKNPYEVVLKDLEPPIIARFVRFMPVSDPSMTVCMRVELYGCEWLDGLVSYSAPVGQEMTFQNLHVYLNDTVYDG-TVDHSMTEGLGQLTDGSWGLDNFTQSQVYGVWPGYDYVGWTNASFPSGSVEMVFEFDRVRNFTSMKVHCNNMYTSGVRAFQQAVCYFRSESDWEARPVSFKPEADNTNTSARF--VTVALGHRMASAIKCRFAFSDAWMMFSEIAFQS 360          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103037878])

HSP 1 Score: 144.05 bits (362), Expect = 1.225e-34
Identity = 116/416 (27.88%), Postives = 180/416 (43.27%), Query Frame = 1
Query: 1792 SHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDL-SYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARI-LPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFL 2997
            +   +P Y  A +          LQ +T  N     +++ +L  DL S  ++A+E      L + + +    FG +H+ E     +  M+ +  F   +  T+                     + ++K+L  +  +  +N+F KEIK +  L     P I++          V      L     Y++N  L +    H   G       A  +S +NL +MA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE LT C++QPY +L++EQVI N+  +   D+R +I LP P          +  C + N   RPSF EI   L
Sbjct:  526 AQEGVPHYAEADIV--------NLQGVTGGN----TYAVPALTMDLLSGKDIAVEEFPRKLLTFKEKLGEGQFGEVHLCE-AEDMEDYMDEDFSFDVSDNQTV---------------------LVAVKMLRADANKNARNDFLKEIKIMSRLKD---PNIIRL-------LAVCMSSDPLCMITEYMENGDLNQFLSRHEPEGMIALLSNAPTVSYNNLHHMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETLTFCKEQPYSQLSDEQVIENTG-EFFRDQRRQIYLPQPPLCPDPAYKLMLSCWNRNAKERPSFQEIHQVL 863          

HSP 2 Score: 114.775 bits (286), Expect = 1.630e-25
Identity = 90/347 (25.94%), Postives = 156/347 (44.96%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS---------YLNLTDFNYDGDKSDSYLSGGLGKLV-----LNSDTLSKDPFNTKNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD 1101
             N   C   L  +  ++ D   + SS + +    K+ R      + AWCP      +  ++FL IDL  ++ + ++ T+G    G  +  A +Y I+Y R+  S W  +R+R  ++ I+GN++      + L P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y    G          YLN  D  YDG  S S ++ GLG+L      L+  T S           VGW  +      V+I F F + +NF+ + +  +   S+ VK F  +   F  +             +D+      F  V V L N++   +K    F+ +W++   I FQSD
Sbjct:   33 VNPSVCRSPLGMSGGQILDEDISASSQWSDSTAAKYGRLDCEEGDGAWCPEIPGEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRDG-SRWISWRNRHGKQVIEGNRNAYDVVLQDLQPPIIARFVRFMPVIDHSMNVCMRVELYGCEWLDGLVSYNAPLGQKMILHSQPIYLN--DSVYDGAMSYS-MTEGLGQLTDGMCGLDDFTFSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSQRVKTFQKVVCYFRSESDWEPTPVSFSPVVDDVNPSARF--VTVSLNNHMASAIKCQYYFSDMWMMFSEITFQSD 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 138.272 bits (347), Expect = 6.459e-33
Identity = 101/316 (31.96%), Postives = 146/316 (46.20%), Query Frame = 1
Query: 1924 DLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSN 2856
            D+S A    E L + + +    FG +H+                  C E   L + L  G     + +Q     + ++K L  + T   +N+F KEIK +  LN    P I++         PL    +V+E+    D   +L    L+  S L +      +S ++L++MA QIA GMK+L  L  VHRDL+ RN L ++  L IKISD  ++   +SSDY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+ TLC +QPY  LT+EQVI NS 
Sbjct:  521 DISVAEFPRERLIFREKLGEGQFGEVHL------------------C-EAEGLAEFLGEGAP---LPEQDGRSVLVAVKQLRADATSNARNDFLKEIKIMSRLND---PNIIRLLCVCVRSDPL---CMVTEYMENGDLNMFLSQRELE--STLTHANNIPSVSMADLLHMAVQIASGMKYLASLNFVHRDLATRNCL-LDRQLTIKISDFGMSRNLYSSDYY--------------------------------RIQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCTEQPYSLLTDEQVIENSG 773          

HSP 2 Score: 78.5666 bits (192), Expect = 2.472e-14
Identity = 82/366 (22.40%), Postives = 145/366 (39.62%), Query Frame = 1
Query:  136 CSDKLLENKNKVPDSAFTESSYKEEFKG-KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLN--------LTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPF-NTKNDQL------VGW--DKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKR--VLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD----PTNDIRIVEPTITKTVIP 1155
            C   L     ++ +   T SS   E  G ++ R +    + AWCP  ++      +L +DL  +  + ++ T+G      G   A  Y ++Y R+ +  W  +R+R   + IKGN                     +  YA++         ++GC +   +  Y   +G  +         L D  YDG      L GGLG+  L    + +D F  T+  QL      +GW  D      V++ F+F + +NF+ + +  +   S+ VK+FS +   F    ++  E    V    +D+      + +VP  L    G   +    F   W++   I F S     PT   R++   +++T  P
Sbjct:   22 CRYPLGMEDGRIKNDDITASSQWYETTGPQYGRLNKEEGDGAWCPAGQLQPSDVQYLQVDLRQLTFVTVVATQGRYARSSGNEFARKYRLDYSRDGH-RWISWRNRYGSEIIKGN---------------------VNTYASV---------VFGCPWQDGLTAYSAPEGQTMMAPGFPNTLLNDSTYDGVLERRKLLGGLGQ--LTDGVIGQDDFVQTRQYQLWPGYDYLGWRNDSLGPGYVEMEFQFDRQRNFTSMKVHCNNMFSRGVKVFSSVSCVFKPHLISEWEAEPVVFSTVLDDRNPSARYVTVP--LLQRSGTATRCRFFFADTWMMFSEISFHSAMNPVPTPWSRVMTTPLSETESP 352          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 134.806 bits (338), Expect = 1.088e-31
Identity = 92/304 (30.26%), Postives = 139/304 (45.72%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYL-QNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMND---------DLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            + ++K+L  + ++  +N+F KE+K +  L     P I++         PL    +V+E+    D   YL Q   L +   LH       IS   LI MASQIA GMK L  L  VHRDL+ RN L+  +         +  IKI+D  ++   ++ DY                                  I    VLPIRWM W+ +L G F+  SDV++FGVT WE+L++C++QPY  +T+EQVI N+        R   L  P    +   + +  C + +   RPSF  +  FL   ++
Sbjct:  727 LVAVKILRPDASKNARNDFLKEVKILSRLKD---PNIIRLLGVCVSSDPL---CMVTEYMESGDLNQYLSQRVLLDKTGPLH---NTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYY--------------------------------RIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAM 989          

HSP 2 Score: 122.094 bits (305), Expect = 1.213e-27
Identity = 84/314 (26.75%), Postives = 145/314 (46.18%), Query Frame = 1
Query:  214 KGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGLGKL---VLNSDTL--SKDPFNTKNDQLVGWDKQKTNQ--VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSID-ETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDP 1104
            + K  R ST   + AWCP   +     +FL ++L  ++ L ++ T+G     HG   A SY + Y R+    W  ++ R  Q+ I GN++      + L P IIAR V+ YP A+   ++CL +++YGC +   +  Y    G  ++L+       D  YDG      L GGLG+L   VL  D    SK+         VGW ++   Q  V I F F + + F  + + ++   ++ V++FS +  +F    + +  +  L+  +  E     +  SV + L     + ++    F   W+++  I F S+P
Sbjct:   81 EAKHGRLSTGEGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGR-QWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPIYLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEP 393          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 134.806 bits (338), Expect = 1.149e-31
Identity = 92/304 (30.26%), Postives = 139/304 (45.72%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-----EETPLGDSVVVSEHTALDDAYSYL-QNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMND---------DLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            + ++K+L  + ++  +N+F KE+K +  L     P I++         PL    +V+E+    D   YL Q   L +   LH       IS   LI MASQIA GMK L  L  VHRDL+ RN L+  +         +  IKI+D  ++   ++ DY                                  I    VLPIRWM W+ +L G F+  SDV++FGVT WE+L++C++QPY  +T+EQVI N+        R   L  P    +   + +  C + +   RPSF  +  FL   ++
Sbjct:  670 LVAVKILRPDASKNARNDFLKEVKILSRLKD---PNIIRLLGVCVSSDPL---CMVTEYMESGDLNQYLSQRVLLDKTGPLH---NTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYY--------------------------------RIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAM 932          

HSP 2 Score: 121.324 bits (303), Expect = 1.794e-27
Identity = 84/314 (26.75%), Postives = 145/314 (46.18%), Query Frame = 1
Query:  214 KGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLT-------DFNYDGDKSDSYLSGGLGKL---VLNSDTL--SKDPFNTKNDQLVGWDKQKTNQ--VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSID-ETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDP 1104
            + K  R ST   + AWCP   +     +FL ++L  ++ L ++ T+G     HG   A SY + Y R+    W  ++ R  Q+ I GN++      + L P IIAR V+ YP A+   ++CL +++YGC +   +  Y    G  ++L+       D  YDG      L GGLG+L   VL  D    SK+         VGW ++   Q  V I F F + + F  + + ++   ++ V++FS +  +F    + +  +  L+  +  E     +  SV + L     + ++    F   W+++  I F S+P
Sbjct:   62 EAKHGRLSTGEGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGR-QWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPIYLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEP 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009339.1 (pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gene:ENSPMAG00000008449.1 transcript:ENSPMAT00000009339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 1.095e-31
Identity = 79/230 (34.35%), Postives = 113/230 (49.13%), Query Frame = 1
Query: 2191 KNEFFKEIKRILSLNHKCFPMILKFEETPLGDS--VVVSEHTALDDAYSYLQNFTLKELSDLH--YETGAKVISQ----SNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSN 2856
            +N+F KEIK +  L     P I++     + D    +++E+    D   +L       + D+   +    K+IS       L+YMASQI  GM +L  L  VHRDL+ RN L+  +   IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+LTLCR+QPY  LT+EQVI N+ 
Sbjct:    8 RNDFLKEIKIMSRLKD---PNIVRLLGVCMRDDPLSMITEYMVNGDLNQFLSRLP-SAIGDIFIFFAPHQKLISVPPKLDKLVYMASQIVSGMAYLSSLNFVHRDLATRNCLV-GEHHTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMAWESILLGKFTPASDVWAFGVTLWEMLTLCREQPYGALTDEQVIENTG 200          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 6.647e-24
Identity = 79/280 (28.21%), Postives = 125/280 (44.64%), Query Frame = 1
Query: 2152 SIKVLSKNTTQKLKNEFFKEIKRILSLN--HKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            +IK +++  T + + EF  E   + S N  H    + +  +  P+   +V+ E     D  SYL++       D   +      S   ++ MA +IA GM +L   K VHRDL+ RN ++  +D  +KI D  +  + + +DY            K    L                      LP+RWM  ++L  G F+  SDV+SFGV  WE+ T   +QPY  L+NEQV     L+ + D    +L +P    +   + I  C  +N   RP+F+EI
Sbjct:   93 AIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQAQPI---LVIMELMTRGDLKSYLRSLR----PDAEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVA-EDFTVKIGDFGMTRDIYETDY----------YRKGGKGL----------------------LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQA-EQPYQGLSNEQV-----LKFVMD--GGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 324          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 7.116e-24
Identity = 80/285 (28.07%), Postives = 126/285 (44.21%), Query Frame = 1
Query: 2152 SIKVLSKNTTQKLKNEFFKEIKRILSLN--HKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFT-----LKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            +IK +++  T + + EF  E   + S N  H    + +  +  P+   +V+ E     D  SYL++         E   L  +      S   ++ MA +IA GM +L   K VHRDL+ RN ++  +D  +KI D  +  + + +DY            K    L                      LP+RWM  ++L  G F+  SDV+SFGV  WE+ T   +QPY  L+NEQV     L+ + D    +L +P    +   + I  C  +N   RP+F+EI
Sbjct:   45 AIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQAQPI---LVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMV-AEDFTVKIGDFGMTRDIYETDY----------YRKGGKGL----------------------LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQA-EQPYQGLSNEQV-----LKFVMD--GGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 100.138 bits (248), Expect = 1.006e-22
Identity = 75/293 (25.60%), Postives = 130/293 (44.37%), Query Frame = 1
Query: 2137 EKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHY----------ETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            E  + + K L K+ +   + +F++E + + +L H+    I++F         V  E   L   + Y++N  L +   L            +   +++SQ+ ++ M SQIA GM +L     VHRDL+ RN L+    L++KI D  ++ + +S+DY                                  +    +LPIRWMP ++++   F+  SDV+S GV  WE+ T   KQP+++L+N +V I+   Q       R+L  P +   E  + +  C H     R    +I
Sbjct:  103 EPMLVAAKTL-KDLSDGARKDFYREAELLTNLQHE---HIVRFYG-------VCVEGEPLIMVFEYMKNGDLNKFLRLRGPDAVFMGDAPQAEPRLLSQAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLV-GAGLVVKIGDFGMSRDVYSTDYY--------------------------------RVGGHTMLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTY-GKQPWYQLSNTEV-IDCICQ------GRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDI 343          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 91.2781 bits (225), Expect = 1.117e-19
Identity = 61/205 (29.76%), Postives = 97/205 (47.32%), Query Frame = 1
Query: 2386 AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQ 3000
              V+   +LI MA Q+A GM +LE    +HRDL+ RN+L+  D+L  K++D  +A      +Y+      A    K                            P++W   +A     F+ KSDV+SFG+  +E++T   K PY  +TN +V     L+ L  E    +P P N  ++F   + +C H  E+ RPSF+++D  L+
Sbjct:  212 GGVLKMCHLINMAVQVASGMAYLEAQNYIHRDLAARNILV-GDNLTCKVADFGLARVIKDDEYI------AREGGK---------------------------FPVKWTAPEAANYSRFTIKSDVWSFGILLYEIVTY-GKVPYAGMTNAEV-----LEEL--EHGYRMPCPTNCPRDFYSIMYNCWHKEEACRPSFLQLDHQLE 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 50.447 bits (119), Expect = 1.471e-6
Identity = 48/211 (22.75%), Postives = 82/211 (38.86%), Query Frame = 1
Query: 2422 ASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK*DIKTTRFYKL 3054
             +Q   G+K+L    ++HRD+   N+L+  D+  +K++D  ++                       SS + L                     + WM  + L     S  SD++S G T  E+LT  +  PYH LT+  +           E     P P+++S+   DF++ C   N   RP+    D  L+H  I    ++K  +  K 
Sbjct:  127 VTQTLLGLKYLHGEGVIHRDIKAANILLSADNT-VKLADFGVST-------------------IVNSSALTLAGT------------------LNWMAPEILGNRGASTLSDIWSLGATVVEMLT--KNPPYHNLTDANIY-------YAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRPT---ADQLLKHVWINSTENVKVDKLNKF 286          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: KIN4 (Serine/threonine protein kinase; inhibits the mitotic exit network (MEN) when the spindle position checkpoint is activated; localized asymmetrically to mother cell cortex, spindle pole body and bud neck; KIN4 has a paralog, FRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005759])

HSP 1 Score: 49.2914 bits (116), Expect = 3.285e-6
Identity = 52/221 (23.53%), Postives = 97/221 (43.89%), Query Frame = 1
Query: 2140 KQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSV---VVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELL 2793
            KQ++ IK++ ++T +K  ++  K  + I +L H   P I+  EE  L +S    +V E  +  + Y Y+Q                + + +S+   + +Q+  G+ ++ Y  LVHRDL   N+L+   + L+ I+D    NE F  + ++ T                       SC +P      +V+  +   ++A        K+DV+S GV  + +L
Sbjct:   75 KQVA-IKLIRRDTIKKDADKEIKIYREINALKHLTHPNIIYLEEV-LQNSKYIGIVLEFVSGGEFYKYIQR--------------KRRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLV-ITDFGFVNEFFEDNELMKT-----------------------SCGSPCYAAPELVVSTKA--YEA-------RKADVWSCGVILYAML 246          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: FRK1 (Protein kinase of unknown cellular role; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; interacts with rRNA transcription and ribosome biogenesis factors and the long chain fatty acyl-CoA synthetase Faa3p; FRK1 has a paralog, KIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000006062])

HSP 1 Score: 49.2914 bits (116), Expect = 3.361e-6
Identity = 60/228 (26.32%), Postives = 102/228 (44.74%), Query Frame = 1
Query: 2131 FPEKQISSIKVLSKNTTQKLKNEFFKEIK---RILSLNHKCFPMILKFEETPLGDSV---VVSEHTALDDAYSYLQN-FTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELL 2793
            FP KQ++ IK++ +++   + N++ KE+K    I +L H   P I+K EE  L +S    +V E+    + Y Y+Q    LKE+               N   + SQ+  G+ ++    LVHRDL   N+L+  ++ L+ I+D    NE  S + ++ T                       SC +P      +V  I   P++A        K+D++S GV  + +L
Sbjct:   73 FP-KQVA-IKLIKRDS---ISNDYRKEVKIYREINALKHLSHPNIVKLEEV-LQNSRYIGIVLEYACGGEFYKYIQKKRRLKEM---------------NACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLV-ITDFGFVNEFCSRNELMKT-----------------------SCGSPCYAAPELV--ISAEPYEA-------RKADIWSCGVILYAIL 246          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 122.479 bits (306), Expect = 4.877e-31
Identity = 86/291 (29.55%), Postives = 140/291 (48.11%), Query Frame = 1
Query: 2161 VLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF-EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDE--------RARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHK 3006
            +L     + +K +FFKE+K +  + H+    +L   ++ P+    ++ E+    D   +L+    +EL+  +     KV  Q+ L+YMA Q+A GMK++   + VHRDL+ RN L+      +KI+D  ++   +S  Y                                  I   ++LPIRWM  + +LQG F++ SDV++FGVT WE+LTL  + PY +LT+E+VI N  L     +        R  I P P+ Y+K     +  C     S RP F +I  FL+++
Sbjct:    1 MLKAGVDKNIKQDFFKEVKIMAGVRHENVVRLLGVCKDDPM---CMIVEYMENGDLNQFLKQ---RELASGNSADPNKVTYQA-LLYMALQLAAGMKYIASHQFVHRDLATRNCLV-GHSFTVKIADFGMSRHLYSKHYY--------------------------------RIQGRVILPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYGDLTDEKVIENVQLMFFRPKSDAITFLSRPEICP-PDVYAK-----MRSCWAIEPSARPDFHDIHSFLENR 245          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO45490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSX1])

HSP 1 Score: 114.775 bits (286), Expect = 1.089e-28
Identity = 71/237 (29.96%), Postives = 121/237 (51.05%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF--EETPLGDSVVVSEHTALDDAYSYLQN---FTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQV 2841
            I ++K L +  + ++K  F +E+  +  L+H     +L    EE P G   ++ E  +  D   Y++    ++L+E          K ++Q +L+ ++ Q++ GM+HL+ ++ VHRDL+ RN L+  D L++KI+D  ++ + ++SDY                                 ++    V+PIRWMP +ALL G F+ +SDVYSFGV  WE+      QPY+  TNE+V
Sbjct:    3 IVAVKTLKQGCSNEMKTSFLQEVTLMAVLHHPNIVELLAVSTEEEPYG---MIFEFMSQGDLNQYMRKRGPYSLEE---------EKSLTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRNCLV-GDGLVVKIADFGMSRDVYASDY--------------------------------YKVEGQAVMPIRWMPPEALLYGRFTVESDVYSFGVLLWEVYAFAL-QPYYGYTNEEV 193          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 108.997 bits (271), Expect = 5.029e-26
Identity = 89/335 (26.57%), Postives = 154/335 (45.97%), Query Frame = 1
Query: 1990 FGSIHIG-EWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKE--IKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            F S++I  EW  P ++I +  ++     +  + +      E  +I    P+ +++ +K +S+N + + + EF +E  I +    NH    + +  +  P   ++VV E     D    L+NF      ++  E+     +   ++ MA +IA GM +L   K VHRDL+ RN ++ N +L +KI D  +  + + +DY            K    L                      LP+RWM  ++L  G F++ SDV+SFGV  WE+ TL   QPY   +NE+V     L+ + D    ++P P++      D +T C  F+   RP+F+ I
Sbjct:    2 FPSVYIADEWEVPREKI-KLIRELGNGSFGMVYEG-----EATDIVPNKPKCKVA-VKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQP---TLVVMELMDNGD----LKNFLRSHRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMV-NANLTVKIGDFGMTRDIYETDY----------YRKGGKGL----------------------LPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLA-SQPYPGKSNEEV-----LKYVVD--GGVMPKPDDCPDRLFDLMTLCWQFSPKARPTFLSI 281          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO39761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S933])

HSP 1 Score: 93.5893 bits (231), Expect = 2.130e-21
Identity = 61/192 (31.77%), Postives = 93/192 (48.44%), Query Frame = 1
Query: 2266 EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQV 2841
            EE P G   ++ E     D   YL++    E S       AK     +L+ +A Q+A GM+++  L+ VHRDL+ RN L+   D+++KI+D  ++ + + SDY   +  T                                +LPIRW+  +A L G F+ KSDVYS+GV  WE+ T    QPY+  TN++V
Sbjct:   32 EEEPYG---MIFEFMGEGDLNHYLRSAKPAESSAYKGPDDAK-----DLVGIAEQVAAGMEYVASLRFVHRDLATRNCLV-GTDMVVKIADFGMSRDVYGSDYYKMSRET--------------------------------MLPIRWLAPEAFLYGKFTVKSDVYSYGVLLWEIFTFGL-QPYYGYTNKEV 181          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO41236 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7S4Y9])

HSP 1 Score: 88.9669 bits (219), Expect = 2.163e-19
Identity = 68/269 (25.28%), Postives = 123/269 (45.72%), Query Frame = 1
Query: 2188 LKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHY------ETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSF 2976
            ++ +F +E++ ++++ H                S VVS      D+  +   F   E  DL        + G   ++ S+ + M S I  GM +L   K VH+DL+ RN ++  D L +KI  L ++ + ++++Y  F +                                 I++P+RWMP +A+   +F+ KSDV+SFGV  WE+ +L  + PY + ++E+V     L+ + D+    LP P+N     ++ +  C   N + RP+F
Sbjct:   51 VREDFTRELESLVNMEH----------------SNVVSLLGVCRDSEPFYMIFECFEKGDLKQFLLSCNDNGRSTLTSSHKLTMCSNIVSGMSYLAANKFVHKDLAARNCMVTKD-LQVKIGFLNLSYDLYNAEYYRFNN---------------------------------ILIPLRWMPSEAIFHDDFTEKSDVWSFGVLAWEIYSL-GQIPYTDRSDEEV-----LKCVKDDLR--LPKPDNCPDNMANVMKKCWEPNPNDRPNF 261          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 146.747 bits (369), Expect = 1.582e-35
Identity = 118/392 (30.10%), Postives = 167/392 (42.60%), Query Frame = 1
Query: 1861 LQSITTVND---PEIMFSLGSLFNDLSYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQ--ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            LQ +T  N    P +   L      LS  +VA+E      L + + +    FG +H+ E         E  ++F   EY               +F   PE Q  + ++K+L  +     +N+F KEIK +  L     P I++          V      L     Y++N  L +    H   G          +S SNL YMA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+L  C++QPY +LT+EQVI N+       +R   LP P   S      +  C   N   RPSF EI
Sbjct:  534 LQGVTGSNTYAIPAVTLDL------LSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------AEGMQEFLHEEY---------------LFD-IPEDQPVLVAVKMLRSDANGNARNDFLKEIKIMSRLKD---PNIIRL-------LAVCIYSNPLCMITEYMENGDLNQFLSRHEPEGQLALLSNTATVSFSNLCYMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPVLCSDSLYKIMLTCWRRNAKERPSFQEI 852          

HSP 2 Score: 126.331 bits (316), Expect = 4.541e-29
Identity = 91/360 (25.28%), Postives = 163/360 (45.28%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFN-------YDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD-PTNDIRIVEPTI 1137
             N   C   L  +  ++ D   + SS + E    +  R      + AWCP   +  D  ++F+ IDL  ++ + ++ T+G    G  +  A  Y+I+Y R+  S W  +R+R  ++ I+GN++        LDP IIAR+V+  P  +    +C+ +++YGCK++  ++ Y    G  + L  F        YDG  +   ++ GLG+  L+   +  D F   +          VGW+ +   +  V+I F F + +NF+ + +  +   S+++K+F  +   F  D             +DE      F  + V+L N +   +K    F   W++   I FQSD    +  +V PTI
Sbjct:   25 VNPDVCRYPLGMSGGQIRDEDISASSQWSESTAARHGRLDCEEGDGAWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQGRHAGGMGNEFAQMYMIKYSRDG-SRWISWRNRQGKQVIEGNRNTYDTVLRDLDPPIIARFVRFMPVTDHSMNVCMRVELYGCKWLDGLVSYNAPAGEQMKLPAFPVFFNDSVYDGAIT-HMMTEGLGQ--LSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDSDWESTVLSFSPVVDENDPSARF--ITVELTNRMANAIKCQFYFKDAWMLFSEITFQSDRAMYNTTLVPPTI 378          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 146.747 bits (369), Expect = 1.582e-35
Identity = 118/392 (30.10%), Postives = 167/392 (42.60%), Query Frame = 1
Query: 1861 LQSITTVND---PEIMFSLGSLFNDLSYANVALEN-----LKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQ--ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETG-------AKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEI 2985
            LQ +T  N    P +   L      LS  +VA+E      L + + +    FG +H+ E         E  ++F   EY               +F   PE Q  + ++K+L  +     +N+F KEIK +  L     P I++          V      L     Y++N  L +    H   G          +S SNL YMA+QIA GMK+L  L  VHRDL+ RN L+   +  IKI+D  ++   +S DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+L  C++QPY +LT+EQVI N+       +R   LP P   S      +  C   N   RPSF EI
Sbjct:  534 LQGVTGSNTYAIPAVTLDL------LSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCE--------AEGMQEFLHEEY---------------LFD-IPEDQPVLVAVKMLRSDANGNARNDFLKEIKIMSRLKD---PNIIRL-------LAVCIYSNPLCMITEYMENGDLNQFLSRHEPEGQLALLSNTATVSFSNLCYMATQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIKIADFGMSRNLYSGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPVLCSDSLYKIMLTCWRRNAKERPSFQEI 852          

HSP 2 Score: 126.331 bits (316), Expect = 4.541e-29
Identity = 91/360 (25.28%), Postives = 163/360 (45.28%), Query Frame = 1
Query:  121 TNTKSCSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIH-DKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFN-------YDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKND-------QLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSD-PTNDIRIVEPTI 1137
             N   C   L  +  ++ D   + SS + E    +  R      + AWCP   +  D  ++F+ IDL  ++ + ++ T+G    G  +  A  Y+I+Y R+  S W  +R+R  ++ I+GN++        LDP IIAR+V+  P  +    +C+ +++YGCK++  ++ Y    G  + L  F        YDG  +   ++ GLG+  L+   +  D F   +          VGW+ +   +  V+I F F + +NF+ + +  +   S+++K+F  +   F  D             +DE      F  + V+L N +   +K    F   W++   I FQSD    +  +V PTI
Sbjct:   25 VNPDVCRYPLGMSGGQIRDEDISASSQWSESTAARHGRLDCEEGDGAWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQGRHAGGMGNEFAQMYMIKYSRDG-SRWISWRNRQGKQVIEGNRNTYDTVLRDLDPPIIARFVRFMPVTDHSMNVCMRVELYGCKWLDGLVSYNAPAGEQMKLPAFPVFFNDSVYDGAIT-HMMTEGLGQ--LSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDSDWESTVLSFSPVVDENDPSARF--ITVELTNRMANAIKCQFYFKDAWMLFSEITFQSDRAMYNTTLVPPTI 378          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2b (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101156357])

HSP 1 Score: 138.658 bits (348), Expect = 5.309e-33
Identity = 106/364 (29.12%), Postives = 163/364 (44.78%), Query Frame = 1
Query: 1921 NDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKEL---SDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKE-FSDFITHCMHFNESTRPSFVEIDMFLQ 3000
             D S      E L + + +    FG +H+ E         E  + F       L + L+ G  +E++        + ++K L ++  +  +N+F KEI+ +  L     P I++          V  +   L     Y++N  L +    S + +  GA  +S + LI MA QIA GMK+L  L  VHRDL+ RN L+   +  I+I+D  ++   +  DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+LTLC++QPY +L++EQVI N+        +   LP P       ++D +  C   N   RPSF EI   LQ
Sbjct:  541 TDSSLREFPREKLSFKEKLGEGQFGEVHLCE--------AEGMQDF-------LDEDLSVGEISESLL-------LVAVKTLREDANKNARNDFLKEIRIMSRLRD---PNIVRL-------LAVCVDTDPLWMITEYMENGDLNQFLSRSKIFFLFGA--LSYTKLINMAVQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIRIADFGMSRNLYKGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYSQLSDEQVIENTGEFFRDKGKQVYLPKPPCCPDSVYNDLMLSCWRRNAKQRPSFQEIHAQLQ 837          

HSP 2 Score: 119.783 bits (299), Expect = 5.077e-27
Identity = 92/361 (25.48%), Postives = 167/361 (46.26%), Query Frame = 1
Query:   76 FLILISLELLFTATITN-TKSCSDKLLENKNKVPDSAFTESSY-KEEFKGKWARESTSPTEMAWCPN--NKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTD----FN---YDGDKSDSYLSGGLGKLVLNS----DTLSKDPFNT-KNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS 1098
            FL+   +E L+ +  +   + C   L     ++ D   + SSY  E    K+ R      + AWCP+  ++ H   +++L +DL  ++ + ++ T+G    G  +  A  Y I+Y R+  SNW  ++ R  Q+ I+GN++      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y + DG  +   D    FN   YDG    + L+ GLG+L   +    D L    +        VGW  +      V++ F F   +NF+ + +  S   S+ V++F  +   F  D          + + D  RV      V V L +   K +K    F+ +W++   + FQS
Sbjct:   12 FLLHTHIEYLWISVASCFPEVCRYPLGMTGGQIQDEDISASSYWSESTAAKFGRLDIGGGDGAWCPDIMSEPH-GLKEYLQVDLRSLHFITLVGTQGRHADGMGNEFAQRYRIKYSRDG-SNWVSWQDRKGQQVIEGNRNAYDVVLKDLEPPIIARYVRFMPVTDHSMIVCMRVELYGCEWLDGLVSYSIPDGHQMIYRDLEVSFNDSVYDG----ASLTKGLGQLTDGTWGLDDFLHSQIYGVWPGYDYVGWSNRTFPKGYVEMIFDFDHVRNFTSMKVHTSNMFSRGVRVFRQVTCFFWSDSEWEPGPITFRPTPD--RVSQRARFVTVTLGDRTAKTIKCRFHFSDVWMLFSEVAFQS 364          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2b (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101156357])

HSP 1 Score: 138.658 bits (348), Expect = 5.570e-33
Identity = 94/307 (30.62%), Postives = 145/307 (47.23%), Query Frame = 1
Query: 1951 ENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF--EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDL---HYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSN 2856
            E L + + +    FG +H+ E         E  + F       L + L+ G  +E++        + ++K L ++  +  +N+F KEI+ +  L       +L    +  PL    +++E+    D   +L N  LKE  D      E G   IS + LI MA QIA GMK+L  L  VHRDL+ RN L+   +  I+I+D  ++   +  DY                                  I    VLPIRWM W+++L G F+  SDV++FGVT WE+LTLC++QPY +L++EQVI N+ 
Sbjct:  552 EKLSFKEKLGEGQFGEVHLCE--------AEGMQDF-------LDEDLSVGEISESLL-------LVAVKTLREDANKNARNDFLKEIRIMSRLRDPNIVRLLAVCVDTDPL---WMITEYMENGDLNQFLCNLRLKEAPDEDKPEQEEGEDSISYTKLINMAVQIASGMKYLSSLNFVHRDLATRNCLV-GKNYTIRIADFGMSRNLYKGDYY--------------------------------RIQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYSQLSDEQVIENTG 800          

HSP 2 Score: 124.79 bits (312), Expect = 1.207e-28
Identity = 94/360 (26.11%), Postives = 168/360 (46.67%), Query Frame = 1
Query:   85 LISLELLFTATI---TNTKSCSDKLLENKNKVPDSAFTESSY-KEEFKGKWARESTSPTEMAWCPN--NKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFIS--ASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTD----FN---YDGDKSDSYLSGGLGKLVLNS----DTLSKDPFNT-KNDQLVGWDKQK--TNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS 1098
            +I L +L  AT+    N + C   L     ++ D   + SSY  E    K+ R      + AWCP+  ++ H   +++L +DL  ++ + ++ T+G    G  +  A  Y I+Y R+  SNW  ++ R  Q+ I+GN++      + L+P IIAR+V+  P  +    +C+ +++YGC+++  ++ Y + DG  +   D    FN   YDG  ++  L+ GLG+L   +    D L    +        VGW  +      V++ F F   +NF+ + +  S   S+ V++F  +   F  D          + + D  RV      V V L +   K +K    F+ +W++   + FQS
Sbjct:    5 VIRLFVLLAATVEAQVNPEVCRYPLGMTGGQIQDEDISASSYWSESTAAKFGRLDIGGGDGAWCPDIMSEPH-GLKEYLQVDLRSLHFITLVGTQGRHADGMGNEFAQRYRIKYSRDG-SNWVSWQDRKGQQVIEGNRNAYDVVLKDLEPPIIARYVRFMPVTDHSMIVCMRVELYGCEWLDGLVSYSIPDGHQMIYRDLEVSFNDSVYDGASAEG-LTKGLGQLTDGTWGLDDFLHSQIYGVWPGYDYVGWSNRTFPKGYVEMIFDFDHVRNFTSMKVHTSNMFSRGVRVFRQVTCFFWSDSEWEPGPITFRPTPD--RVSQRARFVTVTLGDRTAKTIKCRFHFSDVWMLFSEVAFQS 359          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 137.117 bits (344), Expect = 1.217e-32
Identity = 91/301 (30.23%), Postives = 138/301 (45.85%), Query Frame = 1
Query: 2146 ISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKF--EETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMND----------DLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSI 3012
            + ++K+L  + ++  +N+F KE+K +  L       +L       PL    +V+E+    D   YL +  L + +   +   A  IS   LI +ASQIA GMK L  L  VHRDL+ RN L+  D          +  IKI+D  ++   ++ DY                                  I    VLPIRWM W+ +L G F+  SDV++FGVT WE+L++C++QPY  LT+EQVI N+        R   L  P    +   + +  C + +   RPSF  I  FL   ++
Sbjct:  488 LVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSDPL---CMVTEYMECGDLNQYLSHRVLLDKTGPSHN--APTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMSRNLYAGDYY--------------------------------RIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQVYLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFLTEDAM 751          

HSP 2 Score: 112.464 bits (280), Expect = 6.587e-25
Identity = 78/277 (28.16%), Postives = 128/277 (46.21%), Query Frame = 1
Query:  136 CSDKLLENKNKVPDSAFTESS-YKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKG--LSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLN-------LTDFNYDGDKSDSYLSGGLGKL---VLNSD--TLSKDPFNTKNDQLVGWDKQKTNQ--VQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQF 915
            C   L      +PDS  + SS + +  + K  R ST   + AWCP   +     ++L IDL  ++ L ++ T+G     HG     SY + Y R+    W  ++ R  Q+ + GN +      + L P I+AR V+ YP A+   ++CL +++YGC +   +  Y    G  +N       L D  YDG        GGLG+L   VL  D  T +K+         VGW ++   Q  V I F F + + F  + + ++   ++ V++FS ++  F
Sbjct:   25 CRYALGMEAGTIPDSDISASSAWSDSTEAKHGRLSTGEGDGAWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRDG-VKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPVYLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLF 300          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000066441.1 (SMESG000066441.1)

HSP 1 Score: 1999.56 bits (5179), Expect = 0.000e+0
Identity = 981/984 (99.70%), Postives = 983/984 (99.90%), Query Frame = 1
Query:   70 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIRIVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTXXXXXXXXXXXXXXXXPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANS+WFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILK+IEFQSDPTNDIRIVEPTITK VIPFTQKPNIPFDNDFFSIPLAYTLVIVISILIIMLLIGIPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK
Sbjct:    1 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSSWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFNYDGDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQKTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKHIEFQSDPTNDIRIVEPTITKAVIPFTQKPNIPFDNDFFSIPLAYTLVIVISILIIMLLIGIPCVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 984          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 416.387 bits (1069), Expect = 3.215e-129
Identity = 322/1018 (31.63%), Postives = 493/1018 (48.43%), Query Frame = 1
Query:   70 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-YLN---------LTDFNYDGD-KSDSYLSGGLGKLVLNSDTLSKD--PFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS---DPTNDIRIVEP---------TITKTVIPFTQKPNIPFDNDFF---SIPLAYTXXXXXXXXXXXXXXXXPCVTILVR-RQKYRNKKCKEALRRHFQ-EEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCI--APNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            MNF+ ++S++    A   +  SC  KLL N+  VPD AF  SS++ +++ K+AR+S S  E AWCP  K+H+  ++F+ IDLG IY+LKMIMTKGLSRHG+ SAS Y I+YK E    W  YR+  + KKI GNKDHLTEK+    P+I+ RW++IYP ++  E ICL LQ+YGC+Y + ++EY+M DGS Y N          TD +YDG       L  GLGKL  + D    D  PFN  ++  VGW +   K + + I FRF   + F  + + A+ + + +V L   I+I FS DG  ++  + +  +I E R   +   + +DLK   G+FV I+L F S WI+++ I F S   +  +++   +P         T+TK ++    K N     D F   SI L    ++ I            C+  +++ ++K R +K K+A+    Q EE+ R LTL  Q  K   N    + V+N    L  +N +               TE   N  +   I  A N+ F N   + +    +  S+ ND  AT + S+  N  + + Y      +  SQ                                MY           R + +  I+T N PE   S       L+++      LK I+ IS   +G I +    RP               Y+         ++  NI  +F +  I  ++ + +++   +K  F +E+  +  +NHK     +  ++     S VV+E+T+L D ++ L++     LS L        I QS  +Y+A Q++  + +LEYL LVHRD++CRN+L+ +  L IK+SDLAIA  +F S Y     P              L SN   + QN + I S  ++PIRWMPW+ + + +FS KSDVY FGV  WEL   C++ PY  L+N Q+ +N +      +  + L  P + ++E  D I  C+      RP+F EI +F   K+ G K
Sbjct:    1 MNFITILSIK---NALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDS-SLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLT-DHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIV----KSNAITITDIFLSSSISLGILFLLAI------------CLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMK---NQTLYYPVAN----LSTLNTKF-------------HTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYND--ATKYFSMEKNIQTDLSYLDVRGPLGNSQ--------------------------------MY-----------RMNLINFISTTNYPEFS-SFHEFVKQLNFS-----ELKTIENISNNSYGRIDVA---RP------------SIGYSPYEMEPYKDMDNSNIEGKFSD-TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLES-----LSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQL------------LDSN---NKQNEV-IKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 889          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 416.387 bits (1069), Expect = 3.615e-129
Identity = 322/1018 (31.63%), Postives = 493/1018 (48.43%), Query Frame = 1
Query:   70 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-YLN---------LTDFNYDGD-KSDSYLSGGLGKLVLNSDTLSKD--PFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS---DPTNDIRIVEP---------TITKTVIPFTQKPNIPFDNDFF---SIPLAYTXXXXXXXXXXXXXXXXPCVTILVR-RQKYRNKKCKEALRRHFQ-EEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCI--APNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            MNF+ ++S++    A   +  SC  KLL N+  VPD AF  SS++ +++ K+AR+S S  E AWCP  K+H+  ++F+ IDLG IY+LKMIMTKGLSRHG+ SAS Y I+YK E    W  YR+  + KKI GNKDHLTEK+    P+I+ RW++IYP ++  E ICL LQ+YGC+Y + ++EY+M DGS Y N          TD +YDG       L  GLGKL  + D    D  PFN  ++  VGW +   K + + I FRF   + F  + + A+ + + +V L   I+I FS DG  ++  + +  +I E R   +   + +DLK   G+FV I+L F S WI+++ I F S   +  +++   +P         T+TK ++    K N     D F   SI L    ++ I            C+  +++ ++K R +K K+A+    Q EE+ R LTL  Q  K   N    + V+N    L  +N +               TE   N  +   I  A N+ F N   + +    +  S+ ND  AT + S+  N  + + Y      +  SQ                                MY           R + +  I+T N PE   S       L+++      LK I+ IS   +G I +    RP               Y+         ++  NI  +F +  I  ++ + +++   +K  F +E+  +  +NHK     +  ++     S VV+E+T+L D ++ L++     LS L        I QS  +Y+A Q++  + +LEYL LVHRD++CRN+L+ +  L IK+SDLAIA  +F S Y     P              L SN   + QN + I S  ++PIRWMPW+ + + +FS KSDVY FGV  WEL   C++ PY  L+N Q+ +N +      +  + L  P + ++E  D I  C+      RP+F EI +F   K+ G K
Sbjct:    5 MNFITILSIK---NALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDS-SLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLT-DHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIV----KSNAITITDIFLSSSISLGILFLLAI------------CLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMK---NQTLYYPVAN----LSTLNTKF-------------HTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYND--ATKYFSMEKNIQTDLSYLDVRGPLGNSQ--------------------------------MY-----------RMNLINFISTTNYPEFS-SFHEFVKQLNFS-----ELKTIENISNNSYGRIDVA---RP------------SIGYSPYEMEPYKDMDNSNIEGKFSD-TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLES-----LSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQL------------LDSN---NKQNEV-IKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 893          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 410.223 bits (1053), Expect = 4.739e-127
Identity = 321/1018 (31.53%), Postives = 491/1018 (48.23%), Query Frame = 1
Query:   70 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-YLN---------LTDFNYDGD-KSDSYLSGGLGKLVLNSDTLSKD--PFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS---DPTNDIRIVEP---------TITKTVIPFTQKPNIPFDNDFF---SIPLAYTXXXXXXXXXXXXXXXXPCVTILVR-RQKYRNKKCKEALRRHFQ-EEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCI--APNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            MNF+ ++S++    A   +  SC  KLL N+  VPD AF  SS++ +++ K+AR+S S  E AWCP  K+H+  ++F+ IDLG IY+LKMIMTKGLSRHG+ SAS Y I+YK E    W  YR+     KI GNKDHLTEK+    P+I+ RW++IYP ++  E ICL LQ+YGC+Y + ++EY+M DGS Y N          TD +YDG       L  GLGKL  + D    D  PFN  ++  VGW +   K + + I FRF   + F  + + A+ + + +V L   I+I FS DG  ++  + +  +I E R   +   + +DLK   G+FV I+L F S WI+++ I F S   +  +++   +P         T+TK ++    K N     D F   SI L    ++ I            C+  +++ ++K R +K K+A+    Q EE+ R LTL  Q  K   N    + V+N    L  +N +               TE   N  +   I  A N+ F N   + +    +  S+ ND  AT + S+  N  + + Y      +  SQ                                MY           R + +  I+T N PE   S       L+++      LK I+ IS   +G I +    RP               Y+         ++  NI  +F +  I  ++ + +++   +K  F +E+  +  +NHK     +  ++     S VV+E+T+L D ++ L++     LS L        I QS  +Y+A Q++  + +LEYL LVHRD++CRN+L+ +  L IK+SDLAIA  +F S Y     P              L SN   + QN + I S  ++PIRWMPW+ + + +FS KSDVY FGV  WEL   C++ PY  L+N Q+ +N +      +  + L  P + ++E  D I  C+      RP+F EI +F   K+ G K
Sbjct:    1 MNFITILSIK---NALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDS-SLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN-----KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLT-DHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIV----KSNAITITDIFLSSSISLGILFLLAI------------CLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMK---NQTLYYPVAN----LSTLNTKF-------------HTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYND--ATKYFSMEKNIQTDLSYLDVRGPLGNSQ--------------------------------MY-----------RMNLINFISTTNYPEFS-SFHEFVKQLNFS-----ELKTIENISNNSYGRIDVA---RP------------SIGYSPYEMEPYKDMDNSNIEGKFSD-TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLES-----LSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQL------------LDSN---NKQNEV-IKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 884          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 409.453 bits (1051), Expect = 1.148e-126
Identity = 321/1018 (31.53%), Postives = 491/1018 (48.23%), Query Frame = 1
Query:   70 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-YLN---------LTDFNYDGD-KSDSYLSGGLGKLVLNSDTLSKD--PFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQS---DPTNDIRIVEP---------TITKTVIPFTQKPNIPFDNDFF---SIPLAYTXXXXXXXXXXXXXXXXPCVTILVR-RQKYRNKKCKEALRRHFQ-EEHARFLTLSQQQFKDSVNNPTLFTVSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCI--APNFSFINTCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQINLKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQSITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 3021
            MNF+ ++S++    A   +  SC  KLL N+  VPD AF  SS++ +++ K+AR+S S  E AWCP  K+H+  ++F+ IDLG IY+LKMIMTKGLSRHG+ SAS Y I+YK E    W  YR+     KI GNKDHLTEK+    P+I+ RW++IYP ++  E ICL LQ+YGC+Y + ++EY+M DGS Y N          TD +YDG       L  GLGKL  + D    D  PFN  ++  VGW +   K + + I FRF   + F  + + A+ + + +V L   I+I FS DG  ++  + +  +I E R   +   + +DLK   G+FV I+L F S WI+++ I F S   +  +++   +P         T+TK ++    K N     D F   SI L    ++ I            C+  +++ ++K R +K K+A+    Q EE+ R LTL  Q  K   N    + V+N    L  +N +               TE   N  +   I  A N+ F N   + +    +  S+ ND  AT + S+  N  + + Y      +  SQ                                MY           R + +  I+T N PE   S       L+++      LK I+ IS   +G I +    RP               Y+         ++  NI  +F +  I  ++ + +++   +K  F +E+  +  +NHK     +  ++     S VV+E+T+L D ++ L++     LS L        I QS  +Y+A Q++  + +LEYL LVHRD++CRN+L+ +  L IK+SDLAIA  +F S Y     P              L SN   + QN + I S  ++PIRWMPW+ + + +FS KSDVY FGV  WEL   C++ PY  L+N Q+ +N +      +  + L  P + ++E  D I  C+      RP+F EI +F   K+ G K
Sbjct:    5 MNFITILSIK---NALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDS-SLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN-----KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLT-DHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIV----KSNAITITDIFLSSSISLGILFLLAI------------CLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMK---NQTLYYPVAN----LSTLNTKF-------------HTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYND--ATKYFSMEKNIQTDLSYLDVRGPLGNSQ--------------------------------MY-----------RMNLINFISTTNYPEFS-SFHEFVKQLNFS-----ELKTIENISNNSYGRIDVA---RP------------SIGYSPYEMEPYKDMDNSNIEGKFSD-TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLES-----LSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQL------------LDSN---NKQNEV-IKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 888          
The following BLAST results are available for this feature:
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR25.217e-3426.12discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR25.217e-3426.12discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR25.217e-3426.12discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR11.349e-3225.51discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
DDR11.349e-3225.51discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr-16.591e-3129.05Discoidin domain-containing receptor A [Source:Un... [more]
ddr-24.716e-2927.83Discoidin domain-containing receptor tyrosine kina... [more]
cam-12.608e-2828.30Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-13.610e-2828.30Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.086e-2828.30Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr4.312e-3732.66gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr4.312e-3732.66gene:FBgn0053531 transcript:FBtr0344770[more]
smal2.118e-3427.75gene:FBgn0085409 transcript:FBtr0329980[more]
smal2.118e-3427.75gene:FBgn0085409 transcript:FBtr0112617[more]
smal4.028e-3427.75gene:FBgn0085409 transcript:FBtr0329979[more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2a2.392e-3730.33discoidin domain receptor tyrosine kinase 2a [Sour... [more]
ddr2b1.555e-3332.40discoidin domain receptor tyrosine kinase 2b [Sour... [more]
ddr2l2.400e-3228.72discoidin domain receptor family, member 2, like [... [more]
BX088694.12.441e-3228.39discoidin domain receptor family, member 2, like [... [more]
FP015875.12.527e-3228.72discoidin domain receptor family, member 2, like [... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR23.632e-6724.85discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR21.053e-6324.90discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR21.868e-3328.37discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.120e-3328.37discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.735e-3328.53discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr17.575e-3425.24discoidin domain receptor family, member 1 [Source... [more]
Ddr11.105e-3325.24discoidin domain receptor family, member 1 [Source... [more]
Ddr11.105e-3325.24discoidin domain receptor family, member 1 [Source... [more]
Ddr11.105e-3325.24discoidin domain receptor family, member 1 [Source... [more]
Ddr11.105e-3325.24discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16832|DDR2_HUMAN2.505e-3326.12Discoidin domain-containing receptor 2 OS=Homo sap... [more]
sp|Q03146|DDR1_MOUSE7.727e-3325.24Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q62371|DDR2_MOUSE7.089e-3228.39Discoidin domain-containing receptor 2 OS=Mus musc... [more]
sp|Q7YR43|DDR1_PANTR8.977e-3225.51Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q08345|DDR1_HUMAN9.132e-3225.51Epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QMW44.010e-8826.73Discoidin domain-containing receptor 2 OS=Crassost... [more]
A0A194QW376.000e-6724.55Discoidin domain-containing receptor 2 OS=Papilio ... [more]
H3D6L65.312e-6625.40Discoidin domain receptor tyrosine kinase 2a OS=Te... [more]
Q4S3E46.915e-6625.40Chromosome 1 SCAF14751, whole genome shotgun seque... [more]
A0A0N0U7T23.811e-6525.87Discoidin domain-containing receptor 2 OS=Melipona... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019857.22.067e-3729.12discoidin domain-containing receptor 2-like [Sourc... [more]
ddr2a1.225e-3427.88discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2l6.459e-3331.96discoidin domain receptor family, member 2, like [... [more]
ddr11.088e-3130.26discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr11.149e-3130.26discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009339.11.095e-3134.35pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gen... [more]
ENSPMAT00000009481.16.647e-2428.21pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
ENSPMAT00000009485.17.116e-2428.07pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
NTRK21.006e-2225.60neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
frk1.117e-1929.76fyn-related Src family tyrosine kinase [Source:ZFI... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC151.471e-622.75Protein kinase of the Mitotic Exit Network; locali... [more]
KIN43.285e-623.53Serine/threonine protein kinase; inhibits the mito... [more]
FRK13.361e-626.32Protein kinase of unknown cellular role; green flu... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442694.877e-3129.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454901.089e-2829.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476525.029e-2626.57Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO397612.130e-2131.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412362.163e-1925.28Tyrosine-protein kinase receptor [Source:UniProtK... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2a1.582e-3530.10discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2a1.582e-3530.10discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2b5.309e-3329.12discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr2b5.570e-3330.62discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr11.217e-3230.23epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066441.10.000e+099.70SMESG000066441.1[more]
SMESG000021250.13.215e-12931.63SMESG000021250.1[more]
SMESG000021250.13.615e-12931.63SMESG000021250.1[more]
SMESG000021250.14.739e-12731.53SMESG000021250.1[more]
SMESG000021250.11.148e-12631.53SMESG000021250.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008007 ID=SMED30008007|Name=Discoidin domain-containing receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3213bp
ATTAATTTAGCTGTCATTCTTATTATTATCACGCAAAAATCCGATCAAAA
TTGATTATGCACCAATAGAATGAATTTTCTCATTTTAATATCTTTGGAAT
TATTATTCACAGCCACGATTACAAATACGAAAAGCTGTTCAGATAAATTA
TTAGAAAACAAGAACAAAGTACCGGATTCAGCATTTACTGAATCAAGCTA
TAAAGAAGAATTCAAAGGAAAGTGGGCTAGGGAATCAACCTCACCAACAG
AGATGGCCTGGTGCCCGAATAATAAAATACATGATAAAAGAAGAGATTTT
TTAATGATTGATCTTGGTGATATTTATATATTAAAAATGATAATGACGAA
AGGATTAAGCAGACATGGATTCATCAGTGCATCGTCTTACATAATTGAAT
ACAAACGAGAAGCGAATTCTAATTGGTTTGAATATCGTTCAAGAGGAAAG
CAAAAAAAAATAAAAGGCAACAAAGATCACCTTACCGAGAAATATGAATC
ACTTGATCCGGCAATAATAGCACGGTGGGTAAAAATATACCCATATGCAA
ACATAGAAGAAACAATTTGTTTGGTTTTACAAATATATGGATGCAAATAT
ATGAGCCAAATTATGGAATACAGAATGGATGACGGTTCATATTTAAATTT
AACTGATTTTAATTATGATGGGGATAAATCAGATTCATATTTATCTGGTG
GTTTGGGAAAATTAGTTTTGAACTCAGACACATTGTCAAAAGATCCTTTT
AATACCAAAAATGACCAATTAGTCGGTTGGGATAAGCAAAAAACCAATCA
AGTTCAGATAACTTTTCGGTTTGCTCAATTTCAAAACTTTTCTAAACTGT
TAATTGAGGCATCTATTTTTCCATCTAAAAACGTTAAATTATTCTCGCAT
ATTCAAATTCAATTCAGTTACGATGGTGTGACATATGACGAGAAGCGAGT
CCTCCAACAATCCATCGACGAAACGAGAGTAATTAATAATTTTCATTCGG
TTCCAGTTGATTTGAAGAACAATGTTGGGAAATTTGTCAAAATATCTCTA
ACGTTTAACTCGATTTGGATTATACTGAAGTACATTGAATTCCAAAGTGA
TCCCACAAATGACATCAGAATCGTGGAGCCAACTATAACAAAAACAGTGA
TACCATTTACTCAAAAACCAAATATTCCATTTGATAATGACTTCTTCTCA
ATTCCATTGGCATATACTTTAGTAATAGTTATCTCAATCCTAATCATTAT
GCTTCTTATTGGAATTCCCTGTGTGACAATATTAGTTAGACGACAGAAAT
ATCGAAATAAAAAATGTAAAGAAGCTCTTCGGCGGCACTTTCAAGAAGAA
CATGCTCGGTTTTTAACTTTATCGCAACAGCAGTTCAAAGACTCGGTAAA
TAATCCAACTTTATTTACGGTTTCTAATTTCAACCCGAGTCTTCCAAACA
TAAATGGGAGAATGATGCAAGAATCTTCTATTTATACAAGTCTGGCTGGT
TCAGACACAGAAAGCAATTGTAACAGCGACAAACCGCAATGTATAGCCCC
TAATTTCAGTTTCATTAATACCTGCCCAATTATCAACCCTCTAACATCAA
ATAGAGGAAGCATTTCAAATGATTATTCAGCCACGTCTTTCACGAGTCTA
GGTTCAAATGGTGCTTCTTATGTACCATATTATGTAAACAATGCTCAAAT
GGCTCGCAGTCAAATTAATTTAAAATCCCATTATGACATGGTGAATCCCA
TATCATCTAATCCAAATGAATCTTTTGCCAATGATGAACCTAGTCATAGG
TCTATACCGATGTATGGACCTGCTCGAGTGTCAATTCAAGGTCCTCTGCG
AAATTCGAAATTGCAGTCTATAACTACCGTAAACGATCCGGAAATTATGT
TTTCTCTTGGCTCACTGTTTAATGACCTCAGTTATGCAAATGTCGCTCTG
GAAAACCTGAAATATATAAAAACCATTAGCCGTTGTCATTTTGGAAGCAT
CCATATTGGTGAGTGGCTGAGACCCCACGATCAGATCATGGAAACGAATA
AAAAATTCCAATGCCACGAGTACAACACTTTGAGACAAAGTCTTACAACT
GGAATAGAAACTGAAAATATATTTCAACAATTTCCGGAAAAACAAATCTC
ATCAATTAAGGTGTTATCTAAAAATACAACTCAAAAATTGAAGAATGAAT
TTTTCAAAGAAATCAAAAGAATTTTGTCGTTAAATCACAAGTGCTTTCCA
ATGATTTTAAAATTTGAAGAAACTCCTTTGGGGGACAGTGTAGTTGTCAG
TGAACACACAGCACTGGATGATGCGTACAGTTACTTGCAAAATTTTACCC
TCAAAGAATTAAGTGATTTGCACTATGAAACGGGAGCAAAGGTTATCAGC
CAATCAAATCTGATCTATATGGCATCACAGATTGCTTGTGGAATGAAACA
TTTAGAATATTTGAAACTGGTTCATCGCGATTTATCTTGTCGCAACGTTT
TGATCATGAATGATGATTTACTTATTAAAATATCTGATTTGGCAATAGCG
AATGAAAAGTTCAGCTCTGATTATGTAATTTTCACCGACCCCACAGCAAA
TCATATTCACAAGAGTACATCTAGTCTCATTCAACTCCAGTCAAATCCAA
TACATTCTTGTCAAAATCCCATTGAAATAAATTCAGTTATCGTTCTACCG
ATTCGGTGGATGCCATGGCAGGCATTATTACAGGGCAATTTTTCCAATAA
ATCAGATGTATATTCTTTTGGAGTGACGTTTTGGGAATTGTTGACTTTGT
GCAGAAAACAACCATATCACGAGTTGACAAATGAGCAAGTTATCATCAAC
AGCAATTTGCAAGCTTTGGGAGATGAGAGAGCCCGAATTCTGCCAGTGCC
CAACAATTATTCAAAAGAATTTTCAGATTTCATAACCCACTGCATGCATT
TCAATGAATCTACACGGCCATCTTTTGTTGAAATCGACATGTTTTTACAG
CACAAATCTATTGGAATTAAATGAGACATAAAAACAACCCGATTTTATAA
GCTTATACTTATATTGAATTGTACATTATTTGTTTTAAAACATTGATGAA
CCGTGTGATTTTTAAAAGCTTTATTGTTACATAGAAAATCAAAAATTGTT
TTTTTTCAAAAAAAAAAATAAATTAGGAATTCATATTTCGAATTTATACC
GAATATGTGCGGT
back to top

protein sequence of SMED30008007-orf-1

>SMED30008007-orf-1 ID=SMED30008007-orf-1|Name=SMED30008007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=985bp
MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKG
KWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHG
FISASSYIIEYKREANSNWFEYRSRGKQKKIKGNKDHLTEKYESLDPAII
ARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGSYLNLTDFNYD
GDKSDSYLSGGLGKLVLNSDTLSKDPFNTKNDQLVGWDKQKTNQVQITFR
FAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSID
ETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKYIEFQSDPTNDIR
IVEPTITKTVIPFTQKPNIPFDNDFFSIPLAYTLVIVISILIIMLLIGIP
CVTILVRRQKYRNKKCKEALRRHFQEEHARFLTLSQQQFKDSVNNPTLFT
VSNFNPSLPNINGRMMQESSIYTSLAGSDTESNCNSDKPQCIAPNFSFIN
TCPIINPLTSNRGSISNDYSATSFTSLGSNGASYVPYYVNNAQMARSQIN
LKSHYDMVNPISSNPNESFANDEPSHRSIPMYGPARVSIQGPLRNSKLQS
ITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWL
RPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLS
KNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALD
DAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKL
VHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKST
SSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSF
GVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKE
FSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000478pharynx musculature
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008979Galactose-bd-like_sf
IPR000421FA58C
IPR008266Tyr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 691..978
e-value: 6.5E-21
score: 74.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 630..981
score: 24.019
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 12..179
e-value: 1.4E-29
score: 105.0
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 30..177
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 60..169
e-value: 2.2E-10
score: 40.8
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 63..95
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 23..175
score: 23.002
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 180..350
e-value: 3.9E-34
score: 119.8
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 57..836
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 873..982
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 873..982
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 57..836
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.664
NoneNo IPR availableTMHMMTMhelixcoord: 384..406
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 800..812
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 606..972