cdc7-like protein

Overview
Namecdc7-like protein (ACT98293.1)
Smed IDSMED30008000
Length (bp)1404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cdc7-like protein (SMED30008000) t-SNE clustered cells

Violin plots show distribution of expression levels for cdc7-like protein (SMED30008000) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cdc7-like protein (SMED30008000) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cdc7-like protein (SMED30008000) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008000

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008000h1SMcG0015961 SmedASXL_009347SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30008000h1SMcG0002674 dd_Smed_v4_16034_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cdc7-like protein vs. Ensembl Human
Match: CDC7 (cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC:1745])

HSP 1 Score: 143.665 bits (361), Expect = 1.005e-36
Identity = 70/156 (44.87%), Postives = 101/156 (64.74%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            E V Q S++   F+I DKIGEG+F++V+   ++     +E  ALK  IP   P RI  EL+ L   GG+ NV+ + + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL  ALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA 
Sbjct:   49 EAVPQLSNV---FKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQ 201          

HSP 2 Score: 76.2554 bits (186), Expect = 3.961e-14
Identity = 48/184 (26.09%), Postives = 83/184 (45.11%), Query Frame = 3
Query:  696 HSDFGNEKIAIK------SIDSQNNMKRQDTGTLKSRLSDTSIL---SESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKI 1220
            HS   +E  A+K      ++D  +         + +++ +++++   + S     +C C      C  C +R      R GT G+R PEV  +   QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + I+ + K +P             Q +RK CE++
Sbjct:  295 HSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCS-KEVP------------AQDLRKLCERL 465          
BLAST of cdc7-like protein vs. Ensembl Human
Match: CDC7 (cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC:1745])

HSP 1 Score: 143.665 bits (361), Expect = 1.005e-36
Identity = 70/156 (44.87%), Postives = 101/156 (64.74%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            E V Q S++   F+I DKIGEG+F++V+   ++     +E  ALK  IP   P RI  EL+ L   GG+ NV+ + + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL  ALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA 
Sbjct:   49 EAVPQLSNV---FKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQ 201          

HSP 2 Score: 76.2554 bits (186), Expect = 3.961e-14
Identity = 48/184 (26.09%), Postives = 83/184 (45.11%), Query Frame = 3
Query:  696 HSDFGNEKIAIK------SIDSQNNMKRQDTGTLKSRLSDTSIL---SESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKI 1220
            HS   +E  A+K      ++D  +         + +++ +++++   + S     +C C      C  C +R      R GT G+R PEV  +   QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + I+ + K +P             Q +RK CE++
Sbjct:  295 HSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCS-KEVP------------AQDLRKLCERL 465          
BLAST of cdc7-like protein vs. Ensembl Human
Match: CAMK1G (calcium/calmodulin dependent protein kinase IG [Source:HGNC Symbol;Acc:HGNC:14585])

HSP 1 Score: 85.5001 bits (210), Expect = 2.798e-18
Identity = 63/235 (26.81%), Postives = 115/235 (48.94%), Query Frame = 3
Query:  186 YVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFT--IPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRD---YLRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKR--------QDTGTLKSRL-SDTSILSESNQIEASCI 842
            + KQ ++I   F  ++ +G G+F+ VF V+ +   +  ++FALK     P      +ENE+ +LKKI   +N++ L   +    H +++M  V   +  D  L   +   +D    ++ +L A+K++HEN I+HRD+KP N LY       K  + DFGL+  E +G + +      +         + S+D+ ++MK+            T+   L S  + LS+   + A+C+
Sbjct:   12 WKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQR---LTGKLFALKCIKKSPAFRDSSLENEIAVLKKIK-HENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGIMSTACGTPGY---------VGSVDTPHSMKKRSLSFSRRSRRATMSLSLHSGMTFLSQPRTLFATCL 233          
BLAST of cdc7-like protein vs. Ensembl Human
Match: CDC7 (cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC:1745])

HSP 1 Score: 80.8777 bits (198), Expect = 2.158e-17
Identity = 42/112 (37.50%), Postives = 66/112 (58.93%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDY 518
            E V Q S++   F+I DKIGEG+F++V+   ++     +E  ALK  IP   P RI  EL+ L   GG+ NV+ + + FR  DH+ + MP+++H  F+D    +   E+R+Y
Sbjct:   49 EAVPQLSNV---FKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY 157          
BLAST of cdc7-like protein vs. Ensembl Human
Match: CAMK1G (calcium/calmodulin dependent protein kinase IG [Source:HGNC Symbol;Acc:HGNC:14585])

HSP 1 Score: 84.7297 bits (208), Expect = 5.927e-17
Identity = 52/167 (31.14%), Postives = 89/167 (53.29%), Query Frame = 3
Query:  186 YVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF--TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRD---YLRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHG 665
            + KQ ++I   F  ++ +G G+F+ VF V+ +   +  ++FALK     P      +ENE+ +LKKI   +N++ L   +    H +++M  V   +  D  L   +   +D    ++ +L A+K++HEN I+HRD+KP N LY       K  + DFGL+  E +G
Sbjct:   12 WKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQR---LTGKLFALKCIKKSPAFRDSSLENEIAVLKKIK-HENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQNG 174          
BLAST of cdc7-like protein vs. Ensembl Celegans
Match: cdc-7 (Cell Division Cycle related [Source:UniProtKB/TrEMBL;Acc:O01493])

HSP 1 Score: 104.375 bits (259), Expect = 4.031e-24
Identity = 93/384 (24.22%), Postives = 154/384 (40.10%), Query Frame = 3
Query:  237 IGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID--YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQ-VRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLP-----LIGAFN---DWIKSRCQFIRKNCEKITKLIKDNSDKNCIY------------GNHAEFDDSAYDLLSKLLE 1319
            IGEGSF  V     +  +  + I A++    I     +  EL +L ++GG  N++KL   F     + +++    H    +  ++   D++    Y RNLL A+ ++H N  +HRD+K +NFLY  + ++F LVDFGLA                            ++D   N             S +  ++   +    C C    + C  CR +P  +     GT G R PE+         ++D ++ GI++   ++ K+PFF   D+ +    L + L  E ++  A     R+ ++ K  P     LI       D ++  C   R+ C    K   +NS   C              GN  E      DLL + LE
Sbjct:   34 IGEGSFGTVISATCRTTQEKRAIKAIR---RIEKMSMLSIELELLSELGGHFNIVKLFEFFHFNGSVAIVLEHFPHCTATELLFHSKRDLSFALSYFRNLLYAVAYLHHNGYVHRDIKLSNFLYSPQTQRFRLVDFGLA----------------------------TVDRSKN-----------ECSRSHAVAAMERDPECCSCKGTSSPCMFCRGKPKRENYNVVGTPGVRAPELLFGIGLCHPSIDIFSCGIVLLSLVSVKHPFFMPKDETENIMHLAFLLGSETIEKMAHSEGLRVTLSEKLPPADYYHLILCLRFGFDHVRRHCSSSRQPCTICQKRSFNNSMGVCFCRKNYETDMFSTGGNETELMTIYVDLLYRTLE 375          
BLAST of cdc7-like protein vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 78.9518 bits (193), Expect = 2.942e-15
Identity = 46/157 (29.30%), Postives = 84/157 (53.50%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF--------TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL---LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRR-KKFTLVDFGLA 647
            D +EI  ++G G FA V +VR +K     E +A KF        +   +  + IE E+R+L+KI G  NV++LH  +     + +++  V   +  D+      +D  E   +++ +L+A++H+H   I+H D+KP N +  +R   +  ++DFGL+
Sbjct:   26 DVYEIETELGSGQFAVVRRVRDRKT---GEKYAAKFIKKRRYATSRRGVTRQNIEREVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDHVCAKECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRGDSQIKIIDFGLS 179          
BLAST of cdc7-like protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 73.559 bits (179), Expect = 1.152e-13
Identity = 50/174 (28.74%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  159 TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEV 659
            T I+I  V    + +D    FE++  +G+GSF  VF VR  +      ++A+K     T+ + D +R + E  IL  I     ++KLH+AF+ +  +++++ F+   D    +   ++   ++++ YL  L +AL+H+H   I++RD+KP N L D       + DFGL+   +
Sbjct:   79 TEIDIGDVRKCGEKADPR-QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHIS-HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLD-ADGHIKVTDFGLSKEAI 249          

HSP 2 Score: 53.5286 bits (127), Expect = 2.338e-7
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  168 NIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIE--NELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL----LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY---DRRRKKFTLVDFGLA 647
            ++RSV   K  +   D++EI++KIG G+ + V K + K           K+ + I+     +   E+ IL +    + V+KL   +  +  I+M+    +  + +D  +    L    E+   + NLL A++++H  ++ HRD+   N L+   D       +VDFG A
Sbjct:  432 SVRSVPTAKT-NPFTDDYEILEKIGNGAHSVVHKCQMKATRR-------KYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFA 592          
BLAST of cdc7-like protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 73.559 bits (179), Expect = 1.309e-13
Identity = 50/174 (28.74%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  159 TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEV 659
            T I+I  V    + +D    FE++  +G+GSF  VF VR  +      ++A+K     T+ + D +R + E  IL  I     ++KLH+AF+ +  +++++ F+   D    +   ++   ++++ YL  L +AL+H+H   I++RD+KP N L D       + DFGL+   +
Sbjct:   85 TEIDIGDVRKCGEKADPR-QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHIS-HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLD-ADGHIKVTDFGLSKEAI 255          

HSP 2 Score: 53.5286 bits (127), Expect = 2.686e-7
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  168 NIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIE--NELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL----LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY---DRRRKKFTLVDFGLA 647
            ++RSV   K  +   D++EI++KIG G+ + V K + K           K+ + I+     +   E+ IL +    + V+KL   +  +  I+M+    +  + +D  +    L    E+   + NLL A++++H  ++ HRD+   N L+   D       +VDFG A
Sbjct:  438 SVRSVPTAKT-NPFTDDYEILEKIGNGAHSVVHKCQMKATRR-------KYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFA 598          
BLAST of cdc7-like protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 73.1738 bits (178), Expect = 1.613e-13
Identity = 50/174 (28.74%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  159 TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEV 659
            T I+I  V    + +D    FE++  +G+GSF  VF VR  +      ++A+K     T+ + D +R + E  IL  I     ++KLH+AF+ +  +++++ F+   D    +   ++   ++++ YL  L +AL+H+H   I++RD+KP N L D       + DFGL+   +
Sbjct:   46 TEIDIGDVRKCGEKADPR-QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHIS-HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLD-ADGHIKVTDFGLSKEAI 216          

HSP 2 Score: 53.1434 bits (126), Expect = 3.544e-7
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  168 NIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIE--NELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL----LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY---DRRRKKFTLVDFGLA 647
            ++RSV   K  +   D++EI++KIG G+ + V K + K           K+ + I+     +   E+ IL +    + V+KL   +  +  I+M+    +  + +D  +    L    E+   + NLL A++++H  ++ HRD+   N L+   D       +VDFG A
Sbjct:  399 SVRSVPTAKT-NPFTDDYEILEKIGNGAHSVVHKCQMKATRR-------KYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFA 559          
BLAST of cdc7-like protein vs. Ensembl Fly
Match: CG5790 (gene:FBgn0032677 transcript:FBtr0345614)

HSP 1 Score: 194.512 bits (493), Expect = 7.533e-55
Identity = 142/470 (30.21%), Postives = 215/470 (45.74%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKK----IEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHS------------------------------DF------------GNEKIAIKSIDSQNNMKRQDTGTL------KSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL--------IGAFNDWIKSRCQFIRKNCEKITKLIK--DNSDKNCIYGNHAE----------FDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            E  +   +IN  F++  +IG G+F+ V     ++    +E  +  FA+K   P   P+RI  EL  + +IGG +NVI ++   R  D++  +MP++ H +F D Y  ++  EIRDYLRNLL+AL+HVH+  +IHRDVKP+N LY+RR  KF L DFGLA  +   D GS     D S                              D+            G+ + A+    S   ++ Q  G L        R     +L+    +  +    N + + +  +   H    R GT GYRPPEV +R+ +Q+TAVD WA G+IM   L+G +PFFK   D      +I       ++  A  + R I++  K   L            + ++    Q   +  +  T++ +  +    NC+  N             F   AYDLLS+LLE     RIT  EAL+H FF+
Sbjct:  133 ELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTGKFLLCDFGLA--QRIADDGSVVQSSDLSSREVFSILRDLENGRSVTLTDGNSAQAEAEDYMARRRMRALGGGGSVERAVTGPPSIQKLREQAGGHLTKKDVANQRADTMRLLNRLRLVSPNADPNNYVVSTNTSKKEMH--ASRAGTPGYRPPEVLLRYPKQSTAVDVWAAGVIMLSLLSGLHPFFKAPHDCGALAEIINLFGDMPVRKTAFLLDRLILLAQKVNTLDLRRVCMRFRHADFFLAPEIQRKYQRPDGTTEMCRSCEQPTFNCLCSNSGHNLERYDGLDIFPAVAYDLLSRLLEVNPQKRITAEEALKHPFFS 598          
BLAST of cdc7-like protein vs. Ensembl Fly
Match: CG5790 (gene:FBgn0032677 transcript:FBtr0081050)

HSP 1 Score: 194.512 bits (493), Expect = 7.533e-55
Identity = 142/470 (30.21%), Postives = 215/470 (45.74%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKK----IEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHS------------------------------DF------------GNEKIAIKSIDSQNNMKRQDTGTL------KSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL--------IGAFNDWIKSRCQFIRKNCEKITKLIK--DNSDKNCIYGNHAE----------FDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            E  +   +IN  F++  +IG G+F+ V     ++    +E  +  FA+K   P   P+RI  EL  + +IGG +NVI ++   R  D++  +MP++ H +F D Y  ++  EIRDYLRNLL+AL+HVH+  +IHRDVKP+N LY+RR  KF L DFGLA  +   D GS     D S                              D+            G+ + A+    S   ++ Q  G L        R     +L+    +  +    N + + +  +   H    R GT GYRPPEV +R+ +Q+TAVD WA G+IM   L+G +PFFK   D      +I       ++  A  + R I++  K   L            + ++    Q   +  +  T++ +  +    NC+  N             F   AYDLLS+LLE     RIT  EAL+H FF+
Sbjct:  133 ELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTGKFLLCDFGLA--QRIADDGSVVQSSDLSSREVFSILRDLENGRSVTLTDGNSAQAEAEDYMARRRMRALGGGGSVERAVTGPPSIQKLREQAGGHLTKKDVANQRADTMRLLNRLRLVSPNADPNNYVVSTNTSKKEMH--ASRAGTPGYRPPEVLLRYPKQSTAVDVWAAGVIMLSLLSGLHPFFKAPHDCGALAEIINLFGDMPVRKTAFLLDRLILLAQKVNTLDLRRVCMRFRHADFFLAPEIQRKYQRPDGTTEMCRSCEQPTFNCLCSNSGHNLERYDGLDIFPAVAYDLLSRLLEVNPQKRITAEEALKHPFFS 598          
BLAST of cdc7-like protein vs. Ensembl Fly
Match: Cdc7 (gene:FBgn0028360 transcript:FBtr0343377)

HSP 1 Score: 151.369 bits (381), Expect = 3.242e-39
Identity = 73/160 (45.62%), Postives = 104/160 (65.00%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVF----KVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            + + +  DI   F++  +IG G+F+ V     +  S   + L+  FA+K  IP   P RI  EL+ + K+GGK+NV+ +H   R       +MPF+ H +F D+Y  MD+ EIR Y+RNLLVAL+HVH+  +IHRDVKP+NFLY+RRR++F LVDFGLA 
Sbjct:  114 DLLTRIPDIGKLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIKHHIPTSHPDRIMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFMAHDRFQDFYTRMDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREFLLVDFGLAQ 273          

HSP 2 Score: 102.834 bits (255), Expect = 5.292e-23
Identity = 63/201 (31.34%), Postives = 93/201 (46.27%), Query Frame = 3
Query:  837 CICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL-----------IGAFNDW--------IKSRCQFIRKNCEK--ITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            C+C    + C  C  +      R GT GYRPPEV +++ +QTTAVD WA G+I    ++  YPFFK  +D      ++     + ++  A  + R I ++ +  PL              F+D         +   C+  R NC++     L +D+         +  F  SAYDLL +LLE   H RIT  EAL+H FF 
Sbjct:  445 CVCFANPSVCLNCLMKKEVHASRAGTPGYRPPEVLLKYPDQTTAVDVWAAGVIFLSIMSTVYPFFKAPNDFIALAEIVTIFGDQAIRKTALALDRMITLSQRSRPLNLRKLCLRFRYRSVFSDAKLLKSYESVDGSCEVCR-NCDQYFFNCLCEDSDYLTEPLDAYECFPPSAYDLLDRLLEINPHKRITAEEALKHPFFT 644          
BLAST of cdc7-like protein vs. Ensembl Fly
Match: Cdc7 (gene:FBgn0028360 transcript:FBtr0070950)

HSP 1 Score: 151.369 bits (381), Expect = 3.292e-39
Identity = 73/160 (45.62%), Postives = 104/160 (65.00%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVF----KVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            + + +  DI   F++  +IG G+F+ V     +  S   + L+  FA+K  IP   P RI  EL+ + K+GGK+NV+ +H   R       +MPF+ H +F D+Y  MD+ EIR Y+RNLLVAL+HVH+  +IHRDVKP+NFLY+RRR++F LVDFGLA 
Sbjct:  115 DLLTRIPDIGKLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIKHHIPTSHPDRIMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFMAHDRFQDFYTRMDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREFLLVDFGLAQ 274          

HSP 2 Score: 102.834 bits (255), Expect = 5.205e-23
Identity = 63/201 (31.34%), Postives = 93/201 (46.27%), Query Frame = 3
Query:  837 CICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL-----------IGAFNDW--------IKSRCQFIRKNCEK--ITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            C+C    + C  C  +      R GT GYRPPEV +++ +QTTAVD WA G+I    ++  YPFFK  +D      ++     + ++  A  + R I ++ +  PL              F+D         +   C+  R NC++     L +D+         +  F  SAYDLL +LLE   H RIT  EAL+H FF 
Sbjct:  446 CVCFANPSVCLNCLMKKEVHASRAGTPGYRPPEVLLKYPDQTTAVDVWAAGVIFLSIMSTVYPFFKAPNDFIALAEIVTIFGDQAIRKTALALDRMITLSQRSRPLNLRKLCLRFRYRSVFSDAKLLKSYESVDGSCEVCR-NCDQYFFNCLCEDSDYLTEPLDAYECFPPSAYDLLDRLLEINPHKRITAEEALKHPFFT 645          
BLAST of cdc7-like protein vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 80.1073 bits (196), Expect = 1.596e-15
Identity = 52/171 (30.41%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  183 EYVKQFSDIND--NFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGD 668
            E +K+  D  D   FE++  +GEGSF  VF VR    +    ++A+K     T+ + D  R  NE +IL  +G    +++LH+AF+    +++++ F+   D    +   ++    +++ YL  L +A+ H+H   II+RD+KP N L D       L DFGL+   + G 
Sbjct:  185 EVIKEGHDKADPSQFELLRVLGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTNERKILADVG-HAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLD-EHGHIALTDFGLSKQPLDGS 353          

HSP 2 Score: 52.373 bits (124), Expect = 7.002e-7
Identity = 27/103 (26.21%), Postives = 52/103 (50.49%), Query Frame = 3
Query:  357 ELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLL---MDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRK---KFTLVDFGLA 647
            E+ I+ + G   N++ L+  +      +++M  +   + +D  L    M  +E    LR +  A+ ++HE+ ++HRD+KP+N +Y   R+      L D G A
Sbjct:  618 EVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFA 720          
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 197.208 bits (500), Expect = 2.665e-57
Identity = 110/322 (34.16%), Postives = 174/322 (54.04%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTL--KSRLSDTSILSESNQIEASCICGNRLT--TCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVN 1136
            E + Q S I   F IIDKIGEG+F++V+   ++  +  + +FALK  IP   P RI  EL+ L   GG +NV+ + + FR + H+ ++MP+++H  F+D   L+   ++R Y+ +LL ALKH+H+  IIHRD+KP NFL++R+++++ LVDFGLA      D          S    E++  + I S  +        L  K +L   S   +   +     C   +T   C+ C +R      R GT G+R PEV  +   Q TA+D W+ G+I+   L+G+YPFFK +DDL     ++     ++   AAK   + I+ +
Sbjct:   37 EVLPQLSRI---FRIIDKIGEGTFSSVYLAEAQMTDSSRRLFALKHLIPTSHPVRIAAELQCLTVAGGTENVMGVTYCFRKEHHVVIVMPYMEHQTFVDIVGLLSFEDVRHYIYHLLKALKHIHKFGIIHRDIKPTNFLFNRQKREYALVDFGLAQGT--PDTQIELLKGLLSKPKKEEVIPRKIVSAKHRSVPVRAPLNQKQKLPAESQKPKPAAVNPLLTCNCYMTDRVCNICLSRKQQVAPRAGTPGFRAPEVLTKCPNQGTAIDMWSAGVILLSLLSGRYPFFKANDDLIALTQIMTIRGSKETIEAAKTFGKSIVCS 353          
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 195.667 bits (496), Expect = 1.654e-56
Identity = 116/358 (32.40%), Postives = 184/358 (51.40%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS------EVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMK--------------------------RQDTGTLKSRLSDTSILSESNQIEA--------SCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVN 1136
            E + Q S I   F IIDKIGEG+F++V+   ++  +  + +FALK  IP   P RI  EL+ L   GG +NV+ + + FR + H+ ++MP+++H  F+D   L+   ++R Y+ +LL ALKH+H+  IIHRD+KP NFL++R+++++ LVDFGLA        E+  +L    D    S FG      KSI+S N+ K                          +  +  +++ L+    L   +Q           +C C      C+ C +R      R GT G+R PEV  +   Q TA+D W+ G+I+   L+G+YPFFK +DDL     ++     ++   AAK   + I+ +
Sbjct:   37 EVLPQLSRI---FRIIDKIGEGTFSSVYLAEAQMTDSSRRLFALKHLIPTSHPVRIAAELQCLTVAGGTENVMGVTYCFRKEHHVVIVMPYMEHQTFVDIVGLLSFEDVRHYIYHLLKALKHIHKFGIIHRDIKPTNFLFNRQKREYALVDFGLAQGTPDTQIELLKELMG-LDKAPRSVFGE-----KSINSTNSHKPGSDKVEGLLSKPKKEEVIPRKIVSAKHRSVPVRAPLNQKQKLPAESQKPKPAAVNPLLTCNCYMTDRVCNICLSRKQQVAPRAGTPGFRAPEVLTKCPNQGTAIDMWSAGVILLSLLSGRYPFFKANDDLIALTQIMTIRGSKETIEAAKTFGKSIVCS 385          
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 147.902 bits (372), Expect = 1.497e-38
Identity = 73/190 (38.42%), Postives = 118/190 (62.11%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS--EVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQ 746
            E + Q S I   F IIDKIGEG+F++V+   ++  +  + +FALK  IP   P RI  EL+ L   GG +NV+ + + FR + H+ ++MP+++H  F+D   L+   ++R Y+ +LL ALKH+H+  IIHRD+KP NFL++R+++++ LVDFGLA    +   +L      + H   G+ K+  +S+  Q
Sbjct:   37 EVLPQLSRI---FRIIDKIGEGTFSSVYLAEAQMTDSSRRLFALKHLIPTSHPVRIAAELQCLTVAGGTENVMGVTYCFRKEHHVVIVMPYMEHQTFVDIVGLLSFEDVRHYIYHLLKALKHIHKFGIIHRDIKPTNFLFNRQKREYALVDFGLAQGTPDTQIELLKVVKSKGHKGGGSSKMVEESLGKQ 223          

HSP 2 Score: 73.559 bits (179), Expect = 1.917e-13
Identity = 34/101 (33.66%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  834 SCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVN 1136
            +C C      C+ C +R      R GT G+R PEV  +   Q TA+D W+ G+I+   L+G+YPFFK +DDL     ++     ++   AAK   + I+ +
Sbjct:  343 TCNCYMTDRVCNICLSRKQQVAPRAGTPGFRAPEVLTKCPNQGTAIDMWSAGVILLSLLSGRYPFFKANDDLIALTQIMTIRGSKETIEAAKTFGKSIVCS 443          
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Match: camk1gb (calcium/calmodulin-dependent protein kinase IGb [Source:ZFIN;Acc:ZDB-GENE-040426-1694])

HSP 1 Score: 78.5666 bits (192), Expect = 3.063e-15
Identity = 55/176 (31.25%), Postives = 93/176 (52.84%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKR---IENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID------YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHGDLGS 677
            E+ K   +I D F+ +D +G G+F+ VF V+ +K     ++FA+K        KR   +ENE+ +L+KI   +NV+ L   +  + H +++M  V   +  D       Y  MD + +   +R +L A+ ++H N I+HRD+KP N LY       K  + DFGL+  E +G + +
Sbjct:    9 EWKKSTDNIQDVFDFMDVLGSGAFSEVFMVKERKT---GKLFAMKCVKK--KNKRDINLENEIAVLRKIK-HENVVCLEDFYESRTHYYLVMQLVSGGELFDRILDRGMYSEMDASSV---IRQVLEAVSYLHNNGIVHRDLKPENLLYYSPDENSKIMISDFGLSKMEDNGVMST 175          
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Match: si:ch73-60h1.1 (si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-152])

HSP 1 Score: 78.1814 bits (191), Expect = 4.102e-15
Identity = 79/340 (23.24%), Postives = 137/340 (40.29%), Query Frame = 3
Query:  168 NIRSVEY----VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID------YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRR--KKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLI----YFLS--FEKMQAAAKDIQRRIIV 1133
            + R VEY     ++ + + D + +  ++G G+ + V +   K+ E   + +A+K     ID K +  E+ +L ++    N+I+L   F  +  IF+++  V   +  D      YY   D   +   ++ +L A+ ++HEN ++HRD+KP N LY          + DFGL+                           K ID Q  MK                           +CG                     T GY  PE+ +R       VD W+VG+I+ I L G  PFF    D  ++  ++     F+S  ++++   AKD+  ++IV
Sbjct:    7 DARPVEYWVDGSRRDATVEDFYNMGPELGRGATSVVLRCEEKQTE---KPYAVKVLKKTIDKKIVRTEIGVLLRLS-HPNIIRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHV---IKQILEAVAYLHENGVVHRDLKPENLLYADLSIDAPLKIADFGLS---------------------------KIIDEQVTMK--------------------------TVCG---------------------TPGYCAPEI-LRGNAYGPEVDMWSVGVILYILLCGFEPFFDQRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVNKLIV 264          
BLAST of cdc7-like protein vs. Ensembl Xenopus
Match: arid1a (AT-rich interaction domain 1A [Source:Xenbase;Acc:XB-GENE-492490])

HSP 1 Score: 189.119 bits (479), Expect = 6.059e-54
Identity = 136/463 (29.37%), Postives = 209/463 (45.14%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS--EVHGDL----------GSWFDDEDHSDFGNEKIAIKSIDSQNNM----------------KRQDTGTLKSRLSDTSILSESN---QIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFL-SFEKMQAA--------------AKDIQ------RRIIVNPK-------------PLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFD---DSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            V Q  +I   F I  KIGEG+F++V+    +        FALK  IP   P RI  EL+ L   GG+ NV+ + + FR KDH+ ++MP+++H  F D    + + E ++Y+ NLL AL+ +H   I+HRDVKP+NFLY+R  KKF LVDFGLA    +   DL          G +      S FG     + S  + +N                 K     T+ ++ + +S+  +++   Q   +C C  +   C+ C  R      R GT G+R PEV  +   QTTA+D W+ GII    L+G+Y FF   DD++    ++    S E +QA+              +KD++      R  ++ P               + ++   + W       I      +   +    + +    N   +D   + AY LL +LL+    TRIT  EAL H  F
Sbjct:   20 VPQLRNI---FYIKSKIGEGTFSSVYLAIGRLRSGEDVTFALKHLIPTSHPTRIAAELQCLSVAGGEDNVMGVKYCFRNKDHVVIVMPYLEHECFADILHSLSLEETKEYMFNLLKALRRIHSFGIVHRDVKPSNFLYNRSLKKFALVDFGLAQGTPDTKIDLLKVLQPKKQEGLFGSSAQRSVFGERNFNVHSAVTTDNTTLKAVKPSKMLDVTTRKLATRKTVSAKSTSSSVNKKASSICQTSLACDCYAKDQVCNICLARTRQVAPRAGTPGFRAPEVLTKCPHQTTAIDMWSAGIIFLSLLSGRYHFFNAADDMNALAQIMTIRGSKETIQASKCFGKNLLCSKELPSKDLKTLCEGLRSAVLLPNGDQHDIQKQRAALQMQIMENQDGWFSPESSNITHASSMVASCVSAPDNMDIEQSNLNGWDRVPNEAYHLLDRLLDMNPATRITAEEALIHPLF 479          
BLAST of cdc7-like protein vs. Ensembl Xenopus
Match: arid1a (AT-rich interaction domain 1A [Source:Xenbase;Acc:XB-GENE-492490])

HSP 1 Score: 181.8 bits (460), Expect = 5.862e-51
Identity = 137/488 (28.07%), Postives = 211/488 (43.24%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH---------------------SEVHGDL--GSWF--------------DDEDHSDFGNEKIAIKSIDSQNNM----------------KRQDTGTLKSRLSDTSILSESN---QIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFL-SFEKMQAA--------------AKDIQ------RRIIVNPK-------------PLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFD---DSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            V Q  +I   F I  KIGEG+F++V+    +        FALK  IP   P RI  EL+ L   GG+ NV+ + + FR KDH+ ++MP+++H  F D    + + E ++Y+ NLL AL+ +H   I+HRDVKP+NFLY+R  KKF LVDFGLA                      S+ H  +  G+W                    S FG     + S  + +N                 K     T+ ++ + +S+  +++   Q   +C C  +   C+ C  R      R GT G+R PEV  +   QTTA+D W+ GII    L+G+Y FF   DD++    ++    S E +QA+              +KD++      R  ++ P               + ++   + W       I      +   +    + +    N   +D   + AY LL +LL+    TRIT  EAL H  F
Sbjct:   18 VPQLRNI---FYIKSKIGEGTFSSVYLAIGRLRSGEDVTFALKHLIPTSHPTRIAAELQCLSVAGGEDNVMGVKYCFRNKDHVVIVMPYLEHECFADILHSLSLEETKEYMFNLLKALRRIHSFGIVHRDVKPSNFLYNRSLKKFALVDFGLAQGTPDTKIDLLKVLQPKKQGSCSQNHPYIISGNWVHQNIPVLRKEGLFGSSAQRSVFGERNFNVHSAVTTDNTTLKAVKPSKMLDVTTRKLATRKTVSAKSTSSSVNKKASSICQTSLACDCYAKDQVCNICLARTRQVAPRAGTPGFRAPEVLTKCPHQTTAIDMWSAGIIFLSLLSGRYHFFNAADDMNALAQIMTIRGSKETIQASKCFGKNLLCSKELPSKDLKTLCEGLRSAVLLPNGDQHDIQKQRAALQMQIMENQDGWFSPESSNITHASSMVASCVSAPDNMDIEQSNLNGWDRVPNEAYHLLDRLLDMNPATRITAEEALIHPLF 502          
BLAST of cdc7-like protein vs. Ensembl Xenopus
Match: arid1a (AT-rich interaction domain 1A [Source:Xenbase;Acc:XB-GENE-492490])

HSP 1 Score: 134.035 bits (336), Expect = 1.816e-33
Identity = 68/154 (44.16%), Postives = 95/154 (61.69%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            V Q  +I   F I  KIGEG+F++V+    +        FALK  IP   P RI  EL+ L   GG+ NV+ + + FR KDH+ ++MP+++H  F D    + + E ++Y+ NLL AL+ +H   I+HRDVKP+NFLY+R  KKF LVDFGLA 
Sbjct:   37 VPQLRNI---FYIKSKIGEGTFSSVYLAIGRLRSGEDVTFALKHLIPTSHPTRIAAELQCLSVAGGEDNVMGVKYCFRNKDHVVIVMPYLEHECFADILHSLSLEETKEYMFNLLKALRRIHSFGIVHRDVKPSNFLYNRSLKKFALVDFGLAQ 187          

HSP 2 Score: 74.7146 bits (182), Expect = 9.938e-14
Identity = 68/294 (23.13%), Postives = 113/294 (38.44%), Query Frame = 3
Query:  660 HGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNM----------------KRQDTGTLKSRLSDTSILSESN---QIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFL-SFEKMQAA--------------AKDIQ------RRIIVNPK-------------PLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFD---DSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            HG  G +      S FG     + S  + +N                 K     T+ ++ + +S+  +++   Q   +C C  +   C+ C  R      R GT G+R PEV  +   QTTA+D W+ GII    L+G+Y FF   DD++    ++    S E +QA+              +KD++      R  ++ P               + ++   + W       I      +   +    + +    N   +D   + AY LL +LL+    TRIT  EAL H  F
Sbjct:  256 HGQEGLFGSSAQRSVFGERNFNVHSAVTTDNTTLKVIKPSKMLDVTTRKLATRKTVSAKSTSSSVNKKASSICQTSLACDCYAKDQVCNICLARTRQVAPRAGTPGFRAPEVLTKCPHQTTAIDMWSAGIIFLSLLSGRYHFFNAADDMNALAQIMTIRGSKETIQASKCFGKNLLCSKELPSKDLKTLCEGLRSAVLLPNGDQHDIQKQRAALQMQIMENQDGWFSPESSNITHASSMVASCVSAPDNMDIEQSNLNGWDRVPNEAYHLLDRLLDMNPATRITAEEALIHPLF 549          
BLAST of cdc7-like protein vs. Ensembl Xenopus
Match: arid1a (AT-rich interaction domain 1A [Source:Xenbase;Acc:XB-GENE-492490])

HSP 1 Score: 134.035 bits (336), Expect = 2.119e-33
Identity = 68/154 (44.16%), Postives = 95/154 (61.69%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            V Q  +I   F I  KIGEG+F++V+    +        FALK  IP   P RI  EL+ L   GG+ NV+ + + FR KDH+ ++MP+++H  F D    + + E ++Y+ NLL AL+ +H   I+HRDVKP+NFLY+R  KKF LVDFGLA 
Sbjct:   46 VPQLRNI---FYIKSKIGEGTFSSVYLAIGRLRSGEDVTFALKHLIPTSHPTRIAAELQCLSVAGGEDNVMGVKYCFRNKDHVVIVMPYLEHECFADILHSLSLEETKEYMFNLLKALRRIHSFGIVHRDVKPSNFLYNRSLKKFALVDFGLAQ 196          

HSP 2 Score: 75.485 bits (184), Expect = 6.215e-14
Identity = 67/285 (23.51%), Postives = 111/285 (38.95%), Query Frame = 3
Query:  660 HGDLGSWFDDEDHSDFGNEKIAIKSIDSQ-------NNMKRQDTGTLKSRLSDTSILSESN---QIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFL-SFEKMQAA--------------AKDIQ------RRIIVNPK-------------PLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFD---DSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            HG  G +      S FG     + S   +          K     T+ ++ + +S+  +++   Q   +C C  +   C+ C  R      R GT G+R PEV  +   QTTA+D W+ GII    L+G+Y FF   DD++    ++    S E +QA+              +KD++      R  ++ P               + ++   + W       I      +   +    + +    N   +D   + AY LL +LL+    TRIT  EAL H  F
Sbjct:  265 HGQEGLFGSSAQRSVFGERNFNVHSAAVKPSKMLDVTTRKLATRKTVSAKSTSSSVNKKASSICQTSLACDCYAKDQVCNICLARTRQVAPRAGTPGFRAPEVLTKCPHQTTAIDMWSAGIIFLSLLSGRYHFFNAADDMNALAQIMTIRGSKETIQASKCFGKNLLCSKELPSKDLKTLCEGLRSAVLLPNGDQHDIQKQRAALQMQIMENQDGWFSPESSNITHASSMVASCVSAPDNMDIEQSNLNGWDRVPNEAYHLLDRLLDMNPATRITAEEALIHPLF 549          
BLAST of cdc7-like protein vs. Ensembl Xenopus
Match: arid1a (AT-rich interaction domain 1A [Source:Xenbase;Acc:XB-GENE-492490])

HSP 1 Score: 133.65 bits (335), Expect = 2.933e-33
Identity = 68/154 (44.16%), Postives = 95/154 (61.69%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            V Q  +I   F I  KIGEG+F++V+    +        FALK  IP   P RI  EL+ L   GG+ NV+ + + FR KDH+ ++MP+++H  F D    + + E ++Y+ NLL AL+ +H   I+HRDVKP+NFLY+R  KKF LVDFGLA 
Sbjct:   41 VPQLRNI---FYIKSKIGEGTFSSVYLAIGRLRSGEDVTFALKHLIPTSHPTRIAAELQCLSVAGGEDNVMGVKYCFRNKDHVVIVMPYLEHECFADILHSLSLEETKEYMFNLLKALRRIHSFGIVHRDVKPSNFLYNRSLKKFALVDFGLAQ 191          

HSP 2 Score: 75.0998 bits (183), Expect = 6.839e-14
Identity = 68/294 (23.13%), Postives = 113/294 (38.44%), Query Frame = 3
Query:  660 HGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNM----------------KRQDTGTLKSRLSDTSILSESN---QIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFL-SFEKMQAA--------------AKDIQ------RRIIVNPK-------------PLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFD---DSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            HG  G +      S FG     + S  + +N                 K     T+ ++ + +S+  +++   Q   +C C  +   C+ C  R      R GT G+R PEV  +   QTTA+D W+ GII    L+G+Y FF   DD++    ++    S E +QA+              +KD++      R  ++ P               + ++   + W       I      +   +    + +    N   +D   + AY LL +LL+    TRIT  EAL H  F
Sbjct:  260 HGQEGLFGSSAQRSVFGERNFNVHSAVTTDNTTLKVIKPSKMLDVTTRKLATRKTVSAKSTSSSVNKKASSICQTSLACDCYAKDQVCNICLARTRQVAPRAGTPGFRAPEVLTKCPHQTTAIDMWSAGIIFLSLLSGRYHFFNAADDMNALAQIMTIRGSKETIQASKCFGKNLLCSKELPSKDLKTLCEGLRSAVLLPNGDQHDIQKQRAALQMQIMENQDGWFSPESSNITHASSMVASCVSAPDNMDIEQSNLNGWDRVPNEAYHLLDRLLDMNPATRITAEEALIHPLF 553          
BLAST of cdc7-like protein vs. Ensembl Mouse
Match: Cdc7 (cell division cycle 7 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1309511])

HSP 1 Score: 200.29 bits (508), Expect = 1.011e-57
Identity = 130/422 (30.81%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS------EVHGDLGSWFDDED------HSDFGNEKI----AIKSIDSQ----NNMKRQDTGTLKSRLSDTSILSESNQIE--------------------------------ASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSA 1292
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA        E+   + S    ED      H   G++ +    A K++D Q     ++KR  T     +  D  ++ +S  ++                                 +C C      C  C +R      R GT G+R PEV  +  +QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + ++ + K +P             Q +R  CE++  L             +A +D +A
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTRDTKIELLKFVQSEAQQEDCSRNKYHGVVGHKGLLSRPAPKTVDQQCTPKTSVKRSYTQVHIKQGKDGKLIKQSKTVDIISRKLATKKTAISTKAMNSVMRETARSCPAVLTCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCS-KEVP------------AQDLRALCERLRGLDSTTPRSASGPPGNASYDPAA 448          
BLAST of cdc7-like protein vs. Ensembl Mouse
Match: Cdc7 (cell division cycle 7 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1309511])

HSP 1 Score: 183.341 bits (464), Expect = 1.640e-51
Identity = 127/422 (30.09%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS------EVHGDLGSWFDDED------HSDFGNEKI----AIKSIDSQ----NNMKRQDTGTLKSRLSDTSILSESNQIE--------------------------------ASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSA 1292
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA        E+   + S    ED      H   G++ +    A K++D Q     ++KR  T     +  D  ++ +S  ++                                 +C C      C  C +R      R GT G+R PEV  +  +QTT       G+I    L+G+YPF+K  DDL     ++      +   AAK   + ++ + K +P             Q +R  CE++  L             +A +D +A
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTRDTKIELLKFVQSEAQQEDCSRNKYHGVVGHKGLLSRPAPKTVDQQCTPKTSVKRSYTQVHIKQGKDGKLIKQSKTVDIISRKLATKKTAISTKAMNSVMRETARSCPAVLTCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTT-------GVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCS-KEVP------------AQDLRALCERLRGLDSTTPRSASGPPGNASYDPAA 441          
BLAST of cdc7-like protein vs. Ensembl Mouse
Match: Cdc7 (cell division cycle 7 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1309511])

HSP 1 Score: 145.976 bits (367), Expect = 1.273e-39
Identity = 72/157 (45.86%), Postives = 102/157 (64.97%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS 653
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA  
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQG 196          
BLAST of cdc7-like protein vs. Ensembl Mouse
Match: Cdc7 (cell division cycle 7 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1309511])

HSP 1 Score: 149.443 bits (376), Expect = 6.414e-39
Identity = 72/156 (46.15%), Postives = 102/156 (65.38%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA 
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQ 195          

HSP 2 Score: 76.2554 bits (186), Expect = 2.558e-14
Identity = 43/153 (28.10%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  834 SCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSA 1292
            +C C      C  C +R      R GT G+R PEV  +  +QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + ++ + K +P             Q +R  CE++  L             +A +D +A
Sbjct:  341 TCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCS-KEVP------------AQDLRALCERLRGLDSTTPRSASGPPGNASYDPAA 480          
BLAST of cdc7-like protein vs. Ensembl Mouse
Match: Cdc7 (cell division cycle 7 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1309511])

HSP 1 Score: 149.443 bits (376), Expect = 6.414e-39
Identity = 72/156 (46.15%), Postives = 102/156 (65.38%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA 
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQ 195          

HSP 2 Score: 76.2554 bits (186), Expect = 2.558e-14
Identity = 43/153 (28.10%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  834 SCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSA 1292
            +C C      C  C +R      R GT G+R PEV  +  +QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + ++ + K +P             Q +R  CE++  L             +A +D +A
Sbjct:  341 TCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCS-KEVP------------AQDLRALCERLRGLDSTTPRSASGPPGNASYDPAA 480          
BLAST of cdc7-like protein vs. UniProt/SwissProt
Match: sp|Q8SR83|CDC72_ENCCU (Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=CDC7-2 PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.533e-47
Identity = 119/396 (30.05%), Postives = 184/396 (46.46%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            ++  S +   +  I+KIGEGSF+ V+K    +        ALK       P R+ +E+  LK +GG+KN + L   FR +D +  + P+ + I F ++    ++ +I+ YL NLL+A++HVH N I+HRD+KP NFLY++   +  L+DFGLA  E        + +  H++ G                 +  G L   L   S++S++           +    +    RP  +  R GT G+R PEV  R   QT A+D W+VG+I    LT +YPFF   DD+D    +       +M+ AAK   R    N   +P         + R  F     E I + +             AE     YDLL ++L+    +RIT  +AL H FF+
Sbjct:   11 LRHISFVMPKYTPIEKIGEGSFSVVYKALDAES---GRYVALKAITRTSSPARVLDEMMFLKTLGGRKNCMGLLGCFRNEDQVVAVFPYFEPIDFREFISNANLADIKRYLHNLLIAIEHVHSNGIMHRDLKPGNFLYNKESGRGMLIDFGLAQYEE-------YSEGQHAEGGA----------------KPAGPL---LFFNSVVSKT-----------KPPGYYERDGRPPMKAPRAGTRGFRAPEVLFRCQRQTGAIDMWSVGVIFLTILTTQYPFFYSSDDIDSIVEIATIFGHAEMRKAAKFYGRVWRSNIDSIP---------EERIPF-----ETIVESLNP----------WAEVGSDGYDLLYRMLDLCSSSRITASDALSHPFFD 342          
BLAST of cdc7-like protein vs. UniProt/SwissProt
Match: sp|Q8SR85|CDC71_ENCCU (Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=CDC7-1 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 2.587e-47
Identity = 119/396 (30.05%), Postives = 184/396 (46.46%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            ++  S +   +  I+KIGEGSF+ V+K    +        ALK       P R+ +E+  LK +GG+KN + L   FR +D +  + P+ + I F ++    ++ +I+ YL NLL+A++HVH N I+HRD+KP NFLY++   +  L+DFGLA  E        + +  H++ G                 +  G L   L   S++S++           +    +    RP  +  R GT G+R PEV  R   QT A+D W+VG+I    LT +YPFF   DD+D    +       +M+ AAK   R    N   +P         + R  F     E I + +             AE     YDLL ++L+    +RIT  +AL H FF+
Sbjct:   11 LRHISFVMPKYTPIEKIGEGSFSVVYKALDAES---GRYVALKAITRTSSPARVLDEMMFLKTLGGRKNCMGLLGCFRNEDQVVAVFPYFEPIDFREFISNANLADIKRYLHNLLIAIEHVHSNGIMHRDLKPGNFLYNKESGRGMLIDFGLAQYEE-------YSEGQHAEGGA----------------KPAGPL---LFFNSVVSKT-----------KPPGYYERDGRPPMKAPRAGTRGFRAPEVLFRCQRQTGAIDMWSVGVIFLTILTTQYPFFYSSDDIDSIVEIATIFGHAEMRKAAKFYGRVWRSNIDSIP---------EERIPF-----ETIVESLNP----------WAEIGSDGYDLLYRMLDLCSSSRITASDALSHPFFD 342          
BLAST of cdc7-like protein vs. UniProt/SwissProt
Match: sp|Q9UQY9|SPO4_SCHPO (Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo4 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.520e-44
Identity = 116/421 (27.55%), Postives = 193/421 (45.84%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIF-----------------------ALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDS-QNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDS-AYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            V+ F  I +++ ++  +G GSF++VFK   +  +     +                       ALK     + P RI+ EL +L ++ G   V+ +  A R +D + +++PF+ H +F D+Y+   + EI  YLR+LL  L H+    IIHRD+KP NF ++   ++  ++DFGLA          W      +D   E   +  +   +   K  D    +  ++D          E   +             RP  +  R GT G+R PEV  R   QT+++D W+VG+I+  FLT +YPFF+ +DD+D    L +      M   A  +  +I  +  P  L+   ++W+           + I  + K+  D+N I    +++  + A DLL KLLE     R+  + ALQH+FFN
Sbjct:   30 VQAFPTIEEDYHVVKLVGAGSFSSVFKAVDRHFDSYDNSYWISSQIEDQMPHDKTKRPKNHFVALKRIYATVLPSRIQTELEMLHELRGSDCVLNMITAVRHQDQVLIVLPFIQHAEFRDFYMKYSLPEIGAYLRDLLKGLAHIDAKGIIHRDIKPGNFAWNPYTQRGVILDFGLAQ---------W----QEADAPTENCCVDKLRKLKQEGKYYDYFPFEKTIADPP--------EGYLLHD----------PRPTKRADRAGTRGFRAPEVLFRCQNQTSSIDVWSVGVILLCFLTHRYPFFRCEDDIDAIVELAHIFGRNGMSNCAL-LHGQIWSDNIPT-LLDQKHNWL-----------DLIASITKN--DENLILETSSDYQVALAIDLLDKLLELHPSKRVKAKTALQHEFFN 404          
BLAST of cdc7-like protein vs. UniProt/SwissProt
Match: sp|Q9Z0H0|CDC7_MOUSE (Cell division cycle 7-related protein kinase OS=Mus musculus OX=10090 GN=Cdc7 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 4.486e-38
Identity = 72/156 (46.15%), Postives = 102/156 (65.38%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAH 650
            E V Q  ++   F+I DKIGEG+F++V+   ++  E  +E  ALK  IP   P RI  EL+ L   GG+ NV+ L + FR  DH+ + MP+++H  F+D    +   E+R+Y+ NL VALK +H+  I+HRDVKP+NFLY+RR KK+ LVDFGLA 
Sbjct:   43 EAVPQLVNV---FKIKDKIGEGTFSSVYLATAQLQEGHEEKIALKHLIPTSHPMRIAAELQCLTVAGGQDNVMGLKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMYNLFVALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQ 195          

HSP 2 Score: 76.2554 bits (186), Expect = 1.789e-13
Identity = 43/153 (28.10%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  834 SCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSA 1292
            +C C      C  C +R      R GT G+R PEV  +  +QTTA+D W+ G+I    L+G+YPF+K  DDL     ++      +   AAK   + ++ + K +P             Q +R  CE++  L             +A +D +A
Sbjct:  341 TCDCYGSDRVCSVCLSRRQQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKAFGKSVLCS-KEVP------------AQDLRALCERLRGLDSTTPRSASGPPGNASYDPAA 480          
BLAST of cdc7-like protein vs. UniProt/SwissProt
Match: sp|P06243|CDC7_YEAST (Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC7 PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 1.676e-36
Identity = 96/319 (30.09%), Postives = 159/319 (49.84%), Query Frame = 3
Query:  207 INDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEI-----------FALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDE-DHSDFGNEK-IAIKSIDSQNN-----MKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHG-CRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAA 1106
            I + +++IDKIGEG+F++V+K +    ++ K+             ALK       P+RI NEL +L  + G   V  L  A RV+D +  ++P+  H +F  +Y  + I  I+ Y+  LL ALK VH   IIHRD+KP NFL++    +  LVDFGLA +++  D  S    + D+ ++ N       S+ +        M+ Q +    ++      +     +  + + G  LT  +    TR   +  R GT G+R PEV M+   Q+T +D W+VG+I+   L  ++P F+  DD D    L     +++++  A
Sbjct:   29 IENEYKLIDKIGEGTFSSVYKAKDITGKITKKFASHFWNYGSNYVALKKIYVTSSPQRIYNELNLLYIMTGSSRVAPLCDAKRVRDQVIAVLPYYPHEEFRTFYRDLPIKGIKKYIWELLRALKFVHSKGIIHRDIKPTNFLFNLELGRGVLVDFGLAEAQM--DYKSMISSQNDYDNYANTNHDGGYSMRNHEQFCPCIMRNQYSPNSHNQTPPMVTIQNGKVVHLNNVNGVDLTKGYPKNETRRIKRANRAGTRGFRAPEVLMKCGAQSTKIDIWSVGVILLSLLGRRFPMFQSLDDADSLLELCTIFGWKELRKCA 345          
BLAST of cdc7-like protein vs. TrEMBL
Match: D2DJV6 (Cdc7-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 4.552e-160
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 3
Query:  630 VDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEF 1280
            VDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEF
Sbjct:    1 VDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEF 217          
BLAST of cdc7-like protein vs. TrEMBL
Match: G4VG92 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_177120 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 3.027e-122
Identity = 194/432 (44.91%), Postives = 269/432 (62.27%), Query Frame = 3
Query:  171 IRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSE----------VHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPH-PQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFND--WIKSRC---------QFIRKNCEKITKLIKDNSDKNCIYGNHAE---------FDDSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            +RS++Y+ +F  I D F + ++ G+G+FA+V  VRSK+     + +ALK  IP +D +RIENE+RIL+++GGK NVI++H A R++DH+F+LMPF+D+I F +YYL  D  EIR Y+R LL AL HVH+ K+IHRDVKP NFL D++ K+F LVDFGLAHSE          V     S+    D  D  +   A K     +N       ++KS  + ++ L++S   +  C+CG+RLT C GCR  P  P VRRGGT+G+RPPEV MRH EQTTAVD WAVGII   FL+G+YPF KV+DDLDV H+  + + +E+MQ  A+ I RR++++P+P P+  + +   W+K R            +RK   K T L  DNS +     N            F  SAYDLL++LLEP    RIT ++AL H +F
Sbjct:    6 VRSLQYIFEFPQITDLFNVSERQGQGTFASVLAVRSKQDPDESKYYALKMIIPTVDVRRIENEIRILRRLGGKHNVIQMHTAMRIRDHVFILMPFIDYIPFTEYYLTADEKEIRRYMRALLSALAHVHKYKVIHRDVKPTNFLMDQKTKQFFLVDFGLAHSEDISENNQRVNVTNRENSYTHKRDCVDSTSTLFAYKCNSKIDNKSSFKGASVKSSQTISNNLTQSLG-QGGCVCGSRLTVCRGCRHLPRAPTVRRGGTLGFRPPEVMMRHIEQTTAVDIWAVGIIFISFLSGRYPFIKVEDDLDVLHAFTHLIGYERMQMGARSIGRRLLLDPRPPPMEASDSPVMWLKIRLYEKKFAGLPPLLRKTSTKSTNLTNDNSIQTTELSNGKPMIALSSTHIFPTSAYDLLARLLEPCPQKRITAQDALHHPYF 436          
BLAST of cdc7-like protein vs. TrEMBL
Match: A0A3Q0KTJ7 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 8.354e-121
Identity = 202/474 (42.62%), Postives = 279/474 (58.86%), Query Frame = 3
Query:  171 IRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGS-W---FDDEDHSDF---------------------GNEKIAIKSIDSQNNMKR---QDTGTL-----------KSRLSDTSILSE---SNQI-----EASCICGNRLTTCHGCRTRPH-PQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFND--WIKSRCQ--------------FIRKNCEKITKLIKDNSDKNCIYGNHAE---------FDDSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            +RS++Y+ +F  I D F + ++ G+G+FA+V  VRSK+     + +ALK  IP +D +RIENE+RIL+++GGK NVI++H A R++DH+F+LMPF+D+I F +YYL  D  EIR Y+R LL AL HVH+ K+IHRDVKP NFL D++ K+F LVDFGLAHSE  GD+   W   F+ +  SD                       N+++ + + ++    KR     T TL           KS     S+ S    SN +     +  C+CG+RLT C GCR  P  P VRRGGT+G+RPPEV MRH EQTTAVD WAVGII   FL+G+YPF KV+DDLDV H+  + + +E+MQ  A+ I RR++++P+P P+  + +   W+K RC                +RK   K T L  DNS +     N            F  SAYDLL++LLEP    RIT ++AL H +F
Sbjct:    6 VRSLQYIFEFPQITDLFNVSERQGQGTFASVLAVRSKQDPDESKYYALKMIIPTVDVRRIENEIRILRRLGGKHNVIQMHTAMRIRDHVFILMPFIDYIPFTEYYLTADEKEIRRYMRALLSALAHVHKYKVIHRDVKPTNFLMDQKTKQFFLVDFGLAHSEEFGDIDERWERKFEIKSDSDTKKNELMKRISSFPRTNPSISENNQRVNVTNRENSYTHKRDCVDSTSTLFAYKCNSKIDNKSSFKGASVKSSQTISNNLTQSLGQGGCVCGSRLTVCRGCRHLPRAPTVRRGGTLGFRPPEVMMRHIEQTTAVDIWAVGIIFISFLSGRYPFIKVEDDLDVLHAFTHLIGYERMQMGARSIGRRLLLDPRPPPMEASDSPVMWLKIRCSAIRLYEKKFAGLPPLLRKTSTKSTNLTNDNSIQTTELSNGKPMIALSSTHIFPTSAYDLLARLLEPCPQKRITAQDALHHPYF 479          
BLAST of cdc7-like protein vs. TrEMBL
Match: A0A2H1CIK5 (Kinase domain protein OS=Fasciola hepatica OX=6192 GN=D915_06234 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.533e-120
Identity = 202/476 (42.44%), Postives = 276/476 (57.98%), Query Frame = 3
Query:  171 IRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGS-WFDDED-------HSDFGNEKIAIKSIDSQNN------------------MKRQDTGTLKSRLSDTSILSES-----------------------NQIEASCICGNRLTTCHGCRTRPH-PQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFND--WIKSRCQFIRKNCEKITKLI------KDNSDKN----------------CIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            +R+V Y++ F +IND F I+DK G+G+FA+VF V+ K     K ++ALK  IP +D +RIENELRIL+++GGK N++K+H A RV+DH+F+LMPF++   F +YYL  D NEI  Y+R+LL AL +VH  +IIHRDVKP NFL D   K+F LVDFGLAHSE +GD+   W  D D       H+     K  +    +++N                  +  ++T T  S  + +S+   +                         I  +C+CG R+T C GCR  P     RRGGT+G+RPPEV MRH EQTTAVD WAVG+I+  FL+G+YPF KVDDDLDV H+  + + +E+MQA AK + RR++V+PKP P+  A     W+K RC  IRK  +K   L       K  SDKN                 +  +H  F  SAYDL++KLLEP  + R++  EAL+H F N
Sbjct:    6 VRNVSYLRTFPEINDAFTIVDKRGQGTFASVFAVKDKNKPDSKRVYALKMLIPTVDVRRIENELRILRRLGGKCNIVKMHTALRVRDHVFILMPFINFTPFSEYYLSADENEIVRYIRSLLFALSYVHRYRIIHRDVKPTNFLMDSTTKRFYLVDFGLAHSENYGDVDERWELDCDVYEENLKHAHSRKSKRPLSPSSNKDNHQNKTPRLADDLRPSLAVLNSENTPTFPSPDASSSMRIPAATVPHKVVGRATVNHTPSSTVAHTAIPGACVCGFRMTICRGCRQLPRITAARRGGTLGFRPPEVMMRHVEQTTAVDVWAVGVILLSFLSGRYPFIKVDDDLDVLHAFTHLIGYERMQACAKALGRRLLVDPKPPPMEAAETPATWLKLRCVAIRKQEKKFAGLPPLLSNEKKVSDKNGVSTGLTTIESKKNVIALPASHV-FPLSAYDLMAKLLEPSPNKRVSAYEALRHPFLN 480          
BLAST of cdc7-like protein vs. TrEMBL
Match: A0A4E0RF94 (Cell division cycle 7 protein kinase OS=Fasciola hepatica OX=6192 GN=D915_004111 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 5.278e-120
Identity = 202/476 (42.44%), Postives = 276/476 (57.98%), Query Frame = 3
Query:  171 IRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGS-WFDDED-------HSDFGNEKIAIKSIDSQNN------------------MKRQDTGTLKSRLSDTSILSES-----------------------NQIEASCICGNRLTTCHGCRTRPH-PQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFND--WIKSRCQFIRKNCEKITKLI------KDNSDKN----------------CIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            +R+V Y++ F +IND F I+DK G+G+FA+VF V+ K     K ++ALK  IP +D +RIENELRIL+++GGK N++K+H A RV+DH+F+LMPF++   F +YYL  D NEI  Y+R+LL AL +VH  +IIHRDVKP NFL D   K+F LVDFGLAHSE +GD+   W  D D       H+     K  +    +++N                  +  ++T T  S  + +S+   +                         I  +C+CG R+T C GCR  P     RRGGT+G+RPPEV MRH EQTTAVD WAVG+I+  FL+G+YPF KVDDDLDV H+  + + +E+MQA AK + RR++V+PKP P+  A     W+K RC  IRK  +K   L       K  SDKN                 +  +H  F  SAYDL++KLLEP  + R++  EAL+H F N
Sbjct:   33 VRNVSYLRTFPEINDAFTIVDKRGQGTFASVFAVKDKNKPDSKRVYALKMLIPTVDVRRIENELRILRRLGGKCNIVKMHTALRVRDHVFILMPFINFTPFSEYYLSADENEIVRYIRSLLFALSYVHRYRIIHRDVKPTNFLMDSTTKRFYLVDFGLAHSENYGDVDERWELDCDVYEENLKHAHSRKSKRPLSPSSNKDNHQNKTPRLADDLRPSLAVLNSENTPTFPSPDASSSMRIPAATVPHKVVGRATVNHTPSSTVAHTAIPGACVCGFRMTICRGCRQLPRITAARRGGTLGFRPPEVMMRHVEQTTAVDVWAVGVILLSFLSGRYPFIKVDDDLDVLHAFTHLIGYERMQACAKALGRRLLVDPKPPPMEAAETPATWLKLRCVAIRKQEKKFAGLPPLLSNEKKVSDKNGVSTGLTTIESKKNVIALPASHV-FPLSAYDLMAKLLEPSPNKRVSAYEALRHPFLN 507          
BLAST of cdc7-like protein vs. Ensembl Cavefish
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 204.142 bits (518), Expect = 2.480e-60
Identity = 115/326 (35.28%), Postives = 175/326 (53.68%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLT--TCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL 1154
            E V Q S +   F I DKIGEG+F++V+   ++  +  +E FALK  IP   P RI  EL+ L   GGK+NV+ + + FR + H+ ++MP+V+H  F++    +   E++ Y+ +LL ALKH+HE  IIHRD+KP NFLY+RR K++ LVDFGLA       +              E +A +   S    KR+    L +R S T    +   +  +  C   +T   C+ C +R      R GT G+R PEV  +   Q TA+D W+ G+I+   L+G+YPFFK  DDL     ++     ++   AA+   + I+ + +  PL
Sbjct:   24 EVVPQLSRV---FRITDKIGEGTFSSVYLGEAQMTDGRREKFALKHLIPTSHPVRIAAELQCLTVAGGKENVMGVTYCFRKEHHVVIVMPYVEHQPFVEIVGTLSFEEVQHYIYHLLKALKHIHEFGIIHRDIKPTNFLYNRREKQYALVDFGLAQGTPDTQI-ELLKAPLLKPTKTEDVAARRFVS---TKRRP---LPARSSTTGQKPKPTSLNPALTCSCYMTDHICNICLSRKQQVAPRAGTPGFRAPEVLTKCPNQGTAIDIWSAGVILLSLLSGRYPFFKASDDLLALTQIMTIRGSKETAQAARKFGKAIVCSRELPPL 339          
BLAST of cdc7-like protein vs. Ensembl Cavefish
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 149.058 bits (375), Expect = 5.999e-39
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS 653
            E V Q S +   F I DKIGEG+F++V+   ++  +  +E FALK  IP   P RI  EL+ L   GGK+NV+ + + FR + H+ ++MP+V+H  F++    +   E++ Y+ +LL ALKH+HE  IIHRD+KP NFLY+RR K++ LVDFGLA  
Sbjct:   71 EVVPQLSRV---FRITDKIGEGTFSSVYLGEAQMTDGRREKFALKHLIPTSHPVRIAAELQCLTVAGGKENVMGVTYCFRKEHHVVIVMPYVEHQPFVEIVGTLSFEEVQHYIYHLLKALKHIHEFGIIHRDIKPTNFLYNRREKQYALVDFGLAQG 224          

HSP 2 Score: 74.3294 bits (181), Expect = 8.707e-14
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  777 LKSRLSDTSILSESNQIEASCICGNRLT--TCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPL 1154
            L +R S T    +   +  +  C   +T   C+ C +R      R GT G+R PEV  +   Q TA+D W+ G+I+   L+G+YPFFK  DDL     ++     ++   AA+   + I+ + +  PL
Sbjct:  346 LPARSSTTGQKPKPTSLNPALTCSCYMTDHICNICLSRKQQVAPRAGTPGFRAPEVLTKCPNQGTAIDIWSAGVILLSLLSGRYPFFKASDDLLALTQIMTIRGSKETAQAARKFGKAIVCSRELPPL 473          
BLAST of cdc7-like protein vs. Ensembl Cavefish
Match: camk1ga (calcium/calmodulin-dependent protein kinase IGa [Source:ZFIN;Acc:ZDB-GENE-030131-7594])

HSP 1 Score: 78.5666 bits (192), Expect = 2.446e-15
Identity = 52/166 (31.33%), Postives = 87/166 (52.41%), Query Frame = 3
Query:  186 YVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALK-FTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRD---YLRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHG 665
            + K  ++I D FE  + +G GSF+ VF VR +K       +ALK      +D   +ENE+ +LK+I    NV+ L   +  + H +++M  V   +  D  L   +   +D    +R +L A+ ++H+N ++HRD+KP N L+     + K  + DFGL+    HG
Sbjct:   10 WKKVTNNIKDVFEFREILGSGSFSEVFLVRERKT---GNFYALKCVKKKQLDHSNLENEITVLKRIK-HNNVVSLEDFYETRTHYYLVMELVSGGELFDRILDRGVYTEKDASLVIRQVLEAVTYLHQNSVVHRDLKPENLLFYNQDEKAKIMISDFGLSKMVDHG 171          
BLAST of cdc7-like protein vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 76.2554 bits (186), Expect = 1.432e-14
Identity = 49/170 (28.82%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDY---LRNLLVALKHVHENKIIHRDVKPNNFLYDRR--RKKFTLVDFGLAHSEVHGDLGS 677
            ++ K   +I + F+ I+ +G G+ + VFKV+ K      + FA+K  I       +ENE+ +LK+I    N++ L   +  + H +++M  V   +  D  L   +   +D    +R +L  + ++H+N I+HRD+KP N LY  +    K  + DFGL+  E +G + +
Sbjct:   27 DWKKTVENIREIFDFIEVLGSGASSEVFKVKEKST---GKFFAMKCVIKKNRNTTLENEIAVLKRIK-HNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYSQDDNSKIMISDFGLSKIEDNGIMST 192          
BLAST of cdc7-like protein vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 75.485 bits (184), Expect = 2.450e-14
Identity = 48/163 (29.45%), Postives = 84/163 (51.53%), Query Frame = 3
Query:  183 EYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDY---LRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSE 656
            ++ K   +I + F+ I+ +G G+ + VFKV+ K      + FA+K  I       +ENE+ +LK+I    N++ L   +  + H +++M  V   +  D  L   +   +D    +R +L  + ++H+N I+HRD+KP N LY       K  + DFGL+  E
Sbjct:   27 DWKKTVENIREIFDFIEVLGSGASSEVFKVKEKST---GKFFAMKCVIKKNRNTTLENEIAVLKRIK-HNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYSQDENSKIMISDFGLSKME 185          
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Match: cdc7 (cell division cycle 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041114-113])

HSP 1 Score: 140.584 bits (353), Expect = 1.042e-36
Identity = 68/150 (45.33%), Postives = 104/150 (69.33%), Query Frame = 3
Query:  216 NFEIIDKIGEGSFAAVF----KVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS 653
            NF II KIGEG+F++V+    KVR    E  +E+ A+K+ IP   P RI  E++ L + GG  NV+++    R KDH+ ++MP+++H  F +   +M++ E+R+Y+RNLLV+L  +H+  IIHRDVKP+NFLY R+++++ LVDFGLA  
Sbjct:   22 NFNIIRKIGEGTFSSVYMAKGKVRRSGGE--EEMLAVKYLIPTSHPLRIAAEVQCLMEAGGVDNVMEVLQCLRNKDHVVIIMPYLEHEVFSEVVSVMNVMEVREYMRNLLVSLLRIHKLGIIHRDVKPSNFLYCRKQQRYALVDFGLAQG 169          

HSP 2 Score: 75.0998 bits (183), Expect = 9.760e-15
Identity = 36/99 (36.36%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  774 TLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLI 1070
            T K  ++  + +      E +C C      C  C  R      R GT G+R PEV ++   QTTA+D W+ GII    L+G+YPFFK  DDL     +I
Sbjct:  304 TAKKAVAPPNAMPRCALQEKTCSCFGYDQVCKLCLARSPQPSPRAGTPGFRAPEVLLKWPYQTTAIDIWSTGIIFLCLLSGRYPFFKTSDDLTALAQII 402          
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 9.845e-12
Identity = 48/170 (28.24%), Postives = 87/170 (51.18%), Query Frame = 3
Query:  210 NDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV------DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRK--KFTLVDFGLAHSEVHGDLGSWF 683
             D +++ +++G+G+F+ V   R  K+   +E FA K      +   D +++E E RI + +    N+++LH +   +   +++   V      + I   +YY   D +     ++ +L ++ H H++ I+HRD+KP N L   + K     L DFGLA  EV GD  +WF
Sbjct:   11 TDEYQLYEELGKGAFSVVR--RCVKVSTGQE-FAAKIINTKKLSARDHQKLEREARICRLLK-HSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHC---IQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLA-IEVQGDQQAWF 172          
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Match: mast2 (microtubule associated serine/threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050309-150])

HSP 1 Score: 64.3142 bits (155), Expect = 3.884e-11
Identity = 81/352 (23.01%), Postives = 141/352 (40.06%), Query Frame = 3
Query:  174 RSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALK--FTIPIIDPKRIENEL--RILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIY--FLSFEKMQAAAKDIQRRI--IVNPKPLPLIGAFNDWIKSRCQF 1196
            R+ E + +     ++FE I  I  G++ AV+ VR K+    ++ FA+K      +I   +I+     R +        V+ +  +F  K H+ M+M +V   D    +     + ++  + Y    ++AL+++H   I+HRD+KP+N L              + H ++             +DFG  KI + S              L + L +  I  ++ +     +C                     GT  Y  PEV +R       VD WA+G+I+  FL G  PFF  D   ++F  +I    +  E   A   D+Q  I  ++   PL  +G    +   + QF
Sbjct:  199 RAAESLPKKKPCEEDFETIKLISNGAYGAVYLVRHKET---RQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVGMFCSFETKRHLCMVMEYVEGGDCATLLKNLGALPVDMAQLYFAETVLALEYLHNYGIVHRDLKPDNLLIT-----------SMGHVKL-------------TDFGLSKIGLMS--------------LTTNLYEEHIEKDTREFLDKQVC---------------------GTPEYIAPEVILRQG-YGKPVDWWAMGVILYEFLVGCVPFFG-DTPEELFGQVISDEIVWPEGEDALPSDVQDLITGLLERNPLERLGTGGAFEVKQHQF 486          
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008013.1 (pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 gene:ENSPMAG00000007231.1 transcript:ENSPMAT00000008013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 5.104e-11
Identity = 40/153 (26.14%), Postives = 81/153 (52.94%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL-----LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSE 656
            + +  +DK+GEG++A V+K RSK  + L  +  ++       P     E+ +LK +    N++ LH        + ++  +++  K +  Y+     +M ++ ++ +L  LL  L + H+ +++HRD+KP N L +  + +  L DFGLA ++
Sbjct:  196 ETYTKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLK-HANIVTLHDIVHTDKSLTLVFEYLE--KDLKQYMDDCGNIMSMHNVKIFLLQLLRGLAYCHKRRVLHRDLKPQNLLIN-DKGELKLADFGLARAK 344          
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 61.2326 bits (147), Expect = 9.257e-11
Identity = 45/155 (29.03%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDH--IKFIDYYLL--MDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS 653
            DNF+ ++KIGEG++  V+K R+K   +  E  ALK     T     P     E+ +L+++    N+++L      +  ++++   +D    KF+D      + +  ++ YL  LL  +   H ++I+HRD+KP N L +       L DFGLA +
Sbjct:    2 DNFQKVEKIGEGTYGVVYKARNK---LTGEAVALKKIRLDTETEGVPSTAIREISLLRELN-HPNIVRLLTIIHSEKKLYLVFELLDQDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLIN-AEGAIKLADFGLARA 151          
BLAST of cdc7-like protein vs. Ensembl Yeast
Match: CDC7 (DDK (Dbf4-dependent kinase) catalytic subunit; required for origin firing and replication fork progression in mitotic S phase through phosphorylation of Mcm2-7p complexes and Cdc45p; kinase activity correlates with cyclical DBF4 expression; required for pre-meiotic DNA replication, meiotic DSB formation, recruitment of monopolin complex to kinetochores during meiosis I, regulation of meiosis-specific Ndt80p; mutation complemented by human CDC7 and DBF4 co-expression [Source:SGD;Acc:S000002175])

HSP 1 Score: 144.05 bits (362), Expect = 2.414e-38
Identity = 96/319 (30.09%), Postives = 159/319 (49.84%), Query Frame = 3
Query:  207 INDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEI-----------FALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDE-DHSDFGNEK-IAIKSIDSQNN-----MKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHG-CRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAA 1106
            I + +++IDKIGEG+F++V+K +    ++ K+             ALK       P+RI NEL +L  + G   V  L  A RV+D +  ++P+  H +F  +Y  + I  I+ Y+  LL ALK VH   IIHRD+KP NFL++    +  LVDFGLA +++  D  S    + D+ ++ N       S+ +        M+ Q +    ++      +     +  + + G  LT  +    TR   +  R GT G+R PEV M+   Q+T +D W+VG+I+   L  ++P F+  DD D    L     +++++  A
Sbjct:   29 IENEYKLIDKIGEGTFSSVYKAKDITGKITKKFASHFWNYGSNYVALKKIYVTSSPQRIYNELNLLYIMTGSSRVAPLCDAKRVRDQVIAVLPYYPHEEFRTFYRDLPIKGIKKYIWELLRALKFVHSKGIIHRDIKPTNFLFNLELGRGVLVDFGLAEAQM--DYKSMISSQNDYDNYANTNHDGGYSMRNHEQFCPCIMRNQYSPNSHNQTPPMVTIQNGKVVHLNNVNGVDLTKGYPKNETRRIKRANRAGTRGFRAPEVLMKCGAQSTKIDIWSVGVILLSLLGRRFPMFQSLDDADSLLELCTIFGWKELRKCA 345          
BLAST of cdc7-like protein vs. Ensembl Yeast
Match: CKA2 (Alpha' catalytic subunit of casein kinase 2 (CK2); CK2 is a Ser/Thr protein kinase with roles in cell growth and proliferation; CK2, comprised of CKA1, CKA2, CKB1 and CKB2, has many substrates including transcription factors and all RNA polymerases; protein abundance increases in response to DNA replication stress; regulates Fkh1p-mediated donor preference during mating-type switching [Source:SGD;Acc:S000005587])

HSP 1 Score: 77.411 bits (189), Expect = 3.750e-16
Identity = 52/150 (34.67%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  216 NFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDP---KRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDY---YLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLA 647
            N+EII+KIG G ++ VF  R         +   K  I ++ P   K+I  EL+IL  + G  NV+ L+   +  D     + F + IK +D+   Y    + +I+ Y   LL+AL + H   I+HRDVKP N + D   +K  L+D+GLA
Sbjct:   49 NYEIINKIGRGKYSEVFSGRCI-------VNNQKCVIKVLKPVKMKKIYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIF-EEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLA 190          
BLAST of cdc7-like protein vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 65.4698 bits (158), Expect = 2.823e-12
Identity = 41/156 (26.28%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  210 NDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDH--IKFIDYYLL------MDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHS 653
            +  F+ ++K+G G++A V+K  +K   +   +  +K       P     E+ ++K++   +N+++L+     ++ + ++  F+D+   K++D   +      +++N ++ +   LL  L   HENKI+HRD+KP N L + +R +  L DFGLA +
Sbjct:    4 SSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELK-HENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLIN-KRGQLKLGDFGLARA 157          
BLAST of cdc7-like protein vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 66.6254 bits (161), Expect = 3.495e-12
Identity = 81/328 (24.70%), Postives = 131/328 (39.94%), Query Frame = 3
Query:  216 NFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPK---------RIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLL---MDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVF--------HSLIYFLSFEKMQAAAKDIQRRIIVNP 1139
            N++I+  +GEGSF    KV+        +  ALK    II+ K         RIE E+  L+ +    ++IKL+   + KD I M++ +  + +  DY +    M   E R + + ++ A+++ H +KI+HRD+KP N L D       + DFGL++                                                   I+++ N ++ SC          G      P+V  G    Y  PE           VD W+ G+I+ + L  + PF   D+ + V         ++L  FLS      AA  I+R +IVNP
Sbjct:   54 NYQIVKTLGEGSFG---KVKLAYHTTTGQKVALK----IINKKVLAKSDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKDEIIMVIEYAGN-ELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHL-NVKIADFGLSN---------------------------------------------------IMTDGNFLKTSC----------GSPNYAAPEVISGKL--YAGPE-----------VDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTLPKFLS----PGAAGLIKRMLIVNP 291          
BLAST of cdc7-like protein vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 63.1586 bits (152), Expect = 4.510e-11
Identity = 42/149 (28.19%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  216 NFEIIDKIGEGSFAAVF--KVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKF---IDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLA 647
            +F+  +++G+GS+++V     R    +   ++ + ++ I     K +  E   L+K+ G K + KL F F+ +  ++ L+ +  H  F   I  Y  ++    R Y   ++ A+  +H   IIHRD+KP N L D+   K  L DFG A
Sbjct:  124 DFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNM-KVKLTDFGTA 271          
BLAST of cdc7-like protein vs. Ensembl Nematostella
Match: EDO33825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR42])

HSP 1 Score: 209.149 bits (531), Expect = 8.684e-61
Identity = 131/387 (33.85%), Postives = 199/387 (51.42%), Query Frame = 3
Query:  168 NIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKK------FTLVDFGLAHSEVHGDLGSWFD------------------DEDHSDFG------NEKIAIKSIDSQNNMKRQDT------GTLKSRLSDTSILSESNQIEASCICGNRL-TTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEK 1217
            N  + E + QF ++ D F ++ K+GEG+F+ V+   +K  +   E +ALK  IP   P+RIENEL+ L+ IGGK N+I +   +R  DHI  ++P+  H KF DY L M + EIR+Y+RNL +ALK VH  ++IHRDVKP+NFLY R+ K+       TLV  GL++ +      S                     D D+S  G      N + A++  + QN +  + T      G  K++ S  S  S    ++  C   +     C  C +R H    R GT G+R PEV ++  +QTTAVD W+ GI+    L+G+YPFF+  DD+     +I  +   +    A D  + ++++ K           +KS CQ +R+ C K
Sbjct:   29 NSEAGELLTQFPELKDIFTVVSKVGEGTFSNVY--LAKMHDFPDEFWALKHIIPTSGPERIENELKCLQIIGGKDNIIGVEMTYRRNDHIVFVLPYFPHQKFQDYMLDMSVCEIREYIRNLFIALKRVHSFQVIHRDVKPSNFLYCRQSKRDLLAIVKTLVT-GLSNGKYKSTAISPKSSKLPTRRSTRLSPQIENKDLDYSATGATLSRANTRPALEPRNDQNIIFTRSTKNFKSPGATKTKKSSRSP-SRHGGVKPRCAVKHSPDEICATCISRAHQNTPRAGTPGFRSPEVLLKCPDQTTAVDIWSAGIVFLCALSGRYPFFRAQDDMTALAQIISLIGSSESIHVANDQGKDVVMSEK------CPTGSLKSACQRLRQGCSK 405          
BLAST of cdc7-like protein vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 76.6406 bits (187), Expect = 9.619e-16
Identity = 49/157 (31.21%), Postives = 85/157 (54.14%), Query Frame = 3
Query:  207 INDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID------YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFT--LVDFGLAHS 653
            ++ N+++++ IGEGSFA VF+   +K  +      L+ T  + D ++IE E+ + K +   +N++ L+ + R  + + ++M +V      D      YY      + R   R LL AL+++H  +I+HRD+KP+N L  R     T  L DFGLA +
Sbjct:    1 MSPNYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLT-DVEDKEKIEQEIAVWKDLR-HENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYY---SEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQA 152          
BLAST of cdc7-like protein vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 72.0182 bits (175), Expect = 8.161e-14
Identity = 54/165 (32.73%), Postives = 85/165 (51.52%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIEN----ELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID---YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFD 686
            + +E +  +GEGS+  V K R K      +I A+K  I   D K ++     E+R+L+++   +N++ L   FR K  +F++  FVDH    D   Y   +D N +R  +  +L A++ +H + IIHRDVKP N L   R     L DFG A +   G   ++ D
Sbjct:    2 EKYENLGLVGEGSYGMVMKCRHKDS---NQIVAIKKFIESEDDKMVKKIAMREVRMLRQLR-HENLVNLIEVFRRKKRLFLVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENILVS-RSGIVKLCDFGFARTLASGQGEAYTD 161          

HSP 2 Score: 47.3654 bits (111), Expect = 8.042e-6
Identity = 38/155 (24.52%), Postives = 58/155 (37.42%), Query Frame = 3
Query:  909 GTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
             T  YR PE+ +  T+   AVD WAVG ++A  LTG+ P F  D D+D  + ++                               F + I    +  +KN   +   + D  +   +          A D+L   L+     R TC + L H FF
Sbjct:  164 ATRWYRAPELLVGDTKYGRAVDVWAVGCLLAEMLTGE-PLFPGDSDIDQLYHIMR-----------------------------CFGNLISRHREIFQKNPLFVGMRLPDIKEVEPMERRFPRISPMAVDMLKLCLKMDPSERPTCAQLLNHDFF 288          
BLAST of cdc7-like protein vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 70.8626 bits (172), Expect = 3.410e-13
Identity = 52/175 (29.71%), Postives = 88/175 (50.29%), Query Frame = 3
Query:  189 VKQFSDINDNFEIIDKIGEGSFAAVFKV--RSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV------DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKK--FTLVDFGLAHSEVHGDLGSWF 683
            + +    N+ +E+ +++G+G+F+ V K   R  KIE   +I   K  +   D  ++E E RI + +    NV++LH         F++   V      + I   +YY   D +     ++ +L++++H HEN I+HRD+KP N L   R +     L DFGLA  EV G+   W+
Sbjct:    7 ITEGGTFNEKYELKEELGKGAFSTVRKCCHRETKIEYAVKILDTK-NMTQRDVHKVEREARICRHLR-HPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHC---IQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLA-IEVDGERLGWY 175          
BLAST of cdc7-like protein vs. Ensembl Nematostella
Match: EDO36034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR1])

HSP 1 Score: 69.3218 bits (168), Expect = 9.695e-13
Identity = 72/290 (24.83%), Postives = 122/290 (42.07%), Query Frame = 3
Query:  219 FEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPII--DPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGN--------------RLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFF 1031
            FE I  IG G+F  V+ VR     ML  +  L+ +          ++ E  IL +    + V+KL+++F+ +++++ +M +V   D +  +  + +   +  + Y+  L++A+  VH    +HRD+KP+N L D +     L DFGL           W  D  + + G                RQD+     R  +        ++ A+C CG+              R       R + H  V   GT  Y  PEV +R      + D W+VG+I+   L G+ PF 
Sbjct:   38 FEKIRTIGIGAFGEVWLVRKTDTSMLYAMKILRKSEVFRRNQAAHVKAERDILAE-ADNEWVVKLYYSFQDQENLYFVMDYVPGGDLMSLLIKFGIFPEDYAKFYIAELVLAIDSVHRMGFVHRDIKPDNILID-KDGHIKLTDFGLCTG------FRWTHDSKYYEKGQH-------------MRQDSMEPDERAWE--------EMRATCHCGDISIDKPYSEMKPLERRHFRKHMRCQAHSLV---GTPNYIAPEVLLR-IGYRQSCDWWSVGVILYEMLVGQPPFL 294          
BLAST of cdc7-like protein vs. Ensembl Medaka
Match: cdc7 (cell division cycle 7 [Source:NCBI gene;Acc:101159611])

HSP 1 Score: 208.764 bits (530), Expect = 1.484e-61
Identity = 141/458 (30.79%), Postives = 210/458 (45.85%), Query Frame = 3
Query:  192 KQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIG-GKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHG-----------DLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKS-RLSDTS-----ILSESNQ-----IEASCICGNRLT--TCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLP---------------------LIGAFNDWIKSRC------------------QFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFF 1373
            K    +   F I+DKIGEG+F++V+   ++  +  KE+FALK  IP   P RI  EL+ L   G G++NV+ + + FR  DH+ ++MP+++H + I     +   E+R Y+ +LL AL+H+H+  IIHRD+KPNNFLY+RR   + LVDFGLA                  L               K   K+         + TG L   RLS  S      LS S+Q     ++    C   LT   C+ C +R      R GT G+R PEV  +  +Q TA+D W+ G+I+   L+G+YPFFK  DDL     ++      +   AAK   + ++ + +  P                     +  A  D  ++R                   Q    +CE+   L+K N +      +     D AY LL +LL+   +TRI+  EALQH  F
Sbjct:   21 KAVPQLATAFNILDKIGEGTFSSVYLGEARMRDGRKELFALKHLIPTSHPTRIAAELQCLTAAGCGRENVMGVTYCFRRDDHVVIVMPYMEHREIIGS---LSFAEVRLYVYHLLKALRHIHQFGIIHRDIKPNNFLYNRRSGVYALVDFGLAQGTADTKIELLKVVRPRPLQKGGGSAPQRSRAPPKPFSKTTSGSLPAPPRQTGALPPWRLSSASRAAGRTLSSSSQKPQRAVQPGLTCDCFLTDRVCNICMSRKQQVAPRAGTPGFRAPEVLTKCPDQGTAIDVWSAGVILLSLLSGRYPFFKAGDDLTALAQIMTVRGSRETIRAAKTFGKAVVCSQELPPQDLRTLCETLRGRRRSSTGEGVPPAMADACRNRMDGASARGPADAAEPSLQKQESLSSCERTESLVKPNLEAEEEVEDWDRVPDEAYHLLDRLLDLNPNTRISAAEALQHPLF 475          
BLAST of cdc7-like protein vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 83.9593 bits (206), Expect = 4.032e-17
Identity = 73/293 (24.91%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  186 YVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPK-----RIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLR---NLLVALKHVHENKIIHRDVKPNNFLYDRRRK--KFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFK 1034
            + K   +I + F++++++G G+F+ VF VR +K          KF +  I  K      +ENE+ +L++I   +NV+ L   +  + H +++M  V   +  D  L   +   +D  R    +L A+ ++H+N I+HRD+KP N LY  + +  K  + DFGL                                              S+++DT I+S               T C              GT GY  PEV +     + AVD W++G+I  I L G  PF++
Sbjct:   10 WKKSTENIQEIFDLMEELGSGAFSEVFMVRERKT-------GKKFAMKCIKKKKKRDINLENEMAVLRRIK-HENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGL----------------------------------------------SKMTDTGIMS---------------TAC--------------GTPGYVAPEV-LAQKPYSKAVDCWSIGVITYILLCGYPPFYE 218          
BLAST of cdc7-like protein vs. Ensembl Medaka
Match: ENSORLT00000012877.2 (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101157124])

HSP 1 Score: 81.6481 bits (200), Expect = 2.297e-16
Identity = 54/172 (31.40%), Postives = 89/172 (51.74%), Query Frame = 3
Query:  177 SVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLR---NLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHGDLGS 677
            +  + K  S+I D F+   K+G GSF+ VF VR KK   L  +  LK     +    +ENE+ IL++I   +NV+ L   +  + H +++M  V   +  D  L   +   +D  R    +L A+ ++H+N I+HRD+KP N L+       K  + DFGL+ +  HG + +
Sbjct:    7 TCSWKKSTSNIKDVFDFEGKMGSGSFSEVFMVREKKTGRLYALKCLKKKH--LAHSNLENEINILRRIK-HENVVGLEDFYESRTHYYLVMQLVSGGELFDRILDKGVYTEKDASRVIKQVLQAVSYLHQNSIVHRDLKPENLLFFNTDENAKIMVSDFGLSKTPEHGVMST 175          
BLAST of cdc7-like protein vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 73.9442 bits (180), Expect = 7.423e-14
Identity = 54/176 (30.68%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  186 YVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPK----RIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFID------YYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY--DRRRKKFTLVDFGLAHSEVHGDLGS 677
            + KQ  DI   F+  + +G G+F+ V   + K   +   +FA+K  IP    K     IENE+ +L+KI   +N++ L   +   DH++++M  V   +  D      +Y   D + +   +R +L A+ ++H+  I+HRD+KP N LY   +   K  + DFGL+  E  GD+ S
Sbjct:   14 WKKQVDDIKKIFDFKEVLGTGAFSEVVLAQEK---LSGRMFAVK-CIPKKALKGKESSIENEIAVLRKIK-HENIVALEDIYESPDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTL---IRQVLDAVNYLHKLGIVHRDLKPENLLYFNPQDESKIMISDFGLSKMEGSGDVMS 181          
BLAST of cdc7-like protein vs. Ensembl Medaka
Match: rps6kal (highly divergent homeobox [Source:NCBI gene;Acc:101174679])

HSP 1 Score: 72.7886 bits (177), Expect = 3.089e-13
Identity = 46/158 (29.11%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  216 NFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGD 668
             FE++  +G+GSF  VF VR        +++A+K     ++ + D  R + E  IL ++     ++KLH+AF+ +  +++++ F+   D    +   ++    +++ YL  L +AL H+H   I++RD+KP N L D       L DFGL+   V  D
Sbjct:  110 QFELLKVLGQGSFGKVFLVRKLVGPDASQLYAMKVLKKASLKVRDRVRTKMERDILVEVN-HPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIVYRDLKPENILLD-EAGHIKLTDFGLSKESVDAD 265          
BLAST of cdc7-like protein vs. Planmine SMEST
Match: SMESG000069572.1 (SMESG000069572.1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 406/406 (100.00%), Postives = 406/406 (100.00%), Query Frame = 3
Query:  159 TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 1376
            TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN
Sbjct:   13 TTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKIAIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHGCRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKYPFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFNDWIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEPKFHTRITCREALQHKFFN 418          
BLAST of cdc7-like protein vs. Planmine SMEST
Match: SMESG000024545.1 (SMESG000024545.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.896e-14
Identity = 51/148 (34.46%), Postives = 82/148 (55.41%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFK-VRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFR--VKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLA 647
            D+++I+ KIG G ++ VF  +R        E   +K   P+   K I+ E++IL+ + G  N+I L    R  + +   ++  +VD+  F D Y  +   +IR Y+  LL AL   H   I+HRDVKP+N + D +R+K  L+D+GLA
Sbjct:   35 DDYQIVRKIGRGKYSEVFAGIRFST----NEEVVIKVLKPVKKDK-IKREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLA 177          
BLAST of cdc7-like protein vs. Planmine SMEST
Match: SMESG000042100.1 (SMESG000042100.1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.558e-13
Identity = 45/147 (30.61%), Postives = 80/147 (54.42%), Query Frame = 3
Query:  219 FEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYLLMDINEIRDY---LRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKK-FTLVDFGLA 647
            +EI++KIG GS   V+    K+ ++    FA K     ++ K I++E+ +L K+    N+I+L+  +     + M++ +V   +  D  +       +D    +R +L A+ ++HEN IIHRD+KP N LY+ + +    L DFG+A
Sbjct:   19 YEILNKIGNGSTCTVYCCVRKRTDIK---FAAKVISKKVNKKLIKSEVGVLLKLT-HPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIA 161          
BLAST of cdc7-like protein vs. Planmine SMEST
Match: SMESG000059433.1 (SMESG000059433.1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.887e-13
Identity = 46/160 (28.75%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  210 NDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKF----TIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV---DHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGD 668
            + +FE++  +G+GSF  VF VR         ++A+K     ++ + D KR + E  IL  I     ++ LH+AF+ +  +++++ F+   D    +    +   ++++ YL  L +AL H+H   I++RD+KP N L D       L DFGL+   ++ D
Sbjct:   50 SSHFELLRVLGQGSFGKVFLVRKVSEPQQGILYAMKVLKKASLKVQDRKRTKMERDILAAIR-HPFIVTLHYAFQNEGKVYLILEFLKGGDLFSRLSKEFMFTEDDVKFYLAELALALDHLHSLGIVYRDLKPENILLD-EDGHIKLTDFGLSKESIYND 207          

HSP 2 Score: 55.8398 bits (133), Expect = 5.282e-8
Identity = 36/162 (22.22%), Postives = 78/162 (48.15%), Query Frame = 3
Query:  195 QFSDINDNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKR--IENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFVDHIKFIDYYL---LMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLY---DRRRKKFTLVDFGLAHSE 656
            +F  ++  + + ++IG+GSF+  ++   K          + + I +ID  +  +  E+ IL + G   +++KL   +  ++ + ++M +++  + +   L        E    L  L   + ++H N ++HRD+KP+N LY   D   +   + DFG A  +
Sbjct:  403 KFQKVDHYYTLKEEIGKGSFSVCYRAVHKTT-------GVNYAIKVIDGTKRDVIEEVEILFRFGAHPHIVKLKEVYVQQNTVSLIMEYLEGGELLTNILSQKYFSEKEASKILYVLTETVHYLHTNLVVHRDLKPSNILYSKKDTNPENLVICDFGFAKQQ 557          
BLAST of cdc7-like protein vs. Planmine SMEST
Match: SMESG000023149.1 (SMESG000023149.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.043e-12
Identity = 42/151 (27.81%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  213 DNFEIIDKIGEGSFAAVFKVRSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFRVKDHIFMLMPFV--DHIKFI-DYYLLMDINEIRDYLRNLLVALKHVHENKIIHRDVKPNNFLYDRRRKKFTLVDFGLAHSE 656
            +++  +DK+G+G++A VFK RS+  E L  +  ++       P     E+ +L+ +    NV+ LH        + ++  ++  D  +++ D   +M +N ++ +L  +L  L + H  +I+HRD+KP N L +  R    L DFGLA ++
Sbjct:  277 ESYTKLDKLGQGTYATVFKGRSRLTESLVALKEIRLEHEEGAPCTAIREVSLLRNLH-HANVVTLHDIIHTVKSLTLVFEYLHKDLKQYMEDCANIMSMNNVQIFLYQILRGLAYCHRRRILHRDLKPQNLLINPVRGDLKLADFGLARAK 426          
The following BLAST results are available for this feature:
BLAST of cdc7-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC71.005e-3644.87cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC... [more]
CDC71.005e-3644.87cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC... [more]
CAMK1G2.798e-1826.81calcium/calmodulin dependent protein kinase IG [So... [more]
CDC72.158e-1737.50cell division cycle 7 [Source:HGNC Symbol;Acc:HGNC... [more]
CAMK1G5.927e-1731.14calcium/calmodulin dependent protein kinase IG [So... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc-74.031e-2424.22Cell Division Cycle related [Source:UniProtKB/TrE... [more]
dapk-12.942e-1529.30Death-associated protein kinase dapk-1 [Source:Un... [more]
rskn-11.152e-1328.74Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.309e-1328.74Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.613e-1328.74Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG57907.533e-5530.21gene:FBgn0032677 transcript:FBtr0345614[more]
CG57907.533e-5530.21gene:FBgn0032677 transcript:FBtr0081050[more]
Cdc73.242e-3945.63gene:FBgn0028360 transcript:FBtr0343377[more]
Cdc73.292e-3945.63gene:FBgn0028360 transcript:FBtr0070950[more]
S6kII1.596e-1530.41gene:FBgn0262866 transcript:FBtr0333715[more]
back to top
BLAST of cdc7-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc72.665e-5734.16cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
cdc71.654e-5632.40cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
cdc71.497e-3838.42cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
camk1gb3.063e-1531.25calcium/calmodulin-dependent protein kinase IGb [S... [more]
si:ch73-60h1.14.102e-1523.24si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-15... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arid1a6.059e-5429.37AT-rich interaction domain 1A [Source:Xenbase;Acc:... [more]
arid1a5.862e-5128.07AT-rich interaction domain 1A [Source:Xenbase;Acc:... [more]
arid1a1.816e-3344.16AT-rich interaction domain 1A [Source:Xenbase;Acc:... [more]
arid1a2.119e-3344.16AT-rich interaction domain 1A [Source:Xenbase;Acc:... [more]
arid1a2.933e-3344.16AT-rich interaction domain 1A [Source:Xenbase;Acc:... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc71.011e-5730.81cell division cycle 7 (S. cerevisiae) [Source:MGI ... [more]
Cdc71.640e-5130.09cell division cycle 7 (S. cerevisiae) [Source:MGI ... [more]
Cdc71.273e-3945.86cell division cycle 7 (S. cerevisiae) [Source:MGI ... [more]
Cdc76.414e-3946.15cell division cycle 7 (S. cerevisiae) [Source:MGI ... [more]
Cdc76.414e-3946.15cell division cycle 7 (S. cerevisiae) [Source:MGI ... [more]
back to top
BLAST of cdc7-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8SR83|CDC72_ENCCU2.533e-4730.05Probable cell division control protein 7 homolog 2... [more]
sp|Q8SR85|CDC71_ENCCU2.587e-4730.05Probable cell division control protein 7 homolog 1... [more]
sp|Q9UQY9|SPO4_SCHPO3.520e-4427.55Cell cycle protein kinase spo4 OS=Schizosaccharomy... [more]
sp|Q9Z0H0|CDC7_MOUSE4.486e-3846.15Cell division cycle 7-related protein kinase OS=Mu... [more]
sp|P06243|CDC7_YEAST1.676e-3630.09Cell division control protein 7 OS=Saccharomyces c... [more]
back to top
BLAST of cdc7-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJV64.552e-160100.00Cdc7-like protein (Fragment) OS=Schmidtea mediterr... [more]
G4VG923.027e-12244.91Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
A0A3Q0KTJ78.354e-12142.62Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
A0A2H1CIK51.533e-12042.44Kinase domain protein OS=Fasciola hepatica OX=6192... [more]
A0A4E0RF945.278e-12042.44Cell division cycle 7 protein kinase OS=Fasciola h... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc72.480e-6035.28cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
cdc75.999e-3945.22cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
camk1ga2.446e-1531.33calcium/calmodulin-dependent protein kinase IGa [S... [more]
camk1gb1.432e-1428.82calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb2.450e-1429.45calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc71.042e-3645.33cell division cycle 7 homolog (S. cerevisiae) [Sou... [more]
ENSPMAT00000008748.19.845e-1228.24pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
mast23.884e-1123.01microtubule associated serine/threonine kinase 2 [... [more]
ENSPMAT00000008013.15.104e-1126.14pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 g... [more]
cdk29.257e-1129.03cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC72.414e-3830.09DDK (Dbf4-dependent kinase) catalytic subunit; req... [more]
CKA23.750e-1634.67Alpha' catalytic subunit of casein kinase 2 (CK2);... [more]
PHO852.823e-1226.28Cyclin-dependent kinase; has ten cyclin partners; ... [more]
SNF13.495e-1224.70AMP-activated S/T protein kinase; forms a complex ... [more]
PKH14.510e-1128.19Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO338258.684e-6133.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412429.619e-1631.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354028.161e-1432.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498983.410e-1329.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360349.695e-1324.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cdc7-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc71.484e-6130.79cell division cycle 7 [Source:NCBI gene;Acc:101159... [more]
camk1gb4.032e-1724.91calcium/calmodulin-dependent protein kinase type 1... [more]
ENSORLT00000012877.22.297e-1631.40calcium/calmodulin-dependent protein kinase type 1... [more]
camk1da7.423e-1430.68calcium/calmodulin dependent protein kinase ID [So... [more]
rps6kal3.089e-1329.11highly divergent homeobox [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of cdc7-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069572.10.000e+0100.00SMESG000069572.1[more]
SMESG000024545.11.896e-1434.46SMESG000024545.1[more]
SMESG000042100.11.558e-1330.61SMESG000042100.1[more]
SMESG000059433.13.887e-1328.75SMESG000059433.1[more]
SMESG000023149.11.043e-1227.81SMESG000023149.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008000
GenBankACT98293.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008000 ID=SMED30008000|Name=cdc7-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1404bp
TCTCTTTGAGAAAATTTTATTGTATTTCTTCGAATTTGAAATATTTTATT
TCAAAATAATTAAATAAAATTTTTTATAAAATCATATAATAAATTTTTTT
ATATATTTTATCATATTTTGTTATGTCTTCTGTATCCGAAAATTCAGAAA
ATGTTAATACAACAATCAATATTCGATCGGTTGAATATGTTAAACAATTT
TCAGATATCAATGACAACTTCGAAATAATTGATAAAATAGGAGAAGGATC
ATTTGCTGCCGTGTTTAAAGTTAGAAGCAAGAAAATAGAAATGTTAAAGG
AAATTTTTGCTTTAAAATTCACTATTCCAATAATTGATCCAAAACGAATC
GAAAATGAATTAAGAATTCTAAAAAAGATTGGAGGGAAAAAGAATGTAAT
CAAGCTACATTTTGCATTTCGTGTTAAAGACCATATTTTCATGCTTATGC
CATTTGTAGACCATATAAAATTTATTGATTATTATTTATTAATGGATATT
AACGAAATTCGAGATTATTTGCGGAATTTATTAGTAGCTCTTAAACATGT
CCACGAGAATAAGATAATTCATAGGGATGTTAAACCAAACAATTTTCTTT
ATGACCGAAGACGGAAAAAATTTACTTTAGTCGATTTCGGATTGGCTCAT
TCAGAAGTTCACGGTGATCTCGGTTCTTGGTTCGATGATGAAGATCACTC
CGATTTCGGCAACGAAAAGATTGCCATAAAGAGTATTGATTCGCAAAATA
ATATGAAGCGCCAGGATACTGGCACATTAAAATCTAGGCTGTCTGACACG
AGTATTTTAAGTGAAAGTAACCAAATTGAAGCGTCTTGCATTTGTGGTAA
TCGATTAACCACTTGCCATGGATGTCGTACGAGGCCTCATCCCCAGGTCC
GCAGAGGGGGAACTGTAGGGTATCGACCACCGGAAGTGACAATGCGACAC
ACTGAACAGACAACTGCCGTAGATACATGGGCAGTTGGTATTATCATGGC
AATATTTCTAACTGGAAAATACCCTTTCTTCAAAGTCGACGACGATTTAG
ACGTCTTCCATTCCTTGATTTACTTTTTAAGCTTCGAAAAAATGCAAGCA
GCAGCAAAAGATATTCAACGGCGAATCATTGTCAATCCGAAACCGCTGCC
TCTCATTGGTGCATTCAATGATTGGATAAAATCCAGGTGCCAATTTATCC
GTAAAAATTGCGAAAAGATCACAAAGTTAATCAAAGATAACTCTGATAAA
AATTGCATTTATGGAAACCATGCCGAATTTGATGATTCGGCGTATGATCT
TTTATCGAAACTGCTGGAACCGAAATTTCATACCCGAATCACATGTCGAG
AAGCCCTCCAGCATAAGTTCTTCAATATCATCTGAATCGATATAATTATT
TGTT
back to top

protein sequence of SMED30008000-orf-1

>SMED30008000-orf-1 ID=SMED30008000-orf-1|Name=SMED30008000-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MSSVSENSENVNTTINIRSVEYVKQFSDINDNFEIIDKIGEGSFAAVFKV
RSKKIEMLKEIFALKFTIPIIDPKRIENELRILKKIGGKKNVIKLHFAFR
VKDHIFMLMPFVDHIKFIDYYLLMDINEIRDYLRNLLVALKHVHENKIIH
RDVKPNNFLYDRRRKKFTLVDFGLAHSEVHGDLGSWFDDEDHSDFGNEKI
AIKSIDSQNNMKRQDTGTLKSRLSDTSILSESNQIEASCICGNRLTTCHG
CRTRPHPQVRRGGTVGYRPPEVTMRHTEQTTAVDTWAVGIIMAIFLTGKY
PFFKVDDDLDVFHSLIYFLSFEKMQAAAKDIQRRIIVNPKPLPLIGAFND
WIKSRCQFIRKNCEKITKLIKDNSDKNCIYGNHAEFDDSAYDLLSKLLEP
KFHTRITCREALQHKFFNII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000727double-strand break repair via break-induced replication
GO:0006270DNA replication initiation
GO:0006909phagocytosis
GO:0007049cell cycle
GO:0008284positive regulation of cell proliferation
GO:0008360regulation of cell shape
GO:0010571positive regulation of nuclear cell cycle DNA replication
GO:0010971positive regulation of G2/M transition of mitotic cell cycle
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0044770cell cycle phase transition
GO:0051301cell division
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0045171intercellular bridge
GO:0072686mitotic spindle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 33..417
e-value: 4.2E-55
score: 199.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 33..177
e-value: 1.6E-26
score: 93.2
coord: 261..417
e-value: 4.0E-15
score: 55.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 33..417
score: 36.584
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 12..112
e-value: 5.0E-25
score: 89.4
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 25..417
NoneNo IPR availablePANTHERPTHR11909:SF7CELL DIVISION CYCLE 7-RELATED PROTEIN KINASEcoord: 25..417
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 148..160
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 39..65
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 12..418