GTP-binding protein

Overview
NameGTP-binding protein
Smed IDSMED30007993
Length (bp)2499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP-binding protein (SMED30007993) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP-binding protein (SMED30007993) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP-binding protein (SMED30007993) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP-binding protein (SMED30007993) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007993

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007993SMESG000065983.1 SmedASXL_015359SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007993SMESG000065983.1 dd_Smed_v6_11291_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007993SMESG000065983.1 dd_Smed_v4_11291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP-binding protein vs. Ensembl Human
Match: CASC1 (cancer susceptibility 1 [Source:HGNC Symbol;Acc:HGNC:29599])

HSP 1 Score: 171.4 bits (433), Expect = 8.387e-45
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  201 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 548          

HSP 2 Score: 75.8702 bits (185), Expect = 1.376e-13
Identity = 43/111 (38.74%), Postives = 72/111 (64.86%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEK 655
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+ E+L +++   E+E    E+
Sbjct:   66 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVAT-EILLKSSAEEESEAIKCER 174          
BLAST of GTP-binding protein vs. Ensembl Human
Match: CASC1 (cancer susceptibility 1 [Source:HGNC Symbol;Acc:HGNC:29599])

HSP 1 Score: 172.17 bits (435), Expect = 2.745e-44
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  329 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 676          

HSP 2 Score: 135.576 bits (340), Expect = 2.891e-32
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:   55 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 222          
BLAST of GTP-binding protein vs. Ensembl Human
Match: CASC1 (cancer susceptibility 1 [Source:HGNC Symbol;Acc:HGNC:29599])

HSP 1 Score: 171.785 bits (434), Expect = 2.816e-44
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  310 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 657          

HSP 2 Score: 135.576 bits (340), Expect = 2.725e-32
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:   36 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 203          
BLAST of GTP-binding protein vs. Ensembl Human
Match: CASC1 (cancer susceptibility 1 [Source:HGNC Symbol;Acc:HGNC:29599])

HSP 1 Score: 172.555 bits (436), Expect = 2.992e-44
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  369 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 716          

HSP 2 Score: 135.191 bits (339), Expect = 4.044e-32
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:   95 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 262          
BLAST of GTP-binding protein vs. Ensembl Human
Match: CASC1 (cancer susceptibility 1 [Source:HGNC Symbol;Acc:HGNC:29599])

HSP 1 Score: 171.785 bits (434), Expect = 5.240e-44
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  375 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 722          

HSP 2 Score: 135.191 bits (339), Expect = 4.827e-32
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:  101 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 268          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: casc1 (cancer susceptibility candidate 1 [Source:NCBI gene;Acc:566485])

HSP 1 Score: 202.986 bits (515), Expect = 1.111e-54
Identity = 124/445 (27.87%), Postives = 212/445 (47.64%), Query Frame = 2
Query: 1133 YVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            +++DL+ +TP+GG+F+ ++  +PPQ +   GW M ++++   L  FPY      I    QSS  V     L  + +    + P+ V + +P  V+  ++PQ+A W+   + W+T+ +  T Y  + +T++F+M+ F    + Q+ + NMPFQSW L+P                                                ++ +L  I  A+ +V + +   +  +L  +E  +L+ L  KW + ++L K MR AGINIF  E S KYVSI  K+P+ E  +Y+QM+L+S +VAFSWSRWN++C+  +  ++ A E +    PV E+ WS+     ++ + LKMKE             Q+D                      FS ++ +  +FHS   H   +  + EG   V+     Y +T++ LL A R L ++
Sbjct:  378 HIVDLQQFTPLGGVFYFDLFHMPPQSRTVKGWEM-RELLDTGLQVFPYPTEQSRI----QSSTSVK----LDEHSNTTVASLPVGVTVALPHSVLFLEDPQVARWDPIGQHWRTDCISETSYDAESRTISFQMTAFYAFTLLQETYANMPFQSWELRPL----------------------------------------------GQDSALFTITGALIEVSITVKGKQC-MLHTEETKDLDHLLGKWMSPSELQKAMRKAGINIFVNEYSDKYVSINLKDPLIEHAVYEQMALMSSAVAFSWSRWNAQCRQ-EHLVLQACEQMEV-GPVAEEAWSLYLLGAQRNQHLKMKE-------------QED---------------------SFSPELAEGSEFHSTFLHMLRQDMSTEGQARVRQSHHLYIDTVQRLLCATRVLTYS 730          

HSP 2 Score: 152.14 bits (383), Expect = 1.184e-37
Identity = 83/206 (40.29%), Postives = 129/206 (62.62%), Query Frame = 2
Query:  296 EKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEAS 913
            E   R +  WERY+ CDGSPDPS+  EINTYI+LWR+D +N  I+ ++ E  + L L +EL+FL+ D   E S A Q   Y ET+  LQ L+  K+++A+ E+L  A   ++ +  N++ V K   + LCLW NL KNPR   ++F EVG+   +PK L + ++A RIL+T+YDH S  S+    +++   +S++  ++ + TE+S
Sbjct:   92 EAECREKSKWERYMLCDGSPDPSVQPEINTYISLWRDDSEN-QIQKVLEECALTLELEKELDFLLGD-GPEPSIAEQ---YQETLLSLQNLIHYKLNQATEELLKFANYNSDIDTGNMQTVVKDNNITLCLWANLNKNPRFKGYKFEEVGLGFELPKPLAVIEVAVRILHTRYDHLSHHSEREQLQKR---RSMMEAILTQNTESS 289          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: casc1 (cancer susceptibility candidate 1 [Source:NCBI gene;Acc:566485])

HSP 1 Score: 200.29 bits (508), Expect = 8.260e-54
Identity = 124/448 (27.68%), Postives = 212/448 (47.32%), Query Frame = 2
Query: 1133 YVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICD---SRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            +++DL+ +TP+GG+F+ ++  +PPQ +   GW M ++++   L  FPY      I    QSS  V     L  + +    + P+ V + +P  V+  ++PQ+A W+   + W+T+ +  T Y  + +T++F+M+ F    + Q+ + NMPFQSW L+P                                                ++ +L  I  A+ +V + +      +  +L  +E  +L+ L  KW + ++L K MR AGINIF  E S KYVSI  K+P+ E  +Y+QM+L+S +VAFSWSRWN++C+  +  ++ A E +    PV E+ WS+     ++ + LKMKE             Q+D                      FS ++ +  +FHS   H   +  + EG   V+     Y +T++ LL A R L ++
Sbjct:  355 HIVDLQQFTPLGGVFYFDLFHMPPQSRTVKGWEM-RELLDTGLQVFPYPTEQSRI----QSSTSVK----LDEHSNTTVASLPVGVTVALPHSVLFLEDPQVARWDPIGQHWRTDCISETSYDAESRTISFQMTAFYAFTLLQETYANMPFQSWELRPL----------------------------------------------GQDSALFTITGALIEVSITVKAREAGKQCMLHTEETKDLDHLLGKWMSPSELQKAMRKAGINIFVNEYSDKYVSINLKDPLIEHAVYEQMALMSSAVAFSWSRWNAQCRQ-EHLVLQACEQMEV-GPVAEEAWSLYLLGAQRNQHLKMKE-------------QED---------------------SFSPELAEGSEFHSTFLHMLRQDMSTEGQARVRQSHHLYIDTVQRLLCATRVLTYS 711          

HSP 2 Score: 151.754 bits (382), Expect = 1.226e-37
Identity = 87/230 (37.83%), Postives = 140/230 (60.87%), Query Frame = 2
Query:  224 KKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEAS 913
            ++R  EL + R + + +   +   E   R +  WERY+ CDGSPDPS+  EINTYI+LWR+D +N  I+ ++ E  + L L +EL+FL+ D   E S A Q   Y ET+  LQ L+  K+++A+ E+L  A   ++ +  N++ V K   + LCLW NL KNPR   ++F EVG+   +PK L + ++A RIL+T+YDH S  S+    +++   +S++  ++ + TE+S
Sbjct:   69 ERREDELNELRHILDENHFAVTVWEAECREKSKWERYMLCDGSPDPSVQPEINTYISLWRDDSEN-QIQKVLEECALTLELEKELDFLLGD-GPEPSIAEQ---YQETLLSLQNLIHYKLNQATEELLKFANYNSDIDTGNMQTVVKDNNITLCLWANLNKNPRFKGYKFEEVGLGFELPKPLAVIEVAVRILHTRYDHLSHHSEREQLQKR---RSMMEAILTQNTESS 290          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: casc1 (cancer susceptibility candidate 1 [Source:NCBI gene;Acc:566485])

HSP 1 Score: 200.29 bits (508), Expect = 8.391e-54
Identity = 124/448 (27.68%), Postives = 212/448 (47.32%), Query Frame = 2
Query: 1133 YVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICD---SRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            +++DL+ +TP+GG+F+ ++  +PPQ +   GW M ++++   L  FPY      I    QSS  V     L  + +    + P+ V + +P  V+  ++PQ+A W+   + W+T+ +  T Y  + +T++F+M+ F    + Q+ + NMPFQSW L+P                                                ++ +L  I  A+ +V + +      +  +L  +E  +L+ L  KW + ++L K MR AGINIF  E S KYVSI  K+P+ E  +Y+QM+L+S +VAFSWSRWN++C+  +  ++ A E +    PV E+ WS+     ++ + LKMKE             Q+D                      FS ++ +  +FHS   H   +  + EG   V+     Y +T++ LL A R L ++
Sbjct:  354 HIVDLQQFTPLGGVFYFDLFHMPPQSRTVKGWEM-RELLDTGLQVFPYPTEQSRI----QSSTSVK----LDEHSNTTVASLPVGVTVALPHSVLFLEDPQVARWDPIGQHWRTDCISETSYDAESRTISFQMTAFYAFTLLQETYANMPFQSWELRPL----------------------------------------------GQDSALFTITGALIEVSITVKAREAGKQCMLHTEETKDLDHLLGKWMSPSELQKAMRKAGINIFVNEYSDKYVSINLKDPLIEHAVYEQMALMSSAVAFSWSRWNAQCRQ-EHLVLQACEQMEV-GPVAEEAWSLYLLGAQRNQHLKMKE-------------QED---------------------SFSPELAEGSEFHSTFLHMLRQDMSTEGQARVRQSHHLYIDTVQRLLCATRVLTYS 710          

HSP 2 Score: 151.754 bits (382), Expect = 1.229e-37
Identity = 87/230 (37.83%), Postives = 140/230 (60.87%), Query Frame = 2
Query:  224 KKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEAS 913
            ++R  EL + R + + +   +   E   R +  WERY+ CDGSPDPS+  EINTYI+LWR+D +N  I+ ++ E  + L L +EL+FL+ D   E S A Q   Y ET+  LQ L+  K+++A+ E+L  A   ++ +  N++ V K   + LCLW NL KNPR   ++F EVG+   +PK L + ++A RIL+T+YDH S  S+    +++   +S++  ++ + TE+S
Sbjct:   68 ERREDELNELRHILDENHFAVTVWEAECREKSKWERYMLCDGSPDPSVQPEINTYISLWRDDSEN-QIQKVLEECALTLELEKELDFLLGD-GPEPSIAEQ---YQETLLSLQNLIHYKLNQATEELLKFANYNSDIDTGNMQTVVKDNNITLCLWANLNKNPRFKGYKFEEVGLGFELPKPLAVIEVAVRILHTRYDHLSHHSEREQLQKR---RSMMEAILTQNTESS 289          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Casc1 (cancer susceptibility candidate 1 [Source:MGI Symbol;Acc:MGI:2444480])

HSP 1 Score: 154.451 bits (389), Expect = 2.467e-38
Identity = 112/451 (24.83%), Postives = 194/451 (43.02%), Query Frame = 2
Query: 1124 DEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDS---RVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
             + Y +DL +++ +GG++H++++ LPPQ K   GW + + ++   L  F Y   T           +  D DV            PI V ++I   VI  + P++  W+   K W+++G+    Y  +++ LTF M   G V + QD H+NMP+QSW + P                                                 N+ LL++     +++++I ++      +    +  E + L  KW      I  ++ AG+NIFP   S  YV I  K P  E   Y QM+LLS + +F WS+WN  C NS   ++   E L+ E       WS+L F+  + + LKM+E ++KFS                     E L+             +  +FHS L+H  ++F +   M  V++ +  + +++  +L +IR L ++
Sbjct:  384 SQAYKVDLCHFSTLGGVYHLDVLELPPQCKPVKGWVLVE-ILQEGLQRFIYPPDTT----------EEPDPDV---------TFPPIEVTLEIHKSVIFFERPRVVRWDNEGKFWRSDGISSVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPC----------------------------------------------GMNKVLLIVKTVFMELQIYIKENLCMLASVKLRGKGLEFH-LKGKWMAPIPFILALKEAGLNIFPAVYSHFYVVINNKVPQVELKAYRQMALLSSAFSFGWSKWNMVC-NSTRVVIRVREQLSEE--TEHHTWSLLMFSGDRAQMLKMQEENDKFS---------------------EALR-------------EGTEFHSTLYHMMKDFASPVAMERVRHSNCQFIDSVCYMLLSIRVLSYS 730          

HSP 2 Score: 125.176 bits (313), Expect = 4.694e-29
Identity = 66/173 (38.15%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  308 RFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            R    W+ Y  CDGSPDP + QE+NT+I+LW E+EKN   E +M +S + L LIE+++ ++ +    E     + ++  +I  LQ LL  KI+ A+  +L +A+ +A+ +  N+EK+ K + + L +W NL KNPR     F E  I   IP+ L  S++A R+L+T+YDH +
Sbjct:   95 RALAQWKHYTECDGSPDPWVAQEMNTFISLW-EEEKNQAFEQVMEKSKLVLSLIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLRQASNLADLDTGNMEKIIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHIT 266          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Casc1 (cancer susceptibility candidate 1 [Source:MGI Symbol;Acc:MGI:2444480])

HSP 1 Score: 125.946 bits (315), Expect = 1.874e-29
Identity = 83/323 (25.70%), Postives = 139/323 (43.03%), Query Frame = 2
Query: 1124 DEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDS---RVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCI 2083
             + Y +DL +++ +GG++H++++ LPPQ K   GW + + ++   L  F Y   T           +  D DV            PI V ++I   VI  + P++  W+   K W+++G+    Y  +++ LTF M   G V + QD H+NMP+QSW + P                                                 N+ LL++     +++++I ++      +    +  E + L  KW      I  ++ AG+NIFP   S  YV I  K P  E   Y QM+LLS + +F WS+WN  C ++   I
Sbjct:  384 SQAYKVDLCHFSTLGGVYHLDVLELPPQCKPVKGWVLVE-ILQEGLQRFIYPPDTT----------EEPDPDVTFP---------PIEVTLEIHKSVIFFERPRVVRWDNEGKFWRSDGISSVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPC----------------------------------------------GMNKVLLIVKTVFMELQIYIKENLCMLASVKLRGKGLEFH-LKGKWMAPIPFILALKEAGLNIFPAVYSHFYVVINNKVPQVELKAYRQMALLSSAFSFGWSKWNMVCNSTRVVI 639          

HSP 2 Score: 125.176 bits (313), Expect = 3.521e-29
Identity = 66/173 (38.15%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  308 RFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            R    W+ Y  CDGSPDP + QE+NT+I+LW E+EKN   E +M +S + L LIE+++ ++ +    E     + ++  +I  LQ LL  KI+ A+  +L +A+ +A+ +  N+EK+ K + + L +W NL KNPR     F E  I   IP+ L  S++A R+L+T+YDH +
Sbjct:   95 RALAQWKHYTECDGSPDPWVAQEMNTFISLW-EEEKNQAFEQVMEKSKLVLSLIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLRQASNLADLDTGNMEKIIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHIT 266          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Casc1 (cancer susceptibility candidate 1 [Source:MGI Symbol;Acc:MGI:2444480])

HSP 1 Score: 125.561 bits (314), Expect = 3.348e-29
Identity = 66/173 (38.15%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  308 RFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            R    W+ Y  CDGSPDP + QE+NT+I+LW E+EKN   E +M +S + L LIE+++ ++ +    E     + ++  +I  LQ LL  KI+ A+  +L +A+ +A+ +  N+EK+ K + + L +W NL KNPR     F E  I   IP+ L  S++A R+L+T+YDH +
Sbjct:   82 RALAQWKHYTECDGSPDPWVAQEMNTFISLW-EEEKNQAFEQVMEKSKLVLSLIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLRQASNLADLDTGNMEKIIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHIT 253          

HSP 2 Score: 105.531 bits (262), Expect = 6.063e-23
Identity = 97/450 (21.56%), Postives = 176/450 (39.11%), Query Frame = 2
Query: 1127 EEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDS---RVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            + Y +DL +++ +GG++H++++ LPPQ K   GW + + ++   L  F Y   T           +  D DV            PI V ++I   VI  + P++  W+   K W+++G+    Y  +++ LTF M   G V + QD H+NMP+QSW + P                                                 N+ LL++     +++++I ++      +    +  E + L  KW      I  ++ AG+NIFP   S  YV I   N V E++  +                              +EH           WS+L F+  + + LKM+E ++KFS                     E L+             +  +FHS L+H  ++F +   M  V++ +  + +++  +L +IR L ++
Sbjct:  372 QAYKVDLCHFSTLGGVYHLDVLELPPQCKPVKGWVLVE-ILQEGLQRFIYPPDTT----------EEPDPDV---------TFPPIEVTLEIHKSVIFFERPRVVRWDNEGKFWRSDGISSVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPC----------------------------------------------GMNKVLLIVKTVFMELQIYIKENLCMLASVKLRGKGLEFH-LKGKWMAPIPFILALKEAGLNIFPAVYSHFYVVIN--NKVREQLSEE------------------------------TEH---------HTWSLLMFSGDRAQMLKMQEENDKFS---------------------EALR-------------EGTEFHSTLYHMMKDFASPVAMERVRHSNCQFIDSVCYMLLSIRVLSYS 679          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q8T880|AXP83_CIOIN (Axonemal 84 kDa protein OS=Ciona intestinalis OX=7719 GN=AXP83.9 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.066e-57
Identity = 121/364 (33.24%), Postives = 188/364 (51.65%), Query Frame = 2
Query: 1136 VIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQV-VPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARP-ILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI--LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERP---VNEDDWSVLSFTRKKVEKLKMKEYDEKFS 2206
            V+DLR ++P+GG++H++++  PPQP I  GWT+TQ +  P     +P          +R +S +   RD  S +K  +   +P I +   +P +V+  +EPQ+A W+++ K WKT G+  T + ++ + L F+  +FG   + QD H+NMPFQSW LKP                                                 N ++L I AA+ +V + + DS+ R+     D   EL+ L  KW  V  LI  MR AG+N+FP EDS K+VSI  K  V  E +Y+QM++LS + AFSWS+WN++  +    I +A   +    P   V++DDWS+ S +     KL + EYDE+F+
Sbjct:  369 VVDLRQFSPLGGVYHVDLLKTPPQPNIVRGWTLTQIIDKPLSTVKYPSDNPNTGRSSSRVASANPEGRDEGSPSKTPLEQQQPPIGLTFALPSNVMFFEEPQVASWDSSDKHWKTSGITDTNFDEENRKLLFKTQEFGTFCLMQDSHLNMPFQSWELKP----------------------------------------------KGTNSTVLTITAAIAEVEIEVKDSKCRLNAPAEDPPKELSGLYGKWMAVPKLIAAMRDAGVNVFPAEDSHKFVSIQSKE-VDLERVYEQMAILSSTFAFSWSKWNNDAGSKQVIIQIAPCLIKENVPRDAVSDDDWSIFSVSDDMSYKLALSEYDEEFA 685          

HSP 2 Score: 132.88 bits (333), Expect = 1.230e-30
Identity = 74/195 (37.95%), Postives = 116/195 (59.49%), Query Frame = 2
Query:  287 IEDEKNRRFQYS-WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVE 868
            +E  KN +  ++ W RY++CDG PDP+  +EINT+I+L  E + +  +  ++ ++ + L LI +L  L+ D+  EE F  ++  Y +TI  LQ LL  + + A+L+ML  A+  A++E  NL+KV   +   + LW NL KNPR   FEF    I   +PK L ++DIA RIL T++DH S     F  ++K V+
Sbjct:   85 VEQVKNDKLAHAEWNRYMKCDGKPDPTSVKEINTFISLSHE-KGSPDVNIVLEDAKLILSLISDLNELLEDFTPEE-FEQKVDSYRQTILSLQDLLLNRYNEATLKMLKEASYEADSESGNLQKVVDGENETIMLWANLNKNPRFKLFEFENEKISFELPKVLAMADIAVRILRTKFDHYSHQCTTFLPKKKKVK 277          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|A6H8T2|CASC1_DANRE (Protein CASC1 OS=Danio rerio OX=7955 GN=casc1 PE=2 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 3.773e-53
Identity = 125/445 (28.09%), Postives = 211/445 (47.42%), Query Frame = 2
Query: 1133 YVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            +++DL+ +TP+GG+F+ ++  +PPQ +   GW M ++++   L  FPY      I    QSS  V     L  + +    + P+ V + +P  V+  ++PQ+A W+   + W+T+ +  T Y  + +T++F+M+ F    + Q+ + NMPFQSW L+P                                                ++ +L  I  A+ +V + +   +  +L  +E  +L+ L  KW + ++L K MR AGINIF  E S KYVSI  K+P+ E  +Y+QM+L+S +VAFSWSRWN++C+  +  ++ A E L    PV E  WS+     ++ + LKMKE             Q+D                      FS ++ +  +FHS   H   +  + EG   V+     Y +T++ LL A R L ++
Sbjct:  379 HIVDLQQFTPLGGVFYFDLFHMPPQSRTVKGWEM-RELLDTGLQVFPYPTEQSRI----QSSTSVK----LDEHSNTTVASLPVGVTVALPHSVLFLEDPQVARWDPIGQHWRTDCISETSYDAELRTISFQMTAFYAFTLLQETYANMPFQSWELRPL----------------------------------------------GQDSALFTITGALIEVSITVKGKQC-MLHTEETKDLDRLLGKWMSPSELQKAMRKAGINIFVNEYSDKYVSINLKDPLIEHAVYEQMALMSSAVAFSWSRWNAQCRQ-EHLVLQACEQLEV-GPVAEKAWSLYLLGAQRNQHLKMKE-------------QED---------------------SFSPELAEGSEFHSTFLHMLRQDLSTEGQARVRQSHHLYIDTVQRLLCATRVLTYS 731          

HSP 2 Score: 135.576 bits (340), Expect = 2.036e-31
Identity = 84/206 (40.78%), Postives = 129/206 (62.62%), Query Frame = 2
Query:  296 EKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEAS 913
            E   R +  WERY+ CDGSPDPS+  EINTYI+LWR+D +N  I+ ++ E  + L L +ELEFL+ D   E S A Q   Y ET+  LQ L+  K+++A+ E+L  A   ++ +  N++ V K   + LCLW NL KNPR   ++F EVG+   +PK L + ++A RIL+T+YDH S  S+    +++   +S++  ++ + TE+S
Sbjct:   93 EAECREKSKWERYMLCDGSPDPSVQPEINTYISLWRDDSEN-QIQKVLEECALTLELEKELEFLLGD-GPEPSIAEQ---YQETLLSLQNLIHYKLNQATEELLKFANYNSDIDTGNMQTVVKDSNITLCLWANLNKNPRFKGYKFEEVGLGFELPKPLAVIEVAVRILHTRYDHLSHHSEREQLQKR---RSMMEAILTQNTESS 290          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q29RU8|CASC1_BOVIN (Protein CASC1 OS=Bos taurus OX=9913 GN=CASC1 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.094e-47
Identity = 123/451 (27.27%), Postives = 205/451 (45.45%), Query Frame = 2
Query: 1127 EEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            EE  +DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y   T                D+ + N     V  PI V +++ ++VI  + P +A W+   K+WKT+G+    YK +E+ +TF +  F  V + QD HINMP+QSW L+P      D+                                         N+ LL I     ++++ I ++   +    + N  H+ +  L  KW T    I  ++ AG+NIFP   S  YV I  K+P  E   Y QM+LLS + AF WS+WN+ C++  T +    EHL  E P+   +W++L F+                     DR Q               LK+ E  + FS  + +  +FHS L+H  ++F ++E M AV+  +  + +++ ++L + R L ++
Sbjct:  368 EENEVDLCQFTTLGGVYHLDILELPPQCKPMKGW-MIVEILKEGLQKYTYPPETT--------------EDLEAEN-----VFPPIEVTLEVHENVIFFENPMVARWDAEGKQWKTDGISNVSYKSEERLITFNLETFCPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTITTVFTELQIQIKENLCMLASIKVNNKNHSSI--LEEKWMTPVSFIIALKKAGLNIFPTGHSHLYVVINYKHPSVEVKAYRQMALLSSAFAFCWSKWNTACESKKT-VFQVREHLLKEEPIRNPNWTLLMFS--------------------GDRAQS--------------LKINESSDAFSEALKEETEFHSTLYHMVKDFASQEAMRAVRRSNCQFVDSVCHMLLSTRLLSYS 715          

HSP 2 Score: 130.568 bits (327), Expect = 5.763e-30
Identity = 74/176 (42.05%), Postives = 110/176 (62.50%), Query Frame = 2
Query:  299 KNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            ++ RF   W+ Y+ CDGSPDPSI QEINT+I LW+E E N T+E ++ +S + L LIE+L+ ++ +    +     I +Y E+I ELQ LL  K +RA+  +L +A+ +A+ +  N+EKV + + + L +W NL KNPR     F E      IP+ L  SDIA R+L+T YDH +
Sbjct:   87 RDNRFLSQWKHYIECDGSPDPSIAQEINTFITLWKE-ETNETLEEVIEKSKLVLNLIEKLKLILLETPPYDLQGKNIIQYQESILELQELLHLKFNRATEILLRQASTLADLDSGNMEKVIQDENVTLYIWANLKKNPRHRSIRFSETQTGFEIPRILATSDIALRLLHTHYDHVT 261          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q6TDU7|CASC1_HUMAN (Protein CASC1 OS=Homo sapiens OX=9606 GN=CASC1 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.437e-43
Identity = 122/454 (26.87%), Postives = 203/454 (44.71%), Query Frame = 2
Query: 1118 FEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRI----LFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            FED   V+DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y           +++F                   PI V +++ ++VI  ++P +  W+   K W+T+G+    YK  E+ +TF +  FG V + QD HINMP+QSW L+P      D+                                         N+ LL +     ++++ I ++   +    L + +H  ++ L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E      +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H  ++F +EE M  V++ +  + N++ ++L + R L ++
Sbjct:  369 FEDN--VVDLCQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYP-PETTEEFETENAFP------------------PIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRP-----LDV-----------------------------------------NKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKH--ISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLC-NSTKVVFKVREHLT-EACTENPNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 716          

HSP 2 Score: 135.191 bits (339), Expect = 1.942e-31
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            W+ Y++CDGSPDPS+ QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K   A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:   95 WKHYIQCDGSPDPSVAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 262          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q4R796|CASC1_MACFA (Protein CASC1 OS=Macaca fascicularis OX=9541 GN=CASC1 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.684e-43
Identity = 120/444 (27.03%), Postives = 199/444 (44.82%), Query Frame = 2
Query: 1136 VIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            ++DL  +T +GG++H++++ LPPQ K   GW M  +++   L  + Y   T                D  + N        PI V +++ ++VI  + P +  W+   K W+T+G+    YK +E+ +TF +  FG V + QD HINMP+QSW L+P                     +D    ++      TE++  ++ N       L ++++     + HI                + L   W T    I  ++ AG+NIFP   S  YV I  K P+ E   Y QM+LLS + AF WS+WN  C NS   +    EHL  E   N  +W++L F+  + ++LK+KE  E FS                     E LK             +  +FHS L+H   +F ++E M  V++ +  + N++ ++L + R L ++
Sbjct:  379 MVDLFQFTTLGGVYHLDILELPPQCKPVKGW-MIVEILKEGLQKYTYPPETT--------------EDFETEN-----AFPPIEVTLEVHENVIFFENPMVVRWDAEGKHWRTDGISNVSYKPNERLITFSLDTFGPVTLIQDAHINMPYQSWELRP---------------------LDVNKVLLTVTTVFTEIQIQIKEN-------LCMLSSVKLKDKKHI----------------SILEGTWMTPIPFIIALKEAGLNIFPTRYSHFYVVINNKVPLVEVKAYRQMALLSSTFAFGWSKWNLLC-NSTKVVFKVREHLPEECTEN-PNWALLMFSGDRAQRLKIKEESEAFS---------------------EALK-------------EETEFHSTLYHMVRDFASKEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS 722          

HSP 2 Score: 136.732 bits (343), Expect = 7.016e-32
Identity = 73/174 (41.95%), Postives = 109/174 (62.64%), Query Frame = 2
Query:  308 RFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSG 829
            R    W+ Y++CDGSPDPSI QE+NT+I+LW+E + N T E ++ +S + L LIE+L+F++ +    +     I +Y E+I +LQ LL  K + A+  +L +A+ +A+ +  N+EKV K + + L +W NL KNPR     F E  I   IP+ L  SDIA R+L+T YDH S 
Sbjct:   96 RMLSQWKHYIQCDGSPDPSIAQEMNTFISLWKE-KTNETFEEVIEKSKVVLNLIEKLKFILLETPLCDLQDKNIIQYQESILQLQELLHLKFNVATEILLRQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSA 268          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A183MEC9 (Casc1_N domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14404 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.096e-114
Identity = 262/813 (32.23%), Postives = 395/813 (48.59%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEASXXXXXXXXXXXXXXXXXILDQLNLMDELNKVGIDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVST-DMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDL-----------------EMANRLKNSDDHSID----------SKSAIIDEIVEKTEVEE-VLEYNADS---------------------------------KNQSLLVINAAVFDVRLHICDSRVRILFNDEHTE------------------------------------LNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            WERY +CD  P+P I  EINTYI+LW  DE++++IE +M + +   ++I EL  LI++  + +     + KY++ I +L+  + EK+DR+ +++L++A    +NE  NL+K+W                  + +F FPE+ I   IPK L LSD  F I + +YD+ S   + +   + P  KS+  E++ +     E                  +QLN  +++ ++ +++D  +++   E EE  + PPED IP PE   W   + EE  IDL +Y  +GG+    ++ LP QPK   GWT+T  V P KL PF Y V T + I    +S  +   R      ++K     PI V I+IP  +I+ ++P LA W+    +W+T G+ L  + +D+ T+ F  S FG + IFQDFHINMPFQ W L+P      DL                  + N    ++  SI           S  A+  E++     E  V+E+N +                                   NQ LL+I     ++RLHI   R+ IL ++  TE                                    LN L  KW+T+N+LI V++ +G+NIFPREDS+  +    KN + EE LY  M+LLSPS+AF WSRWNSEC +  T IV A EH+++E  V+E+ W V S TRKKV++L+MKEYDE+FS             LS   +                       FH++ +H Y +FG +EG   V+ +D  YF T+  LL+A R LVF+
Sbjct:    1 WERYFQCDDLPNPIIESEINTYISLWNSDEQHISIEDVMNDCIKSFKIINELNLLISELTDHDEDQLHLVKYNDMIHQLRQQIDEKLDRSIIDLLTKAIYYKDNETLNLQKIW------------------IKQFTFPEIDITFDIPKVLTLSDCVFLINFMKYDNYSFKCQSYYPCKLP--KSISGEMIQQNDTLIEE-----------------NQLN-ENKIEEILLNDDNSEKQQTTEMEEAFEIPPEDRIPTPESENWIKTDMEEDAIDLGDYHVIGGIIRFELLTLPRQPKTVKGWTITTCVKPPKLHPFEYIVDTSEEIKTESESVMEETPR-----KQEKKEERPPIQVKIRIPKSIIIVEDPLLARWDPEKLQWRTTGIQLIKFNEDDNTIVFNTSVFGTIAIFQDFHINMPFQYWELRPLPLRRNDLINTTLQSIHSDPINDPTNIKNSFTTNEHQSITMIKSTTPIMKSNKAMNQEVINAISPEPIVIEHNQNGITDKSKECIILGPVTTLGLSNDEYQSILQSSSITNQCLLIIMGGCIELRLHILGDRISILPSNPLTETIKGIGGDRSMVNGPNKGTNVTETNDTDLLKHSKRELNHLWGKWFTLNELITVLQQSGMNIFPREDSVSRIDCLNKNRLVEENLYQHMALLSPSMAFGWSRWNSECNDDHTIIVTAVEHIDHEDSVDEESWKVYSVTRKKVQQLEMKEYDEQFSP------------LSNPNQP----------------------FHADFYHMYMDFGCDEGKRRVEEIDLKYFKTVNKLLQATRLLVFS 736          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A3Q0KBE9 (Similar to cancer susceptibility candidate 1 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 3.363e-102
Identity = 264/835 (31.62%), Postives = 398/835 (47.66%), Query Frame = 2
Query:  221 LKKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVE---KSVIFEVVVEKTEASXXXXXXXXXXXXXXXXXILDQLNLMDELNKVG-----IDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVST-DMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDL----------EMANRLKNSDDHSI-----------------DSKSAIIDEIVEKTEVEE-VLEYN----------------------ADSKNQSLL-------------VINAAVFDVRLHICDSRVRILFNDEHTELN-ALANKWYTVNDLIKVMRTA-------------GINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            LK R  EL++ R L N    +L + E   R Q++W+RY +CD  P+P++  EINTYI+LW  +E+ ++IE +M + +   ++I+EL  LI+   + +    ++SKY++   EL+  +  K+DR+ +E L+RA   A++E  NL+K+W                  + +F F E+ +   IPK L LSD AF I + ++D+ S   + +   + P     +SVI EV+ +                        D LN  +  N+       +++D  +++   E EE  + PPED IP PEP  W   + EE  IDL +Y  +GG+    +V LP QPK   GWT+T  V P KL PF Y V T + I    +S  +   R      ++K     PI V I+IP  +I+ ++P LA W+    +W+T G+ L  + +D+ T+ F  S FG + IFQD+HINMPFQ W L+P      DL          ++ N   N  + +I                  S  A   E++  +  E  ++E+N                      ++ + QS+L              I     ++RLHI   R+ IL N   TE +  + +    VN   K +                GI  F  EDS+  +    KN + EE LY  M+LLSPS+AF WSRWNSEC +  T IV A EH+++E  V+E+ W V S TRKKV++L+MKEYDE+FS  I +  Q                                  FH++ +H Y +FG EEG   VK +D  Y  T+  LL+A R LVF+
Sbjct:   52 LKIRIEELKETRTLINEQNKRLQQLELQYRNQFTWKRYFQCDDLPNPTLENEINTYISLWNSNEQRLSIEDVMDDCMKSFKIIDELNLLISQLMDTDEDHKKLSKYNQMKHELRQQIYHKLDRSIIETLTRAIYYADHESLNLQKIW------------------IKQFTFTEIDLTFDIPKVLTLSDCAFLINFIKFDNYSFKCQSYYPCKLPKSIHTESVIHEVIQQD-----------------------DTLNEENPFNECKTEETLLNDDNGEKQQTNEVEEVFEIPPEDRIPTPEPENWIKADMEEDAIDLGDYHVIGGVIRFELVLLPRQPKTVKGWTITTCVKPPKLHPFEYVVDTSEEIKTENESVMEETPR-----KQEKKEERPPIQVKIRIPKCIIIVEDPLLARWDPEKLQWRTTGIQLIKFNEDDNTIVFSTSVFGTIAIFQDYHINMPFQYWELRPLPLRRNDLNNTTVQSIHSDITNTTTNVKNSTITNEQQSIPMVKSTTPIMKSNEATSKEVINGSSPESMIIEHNQNGITDKSKECIILGPVPTLGLSNDEYQSILQSSSSTTTNQCLLTIIGGCIELRLHILGDRISILPNTLATEKSIGIGSDSIMVNGSSKGINVTEKNDTDLLEHTKRGIKSFMGEDSVSRIECLNKNRLVEENLYQHMALLSPSMAFGWSRWNSECHDDHTIIVTAVEHVDHEDSVDEESWKVYSVTRKKVQQLEMKEYDEQFSP-ISNPNQ---------------------------------PFHADFYHMYMDFGCEEGKRWVKEIDLKYLKTVHKLLQATRLLVFS 806          
BLAST of GTP-binding protein vs. TrEMBL
Match: W5NE13 (Cancer susceptibility candidate 1 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.738e-99
Identity = 208/649 (32.05%), Postives = 336/649 (51.77%), Query Frame = 2
Query:  308 RFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVE-------------KTEASXXXXXXXXXXXXXXXXXILDQLNLMDELNKVGIDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDI 2215
            R +  W+RY++CDGSPDPS+PQEINTYINLWRE+  +V I  ++ +  + + LIEEL++L+ +  + E    ++ +Y E+I  LQ L+  K + A+ E+L  +  +A+ E  N+  V     + LCLW NL+KNPR    EF + G+   +PK L +SDIA RIL+T YDH S    H +   +P+ +  +                   +TEA+   +++  + K  D    L   +  +E + V    DE+ E   +   EE     ++          ED  +E+  +DL  +TP+GG+++ ++  LPPQ K   GWT+T ++    L PFPY +  +  L     S    +R+  S N      + P+ V I +PD V   ++PQ+A W+    +WKT+ +    Y  + K + F+M  F +  + QD ++NMPFQ W L+P  GL                                             N +L  + AA+ +V + I D +  +      + L+ +  KW T + LI+ MR+AG+NIF  E S +YVS+ EK+P  E+  YDQM+L+S + AF WS+WN+E +  +  ++  SEHL  + PV+E++WS+   + +K  +LK +EY E FS+++
Sbjct:   96 RAKEKWDRYMKCDGSPDPSVPQEINTYINLWREN-TDVEINCVLNQCALAINLIEELDYLLNETPSSELNEKEVLQYKESILNLQNLIYSKYNEATEEILKHSRDLADIETGNMRIVMTTVNVTLCLWANLSKNPRFRGLEFQDAGVAFELPKQLAVSDIAIRILHTHYDHLS----HLSRSLQPLARRALAGTGAASPAGGRVEEQDQGQTEAAHIPEDETRSVKSDDRKSALSTTSAKEESSSVEKKTDEDGESKPESHSEETVIDAQEETTGAPQEHEEDILEED-AVDLHQFTPLGGVYYYDVFRLPPQSKDIKGWTIT-ELSETGLQPFPYPLEQN--LPQTSGSAKSEERERESDNL----TSPPVGVTISLPDSVTFLEDPQVARWDGTGHQWKTDRISDVKYDKEAKKIYFKMDTFYIFTLMQDSYVNMPFQFWELRPL-GL---------------------------------------------NTALFTVTAAISEVEITIKDDKCMLNITASDSSLSQIRGKWMTPSALIRAMRSAGVNIFVDEYSDRYVSVNEKDPQLEQAAYDQMALVSSAYAFCWSQWNAE-QGKEHLVMQVSEHLKTD-PVSEEEWSLYLLSTQKAMRLKNREYYESFSTEL 683          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A4W4FXN1 (Cancer susceptibility candidate 1 OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 3.515e-90
Identity = 214/753 (28.42%), Postives = 348/753 (46.22%), Query Frame = 2
Query:  224 KKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKH--FNSRRKPVEKSVIFEVVVEKTEASXXXXXXXXXXXXXXXXXILDQ-LNLMDELNKVGIDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYV--IDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            ++R  EL + R L   ++  +   E   R    W+RY  CDGSP+P++  EIN +I+LW+ED     I+P++ +  M LRL +EL+ L+     EE   S    Y ET   LQ L+ +K+ +A+ E+L  A   ++ E  N++ V +   + LCLW NL KNPR    +F EVG+   +PK L+ SDI  R+L+T+YDH S  S+H   + RR    +     ++ +  E +E    + +  +  +     D+  +L  +  KV +    + +    + E   D P             E   D   V  +DL  YTP+GG+F+ ++  LPPQ    +GW M ++++   L  FPY      +         V  R      +   H + P+ V +++P+ V+  +EPQ+A W+   ++W+++GV  T Y+ +E +L+F+M+ F    + QD H NMPFQSW L+P                                                ++ + L I AA+ +V + +  +R  +L  +   EL  +  +W  +  L   MR +GIN+F  E S KYV +  K+P+ E   Y+QM+L+S + AFSWSRWN++C+     +VL         PV    WS+     ++  +LKM E                WS                    FS ++ +  +FHS   H   +  + EG   V +    Y NT++ LL + R L F+
Sbjct:   34 ERREDELNELRHLLEVNQSAVKAWEAACRESAKWDRYRLCDGSPNPAVQPEINAFISLWKEDPVG-QIQPLLQQCAMALRLTDELDLLV----REEPEPSVAQMYQETRLTLQNLIHDKLLQATEEILKSAKEQSDIETGNMQTVVRDDNVTLCLWANLNKNPRFKGHQFKEVGMGFELPKQLVTSDIGVRMLHTRYDHLSDLSRHARVHGRRPAATEVGTVTLLAQTPEVAEDGGMRVEGKERGNPQHAEDEPQSLRTQGKKVSLHASVQGQGREAQTETVTDRPTFPGEGA------ESVTDTTNVHVVDLHQYTPLGGVFYFDVFYLPPQSVTVNGWEM-RKLLDTGLLVFPYPSEQSHV------HSSVAGR----VEESGAHSSPPVGVTVRLPESVVFLEEPQVARWDPADQQWRSDGVSETCYQAEEHSLSFQMASFSAFTLLQDSHANMPFQSWELRPL----------------------------------------------GQDSAQLTITAALVEVSITVKGNRC-MLQMERARELTPILGRWMNLPALQAAMRRSGINMFVNEYSEKYVDVHAKDPLIEHTAYEQMALVSSAFAFSWSRWNAQCQQQH--LVLQVYEQLEAGPVPAKAWSLYLLGAQRSHRLKMTE----------------WSA------------------AFSPELAEGSEFHSTFLHMLRDGVSAEGWARVNHAHPLYINTVQALLCSTRVLTFS 681          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A3B4CGL2 (Cancer susceptibility candidate 1 OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 2.562e-89
Identity = 211/749 (28.17%), Postives = 352/749 (47.00%), Query Frame = 2
Query:  224 KKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSR-RKPVEKSVIFEVVVEKTEASXXXXXXXXXXXXXXXXXILDQLNLMDELNKVGIDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            ++R  EL + R +   +++ +   E   + +  W+RY+ CDGSP+P++  EINT+I+LW+E+ + V I+P++ +  + LRL +EL+ L+     EE   S    Y +T+  LQ L+  K  +A+ E+L  A   ++ E  N++ V +   + LCLW NL KNPR   ++F EVG+   +PK L +SDI  RIL+T YDH S  S+   ++ RKP  + V  E  + +T     D+E+        +++ L  L    E  KVG+ +      +     E I     D    P  +       E +V+DL+ YTP+GG+F+ ++  LPPQ    SGW M ++++   L  FPY      +  +     D    +             P+ V + +PD V+  +EPQ+  W+   + W+T+ +  T Y  + ++++F+M  F    + Q+ + NMPFQSW L+P                                                ++ +LL I  A+ +V + +  ++  +  +  H EL  L  KW + + L   MR AG+NIF  E S KYV +  K+P+ E  +Y+QM+L+S + AFSWS+WN++C   +  ++   EHL     V E  WS+     ++ + LKM                                   E   +FS ++ +  +FHS   H   +  + EG   V +    Y +T++ LL A R L F+
Sbjct:   40 ERREDELNELRFILEENQNAVNTWEATCKEKAKWDRYMLCDGSPNPAVQPEINTFISLWKENPE-VQIQPLLQQCALALRLTDELDLLL----REEPEPSVAQVYQDTLLSLQSLIHAKHLQATEEILKWAKACSDIETGNMQTVVQDDNITLCLWANLNKNPRFKGYQFKEVGLGFELPKQLAMSDIGVRILHTHYDHLSHLSQRAQAQMRKPAREEVNEETTLAETPKVLEDEEEEVRGSAGQAEDELQSLK--SERKKVGLQSCRRSVLSSMFLMEMIMLWLLDADSTPAVVEPVIDSTEVHVVDLQQYTPLGGVFYFDVFRLPPQSHTVSGWEM-RELLDTGLQVFPYPSEHSQVHSSVSGKLDENYTEF-----------PPVGVTVALPDTVVFLEEPQVVCWDPVGQHWRTDCITETSYNAEARSISFKMESFCAFTLLQETYANMPFQSWELRPL----------------------------------------------GQDSALLTITTALAEVSITVKGNQCMLHMDGVH-ELAHLLGKWMSFSALQTAMRRAGVNIFVNEYSDKYVIVNAKDPLIEHAVYEQMALVSSAFAFSWSKWNAQC-GQEHLVLQVCEHLEVGL-VPEKAWSLYLLGAQRTQHLKM----------------------------------TERSSEFSPELAEGTEFHSTFLHMLRDSMSLEGRARVGHSHHLYIHTVQRLLYATRVLTFS 686          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: casc1 (cancer susceptibility candidate 1 [Source:NCBI gene;Acc:566485])

HSP 1 Score: 195.282 bits (495), Expect = 3.279e-52
Identity = 120/446 (26.91%), Postives = 202/446 (45.29%), Query Frame = 2
Query: 1127 EEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVF 2464
            EE+V+DL+ YTP+GG+F+  +  LPPQ   A GW + +Q++   L  FPYQ    ++ +            V     D    +  + V + +PD VI   EPQ+A W+   + W+T+ ++ T Y  + ++++F M  F    + Q+ + NMPFQSW L+P                                                ++  L  +N A+ ++ + +  ++  +   D   EL  +  KW +++ L   MR AG+NIF  E S KYV++ +K+P+ E  +Y+QM+L+S S AFSWS+WN++C   +  ++   E L+   PV E+ WS+     ++ ++L + E  E                                   FS D+ +  +FHS L H   +  + EG   + +    Y NT++ LL A R L F
Sbjct:  348 EEHVVDLQKYTPLGGVFYFEVFHLPPQSYTARGWEI-RQLLDTGLQVFPYQSEPSLVQIA-----------VSGKQDDNSTQSGAVGVTVILPDSVIFLKEPQVARWDATGQHWRTDCIMDTSYSAETRSVSFRMESFSSFTLLQEIYANMPFQSWELRPL----------------------------------------------GQDSVLFTLNTALSELSITVKGNQCMLQMKDA-LELAHILGKWMSLSSLQTAMRRAGVNIFVNEYSDKYVTVNKKDPLIEHAVYEQMALVSSSYAFSWSQWNTQC-GQEHLVLQVCEQLSAS-PVPEEAWSLYLLGAQRSQRLNISERSE----------------------------------AFSLDLAEGTEFHSTLLHMLRDSMSPEGRARIDHSHFLYTNTVQKLLSATRVLTF 698          

HSP 2 Score: 141.354 bits (355), Expect = 2.513e-34
Identity = 75/201 (37.31%), Postives = 117/201 (58.21%), Query Frame = 2
Query:  224 KKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            ++R  EL + R     ++  +   E   R Q  W++Y+ CDG+P+P++  EINT+I+LW +D+  + I+PIM +  + LRL +EL  L+      ES   Q+  Y+ T+  LQ L+  K   A+ E+L+RA    +NE  N++ V +   + LCLW NL K PR   + F +VG+   +P+ L +SDIA R L+T YDH S
Sbjct:   36 ERREDELNELRFKLEENQSAVNTWEAASREQAEWDQYMLCDGNPNPAVQPEINTFISLW-QDDPELQIQPIMQQCALALRLTDELGLLLN--PELESAVEQV--YYSTLLSLQNLIHNKYLLATEEILNRAKACVDNETGNMQTVVQDDNITLCLWANLNKKPRFKGYHFKDVGLGFELPRQLAMSDIAVRFLHTNYDHLS 231          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000033394.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:24813424:24829399:-1 gene:ENSAMXG00000032132.1 transcript:ENSAMXT00000033394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 9.967e-48
Identity = 120/446 (26.91%), Postives = 199/446 (44.62%), Query Frame = 2
Query: 1127 EEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVF 2464
            EE+V+DL+ YT +GG+F+  +  LPPQ   A GW + +Q++   L  FPYQ     +      S   G +D  S     V V       + +PD VI   EPQ+A W+   + W+T+ ++ T Y  + ++++F M  F    + Q+ + NMPFQSW L+P                                                ++  L  +N A+ ++ + +  ++  +L   E  EL  +  KW ++  L   MR AG+NIF  E S KYV++ +K+P+ E  +Y+QM+L+S + AFSWS+WN++C   +  ++   E L    PV E+ WS+     ++ ++L + E  E F                                  S D+ +  +FH  L H   +  + EG   + +    Y +T++ LL A R L F
Sbjct:  328 EEHVVDLQKYTSLGGVFYFEVFHLPPQSYTARGWEI-RQLLDTGLQVFPYQSEPAQV-----HSAVSGKQDENSTQSGAVGV------TVVLPDSVIFLKEPQVARWDPIGQHWRTDCIMDTSYSAETRSVSFRMESFSSFTLLQEIYANMPFQSWELRPL----------------------------------------------CQDSVLFTLNTALTELSITVKGNQC-MLQMKEARELAHILGKWMSLTALQTAMRRAGVNIFVNEYSDKYVTVNKKDPLIEHAVYEQMALVSSTYAFSWSQWNTQC-GQEHLVLQVCEQLAAS-PVPEEAWSLYLLGAQRSQRLNISERSEAF----------------------------------SLDLAEGTEFHFTLLHMLRDSMSPEGRARIDHSHFLYTDTVQKLLSATRVLTF 678          

HSP 2 Score: 133.65 bits (335), Expect = 6.958e-32
Identity = 69/177 (38.98%), Postives = 106/177 (59.89%), Query Frame = 2
Query:  296 EKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            E   R +  W+RY+ CDG+P+P++  E+NT+I+LW +D+  + I+PIM +  + LRL +EL+ L+    N E   +    Y+ TI  LQ L+ +K   A+ E+L+       NE  N++ V +   + LCLW NL K PR   + F +VG+   +P+ L +SDIA RIL+T YDH S
Sbjct:   45 EAASREKAEWDRYMLCDGTPNPAVQPEVNTFISLW-QDDPELQIQPIMQQCALALRLTDELDLLL----NPELEPAVNQVYYSTILSLQNLIHKKYLLATEEILN-----VNNETGNMQTVVQDDNITLCLWANLNKKPRFKGYHFTDVGLGFELPRQLAMSDIAVRILHTNYDHLS 211          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003803.1 (pep scaffold:Pmarinus_7.0:GL484014:2287:7472:-1 gene:ENSPMAG00000003479.1 transcript:ENSPMAT00000003803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 8.565e-36
Identity = 66/178 (37.08%), Postives = 104/178 (58.43%), Query Frame = 2
Query:  287 IEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDH 820
            ++ +  RR    WERY+RCDG+PDPS  +EINT+++LW E      +   + E    L LIEELEF++ D  +       +S++  +I +LQ ++  K+D+ +  +L  A+  A+ E  NL+ V +   M L LW N+ KNPR   +EF + G+   +P+ L    +A RIL+T+YDH
Sbjct:   91 MQADSQRRASAQWERYMRCDGTPDPSEAKEINTFLSLWAESAPR-DVATALRECSTALDLIEELEFVLADTPDRVLNVQTVSRHRHSILQLQEIIASKLDQVTHHLLKCASKDADLETGNLQTVVESSFMTLMLWANVNKNPRFKGYEFADRGVGFELPRPLAACPVAVRILWTRYDH 267          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO43086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG1])

HSP 1 Score: 189.119 bits (479), Expect = 3.421e-51
Identity = 116/441 (26.30%), Postives = 203/441 (46.03%), Query Frame = 2
Query: 1145 LRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            LR +  VG + ++ +  LPPQPK    W M QQ+VP  L   PYQ   + + ++  +    G    +   +        +L   ++P+ V+  ++PQ+A WE   K W+ +G+    Y ++E+T++F+++ FG +   QD ++NMPFQSW ++P +                                              +N  L  + AA+ ++ + I D+   +   ++  +++    KW T  +LIK ++ AGIN+FP  D+ KYVSI +K+   E  +Y +M+LL+ SV FSWS+WN++    D  ++ A+E L  +  + E+DWS+   T +   KLK+KE                                   D +FS    D  Q HSNL+H   +  T E +  +K  +  + + +  LL A + + ++
Sbjct:  256 LRAFGVVGPIMNLELFELPPQPKHVKNWVM-QQIVPPNLVRVPYQTENETLPVHSATGSAPGTPGTVCTQR--------LLSIYRLPETVVYFEQPQIAHWEPVKKHWRIDGIDDIQYNEEERTVSFKIADFGPIATVQDLYLNMPFQSWEIRPCK----------------------------------------------QNSCLFTLIAAIIELEIEIKDALCCVTQPEDLAQIDHFKGKWMTPQELIKTLQRAGINVFPAVDAEKYVSINKKDSALETTIYKEMALLASSVGFSWSKWNAD-SGEDKIVLQAAEQLE-DDVILEEDWSLYLVTTRSSCKLKLKE----------------------------------EDSEFSETNADNTQLHSNLYHMIRDDTTPEALQRIKESNFLFVDCVYQLLSATKIITYS 605          

HSP 2 Score: 110.923 bits (276), Expect = 3.159e-25
Identity = 65/198 (32.83%), Postives = 114/198 (57.58%), Query Frame = 2
Query:  323 WERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSV-IFEVVVEKTEAS 913
            W+RY+ CDGSPDP +  E+NT+++L +++     ++ ++ E    L+L    E  I+D   ++    ++ ++ +++ +LQ LL   +DRA++ +L  A+   + E  NL+   + +  ILC+WGN+ KNPR+   +F      + IPKAL + +I+ R+L T YDH S  +K +      + K V + EVVVE  + S
Sbjct:    1 WDRYMLCDGSPDPLVEPELNTFLHLAKDESNQKPVKEVLQECEDILKL----EKYISDAIKDDVSDEELQQHKKSVTKLQELLNFVLDRATMHLLQNASEHIDPESQNLQFKCQSEHEILCMWGNIVKNPRLKCVKFDSHDFSVEIPKALAVGEISMRLLLTYYDHLSPLAKSY------LPKVVKLPEVVVEGPQES 188          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO28235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T718])

HSP 1 Score: 58.5362 bits (140), Expect = 2.411e-9
Identity = 30/107 (28.04%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 1244 VVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPIL-VNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQ 1561
            VVP  L   PYQ   + + ++  +    G     SA+   +  A P L +  ++P+ V+  ++PQ+A WE   K W+ +G+    Y ++E+T++F+++ FG +   Q
Sbjct:   14 VVPPNLVRVPYQTENETLPVHSATGSAPGTPG--SASATNLPAANPPLAIKFQLPETVVYFEQPQIAHWEPVKKHWRIDGIDDIQYNEEERTVSFKIADFGPIATVQ 118          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: casc1 (cancer susceptibility 1 [Source:NCBI gene;Acc:101158903])

HSP 1 Score: 126.331 bits (316), Expect = 6.851e-30
Identity = 96/361 (26.59%), Postives = 151/361 (41.83%), Query Frame = 2
Query: 1136 VIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRL--HICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSD 2212
            V+DL  Y+P+GG+F+  +  LPPQ  +         +V + L  FPY   T        SS D       S      HV     V++ +PD       P++ALW+            LT Y++ E  ++F M  F    + Q+ + N+PFQSW                                              E  A S N +L  I+ A+  + +  ++C     +L +D+   L  +  +W +   L + M  AG++IF  E + +YV    KNP  E   Y QM+LL+ + AFSWS+WN++C +         EHL  + P     WS+     ++V++L+  E  E FS D
Sbjct:  246 VVDLLKYSPLGGVFYYGVFHLPPQAHL---------IVDSGLKAFPYTAETS-------SSDD-------SEAPSDPHVG----VSVTLPDWARFLKTPKVALWDAAD---------LT-YQETEAKVSFRMPSFRPFVLMQETYANLPFQSW----------------------------------------------ELRALSDNSALFSISGALLHLSITENLC-----MLQSDQRKGLAHILGRWMSRAALQRAMTKAGLHIFVNEHTDRYVHTCRKNPTTEHAAYQQMALLASACAFSWSKWNTQCGD---------EHLVMQVPAGR--WSLYLLGAQRVQRLEATENSETFSLD 507          

HSP 2 Score: 97.8265 bits (242), Expect = 9.415e-21
Identity = 63/175 (36.00%), Postives = 95/175 (54.29%), Query Frame = 2
Query:  314 QYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTK-FEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDS 835
            Q  WERY+RCDG+PD +  + +NTYI+LWR+D + V I  ++ +    L   E    L      EE+      K  E+   LQ ++  K++ A+ E+L  A    + E  N++ V     + LCLW NL K  R+ K F F + G+   +PK+L + D+A  IL+T+YDH S  S
Sbjct:   77 QEKWERYMRCDGTPDLTERRHVNTYISLWRDDPE-VNISQVLQQCSCALLTEELEVLLEEVSDPEEA-----EKLQESFVNLQEIIHLKLNLAAEEILKAANKNIDPETENMQTVITDDNVTLCLWANLRK--RMFKGFHFEKAGLSFELPKSLAVKDVAIGILHTRYDHLSMGS 243          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: casc1 (cancer susceptibility 1 [Source:NCBI gene;Acc:101158903])

HSP 1 Score: 102.449 bits (254), Expect = 3.229e-22
Identity = 100/449 (22.27%), Postives = 168/449 (37.42%), Query Frame = 2
Query: 1136 VIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDS---RVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEK--NPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            V+DL  Y+P+GG+F+  +  LPPQ  +         +V + L  FPY ++                     + KDK   +             I A              W   GV+   Y++ E  ++F M  F    + Q+ + N+PFQSW L+                           A+ D                          N+A+F + +  C +    + +L +D+   L  +  +W +   L + M  AG++IF  E + +YV    K  NP  E   Y QM+LL+ + AFSWS+WN++C + +  ++   EHL     V    WS+     ++V++L+  E  E FS D                           D           +FHS L H   +  + +G    +     +   +++LL + RPL F+
Sbjct:  246 VVDLLKYSPLGGVFYYGVFHLPPQAHL---------IVDSGLKAFPYTMT--------------------PSEKDKDFTS-------------IYA-----------GTRW-VGGVMDLTYQETEAKVSFRMPSFRPFVLMQETYANLPFQSWELR---------------------------ALSD--------------------------NSALFSISVLCCRAPQENLCMLQSDQRKGLAHILGRWMSRAALQRAMTKAGLHIFVNEHTDRYVHTCRKVTNPTTEHAAYQQMALLASACAFSWSKWNTQCGD-EHLVMQVCEHLP-PTAVPAGRWSLYLLGAQRVQRLEATENSETFSLD------------------------HHPDS----------EFHSTLVHMLRDTMSPDGAARTRESGYRFVEAVQSLLCSTRPLRFS 551          

HSP 2 Score: 80.8777 bits (198), Expect = 2.233e-15
Identity = 50/152 (32.89%), Postives = 80/152 (52.63%), Query Frame = 2
Query:  371 QEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCS 826
            + +NTYI+LWR+D + V I  ++ +   CL ++ E          E S   +  K  E+   LQ ++  K++ A+ E+L  A    + E  N++ V     + LCLW NL K  R   F F + G+   +PK+L + D+A  IL+T+YDH S
Sbjct:   22 RHVNTYISLWRDDPE-VNISQVL-QQCSCLEVLLE----------EVSDPEEAEKLQESFVNLQEIIHLKLNLAAEEILKAANKNIDPETENMQTVITDDNVTLCLWANLRKRMRFKGFHFEKAGLSFELPKSLAVKDVAIGILHTRYDHLS 161          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: casc1 (cancer susceptibility 1 [Source:NCBI gene;Acc:101158903])

HSP 1 Score: 94.7449 bits (234), Expect = 7.170e-21
Identity = 93/409 (22.74%), Postives = 158/409 (38.63%), Query Frame = 2
Query: 1241 QVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            Q+V + L  FPY   T        SS D       S      HV     V++ +PD       P++ALW  ++K  KT           E  ++F M  F    + Q+ + N+PFQSW                                              E  A S N +L++   A  +   ++C     +L +D+   L  +  +W +   L + M  AG++IF  E + +YV    KNP  E   Y QM+LL+ + AFSWS+WN++C + +  ++ + +  N +   +E+  ++     ++V++L+  E  E FS D                           D           +FHS L H   +  + +G    +     +   +++LL + RPL F+
Sbjct:    3 QIVDSGLKAFPYTAETS-------SSDD-------SEAPSDPHVG----VSVTLPDWARFLKTPKVALW--DAKRTKTSPT--------EAKVSFRMPSFRPFVLMQETYANLPFQSW----------------------------------------------ELRALSDNSALVLCCRAPQE---NLC-----MLQSDQRKGLAHILGRWMSRAALQRAMTKAGLHIFVNEHTDRYVHTCRKNPTTEHAAYQQMALLASACAFSWSKWNTQCGD-EHLVIFSCKRTNKQ---DEEPAALYLLGAQRVQRLEATENSETFSLD------------------------HHPDS----------EFHSTLVHMLRDTMSPDGAARTRESGYRFVEAVQSLLCSTRPLRFS 291          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000065983.1 (SMESG000065983.1)

HSP 1 Score: 1344.72 bits (3479), Expect = 0.000e+0
Identity = 714/749 (95.33%), Postives = 714/749 (95.33%), Query Frame = 2
Query:  221 LKKRSIELEDFRVLKNFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEASXXXXXXXXXXXXXXXXXILDQLNLMDELNKVGIDNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 2467
            LKKRSIELEDFRVLK FHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEASETDKEKGDNDKEKDSDEILDQLNLMDELNKVGIDNDEEKEETVQEQEEEIDPPPEDLIPVPEPILWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDD                                  RIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA
Sbjct:   60 LKKRSIELEDFRVLKIFHEDKLIEDEKNRRFQYSWERYLRCDGSPDPSIPQEINTYINLWREDEKNVTIEPIMAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKIDRASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFPEVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFEVVVEKTEASETDKEKGDNDKEKDSDEILDQLNLMDELNKVGIDNDEEKEETVQEQEEEIDPPPEDLIPVPEPILWEDFEDEEYVIDLRNYTPVGGLFHINMVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDRDVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVVLTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEMANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAVFDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPREDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIVLASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDD----------------------------------RIQFHSNLHHFYEEFGTEEGMVAVKNVDSHYFNTLRNLLKAIRPLVFA 774          
The following BLAST results are available for this feature:
BLAST of GTP-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASC18.387e-4526.87cancer susceptibility 1 [Source:HGNC Symbol;Acc:HG... [more]
CASC12.745e-4426.87cancer susceptibility 1 [Source:HGNC Symbol;Acc:HG... [more]
CASC12.816e-4426.87cancer susceptibility 1 [Source:HGNC Symbol;Acc:HG... [more]
CASC12.992e-4426.87cancer susceptibility 1 [Source:HGNC Symbol;Acc:HG... [more]
CASC15.240e-4426.87cancer susceptibility 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GTP-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
casc11.111e-5427.87cancer susceptibility candidate 1 [Source:NCBI gen... [more]
casc18.260e-5427.68cancer susceptibility candidate 1 [Source:NCBI gen... [more]
casc18.391e-5427.68cancer susceptibility candidate 1 [Source:NCBI gen... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GTP-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Casc12.467e-3824.83cancer susceptibility candidate 1 [Source:MGI Symb... [more]
Casc11.874e-2925.70cancer susceptibility candidate 1 [Source:MGI Symb... [more]
Casc13.348e-2938.15cancer susceptibility candidate 1 [Source:MGI Symb... [more]
back to top
BLAST of GTP-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8T880|AXP83_CIOIN1.066e-5733.24Axonemal 84 kDa protein OS=Ciona intestinalis OX=7... [more]
sp|A6H8T2|CASC1_DANRE3.773e-5328.09Protein CASC1 OS=Danio rerio OX=7955 GN=casc1 PE=2... [more]
sp|Q29RU8|CASC1_BOVIN1.094e-4727.27Protein CASC1 OS=Bos taurus OX=9913 GN=CASC1 PE=2 ... [more]
sp|Q6TDU7|CASC1_HUMAN1.437e-4326.87Protein CASC1 OS=Homo sapiens OX=9606 GN=CASC1 PE=... [more]
sp|Q4R796|CASC1_MACFA2.684e-4327.03Protein CASC1 OS=Macaca fascicularis OX=9541 GN=CA... [more]
back to top
BLAST of GTP-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183MEC92.096e-11432.23Casc1_N domain-containing protein OS=Schistosoma m... [more]
A0A3Q0KBE93.363e-10231.62Similar to cancer susceptibility candidate 1 OS=Sc... [more]
W5NE131.738e-9932.05Cancer susceptibility candidate 1 OS=Lepisosteus o... [more]
A0A4W4FXN13.515e-9028.42Cancer susceptibility candidate 1 OS=Electrophorus... [more]
A0A3B4CGL22.562e-8928.17Cancer susceptibility candidate 1 OS=Pygocentrus n... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
casc13.279e-5226.91cancer susceptibility candidate 1 [Source:NCBI gen... [more]
ENSAMXT00000033394.19.967e-4826.91pep primary_assembly:Astyanax_mexicanus-2.0:24:248... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003803.18.565e-3637.08pep scaffold:Pmarinus_7.0:GL484014:2287:7472:-1 ge... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GTP-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430863.421e-5126.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282352.411e-928.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
casc16.851e-3026.59cancer susceptibility 1 [Source:NCBI gene;Acc:1011... [more]
casc13.229e-2222.27cancer susceptibility 1 [Source:NCBI gene;Acc:1011... [more]
casc17.170e-2122.74cancer susceptibility 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of GTP-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065983.10.000e+095.33SMESG000065983.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007993 ID=SMED30007993|Name=GTP-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2499bp
CGGGAATCTTGATTTTACTAATTTTATTTCAATTAATTATTCTTTCTAGC
CGAAAAAGAAATTAAGCAAAAAAGAAATAGATAGAAAGAAAAAAGAAGAG
GAAGATCGAAAGCACCAAGAAGAAGAAGAAGCTAGAATTAAAGCTGAACA
AGAAGAAAAGGAAAGAATTATCAGGGAAAAGATTGAAGCAGAAGAAAGAA
AAAAAATAGAAAAACAGGAGTTGAAAAAACGATCAATAGAGCTAGAAGAT
TTTCGCGTACTTAAAAATTTCCATGAAGATAAATTGATTGAAGATGAAAA
AAATCGTCGTTTTCAATATTCGTGGGAAAGATACCTTCGATGTGATGGAT
CTCCTGATCCCAGTATTCCACAAGAAATCAACACTTATATCAATTTGTGG
AGAGAGGATGAAAAGAATGTTACCATTGAACCGATTATGGCAGAAAGCCT
AATGTGCTTGAGATTAATTGAAGAATTAGAATTTCTTATAACAGATTACA
AAAATGAAGAATCCTTTGCCTCCCAAATTTCTAAATATCATGAAACAATT
AAAGAACTTCAAATTTTATTGCAAGAAAAAATTGACCGCGCTAGTTTGGA
AATGTTGTCTCGAGCGACGATCATAGCTGAAAACGAAATGTCAAATTTAG
AAAAGGTGTGGAAATATCAGAAAATGATTCTTTGTCTCTGGGGCAATTTA
ACGAAAAATCCTAGAGTAACTAAATTTGAATTCCCTGAAGTTGGGATACA
TATTTCCATTCCAAAAGCGCTTATTCTATCAGATATAGCATTTAGAATTT
TATATACCCAATATGATCACTGTTCGGGAGATTCTAAACATTTCAATTCA
CGAAGGAAACCGGTTGAAAAATCTGTGATTTTCGAAGTTGTAGTGGAAAA
AACGGAAGCATCTGAAACTGATAAGGAAAAAGGAGACAATGACAAAGAGA
AAGATTCCGATGAAATACTTGATCAATTAAATCTAATGGATGAACTTAAT
AAAGTTGGTATTGATAATGACGAAGAAAAGGAAGAAACAGTTCAAGAGCA
AGAAGAAGAAATTGATCCACCTCCTGAAGATTTAATACCTGTACCAGAAC
CTATCTTATGGGAGGATTTTGAAGATGAAGAATATGTGATCGACTTGAGA
AATTACACTCCAGTTGGAGGTTTGTTTCATATAAATATGGTATGCTTGCC
TCCTCAACCAAAAATTGCAAGTGGATGGACAATGACCCAACAGGTTGTAC
CTGCAAAATTGTCACCGTTTCCTTATCAGGTTTCTACTGATATGATACTT
ATGAACAGGCAAAGTTCCTTCGATGTCGGAGACAGAGATGTTCTGAGTGC
TAATAAAGACAAAGTTCACGTAGCCAGACCAATTCTTGTGAATATAAAAA
TTCCAGACGATGTAATATTAGCGGATGAACCTCAACTTGCATTGTGGGAA
ACCAATTCCAAGGAATGGAAAACTGAAGGGGTTGTCCTTACGGGCTATAA
AGATGATGAAAAGACTTTAACATTTGAAATGTCACAGTTTGGAGTTGTTG
GGATTTTTCAGGATTTCCATATCAATATGCCATTCCAGTCCTGGTGTCTT
AAACCGTACAGAGGCTTGGTTTTTGACTTAGAGATGGCGAATCGGTTGAA
GAATTCTGATGATCACAGTATTGATTCAAAGTCAGCAATAATAGATGAAA
TTGTCGAAAAAACCGAAGTCGAAGAAGTATTGGAATATAATGCTGATTCG
AAAAATCAAAGTTTATTGGTTATTAACGCAGCGGTATTTGACGTAAGACT
GCATATTTGCGACAGTCGAGTAAGAATCCTATTCAACGACGAGCATACCG
AACTAAATGCACTGGCTAATAAATGGTATACGGTTAATGATTTGATAAAA
GTAATGAGAACCGCCGGAATTAACATCTTTCCTAGAGAAGACTCAATGAA
ATATGTTTCAATCACTGAAAAAAATCCAGTTGCGGAGGAAATGCTTTACG
ATCAAATGTCGTTGCTTAGTCCAAGTGTAGCTTTTAGTTGGTCGAGATGG
AATTCAGAATGTAAAAATTCCGATACTTGCATCGTTCTTGCTAGTGAACA
TCTCAACTATGAAAGGCCAGTTAATGAGGACGATTGGAGTGTTTTGTCTT
TTACTAGGAAAAAGGTGGAGAAATTGAAAATGAAGGAATATGATGAGAAA
TTCTCATCCGATATAGATGATAGAATTCAGGACGATTGGAGTGTTTTGTC
TTTTACTAGGAAAAAGGTGGAGAAATTGAAAATGAAGGAATATGATGAGA
AATTCTCATCCGATATAGATGATAGAATTCAGTTCCATTCCAATTTACAT
CATTTCTATGAAGAATTTGGAACGGAGGAAGGAATGGTGGCAGTAAAAAA
TGTCGACTCGCATTATTTCAATACTTTGAGAAATTTATTAAAGGCTATCA
GACCATTAGTTTTTGCATAGTTCTTTGGGATTTGTATTGTTATTAAATA
back to top

protein sequence of SMED30007993-orf-1

>SMED30007993-orf-1 ID=SMED30007993-orf-1|Name=SMED30007993-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=678bp
MAESLMCLRLIEELEFLITDYKNEESFASQISKYHETIKELQILLQEKID
RASLEMLSRATIIAENEMSNLEKVWKYQKMILCLWGNLTKNPRVTKFEFP
EVGIHISIPKALILSDIAFRILYTQYDHCSGDSKHFNSRRKPVEKSVIFE
VVVEKTEASETDKEKGDNDKEKDSDEILDQLNLMDELNKVGIDNDEEKEE
TVQEQEEEIDPPPEDLIPVPEPILWEDFEDEEYVIDLRNYTPVGGLFHIN
MVCLPPQPKIASGWTMTQQVVPAKLSPFPYQVSTDMILMNRQSSFDVGDR
DVLSANKDKVHVARPILVNIKIPDDVILADEPQLALWETNSKEWKTEGVV
LTGYKDDEKTLTFEMSQFGVVGIFQDFHINMPFQSWCLKPYRGLVFDLEM
ANRLKNSDDHSIDSKSAIIDEIVEKTEVEEVLEYNADSKNQSLLVINAAV
FDVRLHICDSRVRILFNDEHTELNALANKWYTVNDLIKVMRTAGINIFPR
EDSMKYVSITEKNPVAEEMLYDQMSLLSPSVAFSWSRWNSECKNSDTCIV
LASEHLNYERPVNEDDWSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQDD
WSVLSFTRKKVEKLKMKEYDEKFSSDIDDRIQFHSNLHHFYEEFGTEEGM
VAVKNVDSHYFNTLRNLLKAIRPLVFA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0008017microtubule binding
GO:0048487beta-tubulin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR023247Casc1
IPR031826Casc1_N
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement