FH2 domain-containing protein

Overview
NameFH2 domain-containing protein
Smed IDSMED30007990
Length (bp)4064
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FH2 domain-containing protein (SMED30007990) t-SNE clustered cells

Violin plots show distribution of expression levels for FH2 domain-containing protein (SMED30007990) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FH2 domain-containing protein (SMED30007990) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FH2 domain-containing protein (SMED30007990) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007990

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007990SMESG000034094.1 SmedASXL_014879SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30007990SMESG000034094.1 SmedASXL_014879SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007990SMESG000034094.1 dd_Smed_v4_15344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007990SMESG000034094.1 dd_Smed_v4_15344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007990SMESG000034094.1 dd_Smed_v4_15344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007990SMESG000034094.1 dd_Smed_v4_15344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007990SMESG000034095.1 SMESG000034094.1 Contig45373newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007990SMESG000034095.1 SMESG000034094.1 Contig45373uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007990SMESG000034094.1 dd_Smed_v6_15344_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynx musculatureSMED30007990SMESG000034094.1 dd_Smed_v4_15344_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v6_414_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v6_414_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007990SMESG000034095.1 SMESG000034094.1 dd_Smed_v4_414_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FH2 domain-containing protein vs. Ensembl Human
Match: FMN1 (formin 1 [Source:HGNC Symbol;Acc:HGNC:3768])

HSP 1 Score: 73.9442 bits (180), Expect = 1.748e-12
Identity = 61/252 (24.21%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSD------ISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRA-------FFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA++            K ED +K +  + R + +  +Q   V        +  +  KL +  +KA+ E  + + H+   +K F    + F  K  S          F  W +F  + K +W
Sbjct:  904 FLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDF-FLASQ-----------VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIW 1143          
BLAST of FH2 domain-containing protein vs. Ensembl Human
Match: FMN1 (formin 1 [Source:HGNC Symbol;Acc:HGNC:3768])

HSP 1 Score: 73.559 bits (179), Expect = 2.060e-12
Identity = 60/252 (23.81%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSD------ISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA++            K ED +K +  + R + +  +Q   V        +  +  KL +  +KA+ E  + + H+   +K F    + F  K       +     F  W +F  + K +W
Sbjct:  549 FLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDF-FLASQ-----------VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIW 788          
BLAST of FH2 domain-containing protein vs. Ensembl Human
Match: FMN1 (formin 1 [Source:HGNC Symbol;Acc:HGNC:3768])

HSP 1 Score: 73.1738 bits (178), Expect = 3.966e-12
Identity = 61/252 (24.21%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSD------ISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRA-------FFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA++            K ED +K +  + R + +  +Q   V        +  +  KL +  +KA+ E  + + H+   +K F    + F  K  S          F  W +F  + K +W
Sbjct: 1029 FLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDF-FLASQ-----------VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIW 1268          
BLAST of FH2 domain-containing protein vs. Ensembl Human
Match: FMN1 (formin 1 [Source:HGNC Symbol;Acc:HGNC:3768])

HSP 1 Score: 72.7886 bits (177), Expect = 4.258e-12
Identity = 61/252 (24.21%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSD------ISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRA-------FFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA++            K ED +K +  + R + +  +Q   V        +  +  KL +  +KA+ E  + + H+   +K F    + F  K  S          F  W +F  + K +W
Sbjct: 1127 FLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDF-FLASQ-----------VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIW 1366          
BLAST of FH2 domain-containing protein vs. Ensembl Human
Match: FMN2 (formin 2 [Source:HGNC Symbol;Acc:HGNC:14074])

HSP 1 Score: 62.7734 bits (151), Expect = 5.395e-9
Identity = 66/281 (23.49%), Postives = 118/281 (41.99%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSR--QTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK-NIISAQRSQKDS---FNKQNLKPIGKVIPR 3954
            F  EL+ IP+  E+V  +       ESI     K+     +   L+N   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS ++  Y+  + +        FPLPEP DL      +M  +   KD  K++  +K+      C +   +  Q  S   +  +   +   I +A+++    +  +T+  K F      F  K       V+  AFF+ W +F+ + K  W K N +  Q   K++     ++  K + K+ PR
Sbjct: 1437 FLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDL--FQASQMKFEDFQKDLRKLKKDLKA------CEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPR 1709          
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Match: CU695215.3 (formin-like [Source:NCBI gene;Acc:103909278])

HSP 1 Score: 77.7962 bits (190), Expect = 1.670e-14
Identity = 73/297 (24.58%), Postives = 124/297 (41.75%), Query Frame = 1
Query: 3193 LEEKVQFLYLYKIHIESIQRFDFKIHQFSF--------------------VSHFLENSESLDNILSLVMEICNIKSTNC----QNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLS-FPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSV------SDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRA-------FFNQWLDFAQELKVLWIKN--IISAQRSQKDSFNKQNLKPIGKVIPRRPN 3963
            L++  QFLY     +  I  F  ++H F F                    V  FL   +S   ++ LV+ + N  +       Q     LE+L +LK++  + +  S+L  ++  Y+H ++  N G   S FPLPEP D  +  + ++  D LSKD  K          + R +  C +   +V        I  +  K+   I  AQ EL+ ++  +    K FS+L + F  K  S          F  W +F  + K+ W +   +IS QR ++   + +N+    K+  RR +
Sbjct:   49 LDKPEQFLY----ELSQIPEFSSRVHCFIFQTKFTDAVASIQRKTEIIHHVCKFLLEKDSTREVMGLVLALGNYMNGGSRARGQADGFGLEILPKLKDVKSRENHISLLDYIVSYYLH-HLDKNAGTEKSIFPLPEPQD--VFLSSQVKFDDLSKDLRK----------LGRDLTVCEKDVLTVCTNSSQEHIHPFQEKMDFFIASAQKELITMEHQVVSARKSFSDLVEYFGLKPRSGEQEVVPGNVFTLWFEFCNDFKIRWKRENKVISKQRLKEAQQSVRNMTAEKKIETRRAH 328          
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Match: fmn2a (formin 2a [Source:ZFIN;Acc:ZDB-GENE-101107-1])

HSP 1 Score: 74.7146 bits (182), Expect = 8.731e-13
Identity = 61/252 (24.21%), Postives = 111/252 (44.05%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F  +L+ +P    +V  +       E +     K+     V   L++ +++  IL LV+   NI      +  Q     L++L +LK++    +  S+LS ++  Y+  + +     + ++PLPEP DL      +M  +   +D  K+    K +N       +CS +   V +IS       +  K+ D + KA+ EL L ++ +T  ++ F  L   FS K       V+   FF  W +F+ + K LW
Sbjct: 1180 FLLQLSEVPQFSGRVFCILFQSTFTECVTSVQRKLETLGRVCTALQSGQAVLQILGLVLAFGNIMNGGNRSRGQADGFSLDILPKLKDVKSSDNSQSLLSYIVAYYLRHFDEDAGKETCTYPLPEPQDL--FQASQMKFEDFQRDLRKLR---KDLN-------ACSAEREKVCNISSDEHLQPFKDKMDDFLTKAKTELELQEKQLTDTQRIFLELSVFFSVKPKAGEKEVSPNTFFTVWHEFSSDFKELW 1419          
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Match: fmn2a (formin 2a [Source:ZFIN;Acc:ZDB-GENE-101107-1])

HSP 1 Score: 72.0182 bits (175), Expect = 1.610e-12
Identity = 61/252 (24.21%), Postives = 111/252 (44.05%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F  +L+ +P    +V  +       E +     K+     V   L++ +++  IL LV+   NI      +  Q     L++L +LK++    +  S+LS ++  Y+  + +     + ++PLPEP DL      +M  +   +D  K+    K +N       +CS +   V +IS       +  K+ D + KA+ EL L ++ +T  ++ F  L   FS K       V+   FF  W +F+ + K LW
Sbjct:   49 FLLQLSEVPQFSGRVFCILFQSTFTECVTSVQRKLETLGRVCTALQSGQAVLQILGLVLAFGNIMNGGNRSRGQADGFSLDILPKLKDVKSSDNSQSLLSYIVAYYLRHFDEDAGKETCTYPLPEPQDL--FQASQMKFEDFQRDLRKLR---KDLN-------ACSAEREKVCNISSDEHLQPFKDKMDDFLTKAKTELELQEKQLTDTQRIFLELSVFFSVKPKAGEKEVSPNTFFTVWHEFSSDFKELW 288          
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Match: fmn2b (formin 2b [Source:ZFIN;Acc:ZDB-GENE-080225-35])

HSP 1 Score: 60.8474 bits (146), Expect = 1.255e-8
Identity = 54/248 (21.77%), Postives = 105/248 (42.34%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNS-------RAFFNQWLDFAQELKVLWIK 3873
            F ++L+ IP+   +V  +       E I     K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+L+ ++  Y+  + +     +  FPLPEP+DL      +M  +  +KD  ++   +++       + S S +      +  +  K+   + +A+ EL   ++ ++   K F +L   FS K  S         FF+ W +F  + K  W K
Sbjct: 1194 FLHQLSQIPNFSGRVFCILFQSTFSECITSVQRKLQILQKVCKTLQSGSGVLQVLGLVLAFGNFMNGGNRTRGQADGFTLDILPKLKDVKSSDNSKSLLAYIVSYYLRHFDEDAGRETCVFPLPEPHDL--FQASQMKFEDFTKDLLRLRKDLRACTAEVEKVCSVSTE----EHLQPFKEKMEAFVTEAKTELEGQEKQLSDTHKLFLDLCVFFSVKAKSGEKEVSPNTFFSVWHEFCTDFKDTWKK 1435          
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Match: fmn2b (formin 2b [Source:ZFIN;Acc:ZDB-GENE-080225-35])

HSP 1 Score: 60.8474 bits (146), Expect = 1.305e-8
Identity = 54/248 (21.77%), Postives = 105/248 (42.34%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNS-------RAFFNQWLDFAQELKVLWIK 3873
            F ++L+ IP+   +V  +       E I     K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+L+ ++  Y+  + +     +  FPLPEP+DL      +M  +  +KD  ++   +++       + S S +      +  +  K+   + +A+ EL   ++ ++   K F +L   FS K  S         FF+ W +F  + K  W K
Sbjct: 1169 FLHQLSQIPNFSGRVFCILFQSTFSECITSVQRKLQILQKVCKTLQSGSGVLQVLGLVLAFGNFMNGGNRTRGQADGFTLDILPKLKDVKSSDNSKSLLAYIVSYYLRHFDEDAGRETCVFPLPEPHDL--FQASQMKFEDFTKDLLRLRKDLRACTAEVEKVCSVSTEEH----LQPFKEKMEAFVTEAKTELEGQEKQLSDTHKLFLDLCVFFSVKAKSGEKEVSPNTFFSVWHEFCTDFKDTWKK 1410          
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Match: itgb3 (integrin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-1009964])

HSP 1 Score: 70.0922 bits (170), Expect = 3.211e-11
Identity = 79/353 (22.38%), Postives = 148/353 (41.93%), Query Frame = 1
Query: 3034 DIQIPIENIDINLL--------------KEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK--NIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQENSI 4011
            DIQ  I N+D +++              KE  E+I K+ + S+  D K  + +    F  EL+ IP+  E+ Q +    + +E I     K+   S     L    S+ +I+ L++   N       T  Q     LE+L +LK++  + +  S++  V+  Y+  + Q        FPLPE  DL  L   ++  + L KD  K++  ++      + ++  S +     +I  +  K+   + KA+ E    +  +T+ + +F      F  K       +   +FF  W +F  + K +W +   ++S +R ++   +   L    KV  R+ N    L      +E S+
Sbjct: 1056 DIQQAILNVDNSVVDIETLEALYENRAQKEEMEIIKKHYQTSKAEDVK--LLDKPEQFLYELSQIPNFVERSQCIIFQSVFLEGISSVRRKVDIISRACDCLLERVSVRDIIGLILAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNKASLVDYVVRYYLRYFDQDAGTDKSVFPLPESQDL--LLASQVKFEDLDKDLRKLKKDIEVCEKQLKAVVKDSPK----ENIQPFKDKMSSFLNKAKEEYKTEESKLTRSQNRFEETIGYFGCKPKGNDKEITPNSFFVLWYEFCGDFKSVWKRESKVLSTERLRQAQESVNKLTAEKKVETRKINPAASLKEKLRQKEASV 1400          
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Match: itgb3 (integrin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-1009964])

HSP 1 Score: 69.707 bits (169), Expect = 3.447e-11
Identity = 77/333 (23.12%), Postives = 141/333 (42.34%), Query Frame = 1
Query: 3034 DIQIPIENIDINLL--------------KEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK--NIISAQRSQKDSFNKQNLKPIGKVIP 3951
            DIQ  I N+D +++              KE  E+I K+ + S+  D K  + +    F  EL+ IP+  E+ Q +    + +E I     K+   S     L    S+ +I+ L++   N       T  Q     LE+L +LK++  + +  S++  V+  Y+  + Q        FPLPE  DL  L   ++  + L KD  K++  ++      + ++  S +     +I  +  K+   + KA+ E    +  +T+ + +F      F  K       +   +FF  W +F  + K +W +   ++S +R     F     +  GKVIP
Sbjct:  928 DIQQAILNVDNSVVDIETLEALYENRAQKEEMEIIKKHYQTSKAEDVK--LLDKPEQFLYELSQIPNFVERSQCIIFQSVFLEGISSVRRKVDIISRACDCLLERVSVRDIIGLILAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNKASLVDYVVRYYLRYFDQDAGTDKSVFPLPESQDL--LLASQVKFEDLDKDLRKLKKDIEVCEKQLKAVVKDSPK----ENIQPFKDKMSSFLNKAKEEYKTEESKLTRSQNRFEETIGYFGCKPKGNDKEITPNSFFVLWYEFCGDFKSVWKRESKVLSTERRLCFLFGSNGHQ--GKVIP 1250          
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Match: itgb3 (integrin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-1009964])

HSP 1 Score: 69.3218 bits (168), Expect = 5.065e-11
Identity = 86/356 (24.16%), Postives = 155/356 (43.54%), Query Frame = 1
Query: 3034 DIQIPIENIDINLL--------------KEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLS-FPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK--NIISAQ--RSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQENSI 4011
            DIQ  I N+D +++              KE  E+I K+ + S+  D K  + +    F  EL+ IP+  E+ Q +    + +E I     K+   S     L    S+ +I+ L++   N       T  Q     LE+L +LK++  + +  S++  V+ RY   Y   + G   S FPLPE  DL +LA+ ++  + L KD  K++  ++      + ++  S +     +I  +  K+   + KA+ E    +  +T+ + +F      F  K       +   +FF  W +F  + K +W +   ++S +  R  ++S NK  L    KV  R+ N    L      +E S+
Sbjct:  928 DIQQAILNVDNSVVDIETLEALYENRAQKEEMEIIKKHYQTSKAEDVK--LLDKPEQFLYELSQIPNFVERSQCIIFQSVFLEGISSVRRKVDIISRACDCLLERVSVRDIIGLILAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNKASLVDYVV-RYYLRYFDQDAGTDKSVFPLPESQDL-LLAS-QVKFEDLDKDLRKLKKDIEVCEKQLKAVVKDSPK----ENIQPFKDKMSSFLNKAKEEYKTEESKLTRSQNRFEETIGYFGCKPKGNDKEITPNSFFVLWYEFCGDFKSVWKRESKVLSTERLRQAQESVNK--LTAEKKVETRKINPAASLKEKLRQKEASV 1272          
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Match: itgb3 (integrin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-1009964])

HSP 1 Score: 62.7734 bits (151), Expect = 5.397e-9
Identity = 77/344 (22.38%), Postives = 142/344 (41.28%), Query Frame = 1
Query: 3034 DIQIPIENIDINLL--------------KEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK--NIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNT 3984
            DIQ  I N+D +++              KE  E+I K+ + S+  D K  + +    F  EL+ IP+  E+ Q +    + +E I     K+   S     L    S+ +I+ L++   N       T  Q     LE+L +LK++  + +  S++  V+  Y+  + Q        FPLPE  DL  L   ++  + L KD  K++  ++      + ++  S +     +I  +  K+   + K ++   L  +  T    +F      F  K       +   +FF  W +F  + K +W +   ++S +R ++   +   L    KV  R+ N    L T
Sbjct:  941 DIQQAILNVDNSVVDIETLEALYENRAQKEEMEIIKKHYQTSKAEDVK--LLDKPEQFLYELSQIPNFVERSQCIIFQSVFLEGISSVRRKVDIISRACDCLLERVSVRDIIGLILAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNKASLVDYVVRYYLRYFDQDAGTDKSVFPLPESQDL--LLASQVKFEDLDKDLRKLKKDIEVCEKQLKAVVKDSPK----ENIQPFKDKMSSFLNKGEISGFLFADK-TSITLRFEETIGYFGCKPKGNDKEITPNSFFVLWYEFCGDFKSVWKRESKVLSTERLRQAQESVNKLTAEKKVETRKINPAASLVT 1275          
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Match: itgb3 (integrin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-1009964])

HSP 1 Score: 58.9214 bits (141), Expect = 6.797e-8
Identity = 67/307 (21.82%), Postives = 130/307 (42.35%), Query Frame = 1
Query: 3034 DIQIPIENIDINLL--------------KEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRAFFNQWLDFAQELKVLWIK--NIISAQR 3894
            DIQ  I N+D +++              KE  E+I K+ + S+  D K  + +    F  EL+ IP+  E+ Q +    + +E I     K+     +S  L    S+ +I+ L++   N       T  Q     LE+L +LK++  + +  S++  V+  Y+  + Q        FPLPE  DL  L   ++  + L KD  K++  ++      + ++  S +     +I  +  K+   + K ++   +  E        F    +    ++   +FF  W +F  + K +W +   ++S +R
Sbjct:  890 DIQQAILNVDNSVVDIETLEALYENRAQKEEMEIIKKHYQTSKAEDVK--LLDKPEQFLYELSQIPNFVERSQCIIFQSVFLEGISSVRRKV---DIISRCLLERVSVRDIIGLILAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNKASLVDYVVRYYLRYFDQDAGTDKSVFPLPESQDL--LLASQVKFEDLDKDLRKLKKDIEVCEKQLKAVVKDSPK----ENIQPFKDKMSSFLNKGEISAWMEFEETIGY---FGCKPKGNDKEITPNSFFVLWYEFCGDFKSVWKRESKVLSTER 1182          
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Match: Fmn1 (formin 1 [Source:MGI Symbol;Acc:MGI:101815])

HSP 1 Score: 78.1814 bits (191), Expect = 7.809e-14
Identity = 60/246 (24.39%), Postives = 109/246 (44.31%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA+ ++  + L KD  K++  +++     + +   S + +    +  +  KL +  KKA+ E  + + H+   +K F      F  K       V     F  W +F  + K +W
Sbjct:  912 FLHELAQIPNFAERAQCIIFRAVFSEGITSLHRKVEIVTRASKGLLHMKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGMNLVDYVVKYYLRYYDQEAGTDKSVFPLPEPQDF-FLAS-QVKFEDLLKDLRKLKRQLEASEQQMKLVCKESPREY----LQPFKDKLEEFFKKAKKEHKMEESHLENAQKSFETTVGYFGMKPKTGEKEVTPSYVFMVWFEFCSDFKTIW 1151          
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Match: Fmn1 (formin 1 [Source:MGI Symbol;Acc:MGI:101815])

HSP 1 Score: 77.7962 bits (190), Expect = 8.223e-14
Identity = 58/246 (23.58%), Postives = 108/246 (43.90%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D  + +  ++  + L KD  K++  +++     + +   S + +    +  +  KL +  KKA+ E  + + H+   +K F      F  K       V     F  W +F  + K +W
Sbjct:  558 FLHELAQIPNFAERAQCIIFRAVFSEGITSLHRKVEIVTRASKGLLHMKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGMNLVDYVVKYYLRYYDQEAGTDKSVFPLPEPQDFFLAS--QVKFEDLLKDLRKLKRQLEASEQQMKLVCKESPREY----LQPFKDKLEEFFKKAKKEHKMEESHLENAQKSFETTVGYFGMKPKTGEKEVTPSYVFMVWFEFCSDFKTIW 797          
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Match: Fmn1 (formin 1 [Source:MGI Symbol;Acc:MGI:101815])

HSP 1 Score: 77.411 bits (189), Expect = 1.433e-13
Identity = 60/246 (24.39%), Postives = 109/246 (44.31%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA+ ++  + L KD  K++  +++     + +   S + +    +  +  KL +  KKA+ E  + + H+   +K F      F  K       V     F  W +F  + K +W
Sbjct: 1138 FLHELAQIPNFAERAQCIIFRAVFSEGITSLHRKVEIVTRASKGLLHMKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGMNLVDYVVKYYLRYYDQEAGTDKSVFPLPEPQDF-FLAS-QVKFEDLLKDLRKLKRQLEASEQQMKLVCKESPREY----LQPFKDKLEEFFKKAKKEHKMEESHLENAQKSFETTVGYFGMKPKTGEKEVTPSYVFMVWFEFCSDFKTIW 1377          
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Match: Fmn1 (formin 1 [Source:MGI Symbol;Acc:MGI:101815])

HSP 1 Score: 77.0258 bits (188), Expect = 1.689e-13
Identity = 60/246 (24.39%), Postives = 109/246 (44.31%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA+ ++  + L KD  K++  +++     + +   S + +    +  +  KL +  KKA+ E  + + H+   +K F      F  K       V     F  W +F  + K +W
Sbjct: 1040 FLHELAQIPNFAERAQCIIFRAVFSEGITSLHRKVEIVTRASKGLLHMKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGMNLVDYVVKYYLRYYDQEAGTDKSVFPLPEPQDF-FLAS-QVKFEDLLKDLRKLKRQLEASEQQMKLVCKESPREY----LQPFKDKLEEFFKKAKKEHKMEESHLENAQKSFETTVGYFGMKPKTGEKEVTPSYVFMVWFEFCSDFKTIW 1279          
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Match: Fmn2 (formin 2 [Source:MGI Symbol;Acc:MGI:1859252])

HSP 1 Score: 54.299 bits (129), Expect = 1.472e-6
Identity = 55/248 (22.18%), Postives = 103/248 (41.53%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSN------LQQKFSTK-VNSRAFFNQWLDFAQELKVLWIK 3873
            F  EL+ IP+  E+V  +       ESI     K+     +   L+N   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS ++  Y+  + +        FPL EP +L      +M  +   KD  K++  +K+    +  +     Q  S   +  +   +   I +A+++    +  +T+  K F        ++ K   K V+   FF+ W +F+ + K  W K
Sbjct: 1293 FLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNYMNAGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCVFPLAEPQEL--FQASQMKFEDFQKDLRKLKKDLKACEAEAGKVY----QVSSAEHMQPFKENMEQFISQAKIDQESQEAALTETHKCFLETTAYYFMKPKLGEKEVSPNVFFSVWHEFSSDFKDAWKK 1534          
BLAST of FH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68DA7|FMN1_HUMAN (Formin-1 OS=Homo sapiens OX=9606 GN=FMN1 PE=1 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 2.045e-11
Identity = 61/252 (24.21%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSD------ISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRA-------FFNQWLDFAQELKVLW 3867
            F +EL  IP+  E+ Q +    +  E I     K+   +  S  L + +S+ +IL+L++   N       T  Q     LE+L +LK++  + +G +++  V+  Y+  Y Q        FPLPEP D   LA++            K ED +K +  + R + +  +Q   V        +  +  KL +  +KA+ E  + + H+   +K F    + F  K  S          F  W +F  + K +W
Sbjct: 1127 FLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDF-FLASQ-----------VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIW 1366          
BLAST of FH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NZ56|FMN2_HUMAN (Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4)

HSP 1 Score: 62.7734 bits (151), Expect = 2.591e-8
Identity = 66/281 (23.49%), Postives = 118/281 (41.99%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSR--QTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK-NIISAQRSQKDS---FNKQNLKPIGKVIPR 3954
            F  EL+ IP+  E+V  +       ESI     K+     +   L+N   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS ++  Y+  + +        FPLPEP DL      +M  +   KD  K++  +K+      C +   +  Q  S   +  +   +   I +A+++    +  +T+  K F      F  K       V+  AFF+ W +F+ + K  W K N +  Q   K++     ++  K + K+ PR
Sbjct: 1437 FLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDL--FQASQMKFEDFQKDLRKLKKDLKA------CEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPR 1709          
BLAST of FH2 domain-containing protein vs. TrEMBL
Match: A0A419PPX9 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_214s PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 8.540e-15
Identity = 66/213 (30.99%), Postives = 105/213 (49.30%), Query Frame = 1
Query: 1987 VPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQ--KSDLYLLGCQMCTCLIACHQL-----XXXXXXXXXXXXXXESFNSKVFQP------------EQMYRWNSSGRDIQSDENEI--GEKKLHYLKKMNKNC-------SRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLAR 2541
            +P+EL   +   FQG  L+ WLC       ++G     +L  L   +CTCL+    L          S+   +  + S  S+V  P             Q Y+W+       +D  E+    +   +     ++        SR Q  + E+ K   ++ Y+++RL +E EL++F+VKN+GVMK+CQL D++E LE++VEKYRILAGIE L +
Sbjct:  353 IPDELR-FTAERFQGRTLVQWLCRQLV---RTGVAWSYNLITLVAHICTCLMRLGVLLPLDQSKPDNSKSAYTRLSSSLPSEVLAPGASGEISERFDLNQHYKWSGHRLGQVTDLLELCSTNRPFDFTANSMRSSQESLPFQSRFQPDLSELRK---EYEYELERLAREHELQLFRVKNQGVMKVCQLTDRIEMLEQEVEKYRILAGIERLTK 558          
BLAST of FH2 domain-containing protein vs. TrEMBL
Match: G7YBH4 (Sphingosine phosphate lyase OS=Clonorchis sinensis OX=79923 GN=CLF_104356 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.277e-14
Identity = 67/213 (31.46%), Postives = 103/213 (48.36%), Query Frame = 1
Query: 1987 VPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQ--KSDLYLLGCQMCTCLIACHQL-----XXXXXXXXXXXXXXESFNSKVFQP------------EQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKNCS---------RCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLAR 2541
            +P+EL   +   FQG  L+ WLC       ++G     +L  L   +CTCL+    L          S+   +  + S  S+V  P             Q Y+W+       +D  E+      +    N   S         R Q  + E+ K   ++ Y+++RL +E EL++F+VKN+GVMK+CQL D++E LE++VEKYRILAGIE L +
Sbjct:  353 IPDELR-FTAERFQGRTLVQWLCRQLV---RTGVAWSYNLITLVAHICTCLMRLGVLLPLDQSKPDNSKSAYTRLSSSLPSEVLAPGASGEISERFDLNQHYKWSGHRLGQVTDLLELCSTNRPFDFTANSMWSSQESLPFQSRFQPDLSELRK---EYEYELERLAREHELQLFRVKNQGVMKVCQLTDRIEMLEQEVEKYRILAGIERLTK 558          
BLAST of FH2 domain-containing protein vs. TrEMBL
Match: A0A1I8IG24 (FH2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.913e-14
Identity = 64/193 (33.16%), Postives = 92/193 (47.67%), Query Frame = 1
Query: 2038 LLSWLCHWCAPHF-KSGQKSDLYLLGCQMCTCLIACHQLXXXXXXXXXXXXXXESFNSKVFQPEQMYRWNSSGRDIQSDENE--------------------------IGEKKLHYLKKMNKNCSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGL 2535
            LLSWL    + HF     + +LYL   Q+CTCL+A   +           + +E+ NS VF+P + Y W   G+     E +                          +GE     +        R       IH+  L+H  +++R +Q+ +L IF+ KNE VMK+C L DK+E LE++VEKYRILAGIEGL
Sbjct:    3 LLSWLTS--SAHFLNVKARGELYLFVNQVCTCLLALGVI---------RQVQSEAPNS-VFRPHEFYEW--CGQQAPPPETQPTSQQQQQHNLSPSRRQQRQLQQQPTVGESAEDAVSAALAQAKR--DFDDRIHRLQLEHKEELERQRQDADLRIFQAKNESVMKVCSLRDKIEQLEQRVEKYRILAGIEGL 179          

HSP 2 Score: 70.4774 bits (171), Expect = 3.068e-8
Identity = 57/279 (20.43%), Postives = 127/279 (45.52%), Query Frame = 1
Query: 3058 IDINLLKEFQEMIPKNAEISE----KMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI---KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSN---LGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNS--RAFFNQWLDFAQELK 3858
            I +  LK+ +++ P   E+++       +   V +    F   ++ IP   E++  +     H + +   + ++     V   L  S S+  +LSLV+ + N+    ++  +     LE+L +LK++    + C++  +++  YI  Y +S    LG  + FPLP+P ++   A  E+ L  +  +   +   + +   I R + + S    + S+   ++ K+   + +A+ +L   ++ +T  E  +SN+   F    ++  + FF+ W  F  + K
Sbjct:  481 ISVEQLKQLRDLTPSQEEMAQIKEFVASNPGAVLDRPERFLLSISEIPFFSERLHCMLFQLEHEDCVSALESRVTALISVCRQLYESRSVRKVLSLVLALGNLLNYGTSRGRADGFGLEILGKLKDLRSSENTCTLFQVLVSMYIDEYWESGGPELGTVVPFPLPDPEEVKQAA--EVDLAGVKGELRHLSARLIANEKIVRKVATSS----APSEREPFAKKMNSFLDRAKKDLSEFRKTVTDAETCYSNILMYFCQPPSTPPKEFFSHWAAFCVDFK 753          
BLAST of FH2 domain-containing protein vs. TrEMBL
Match: A0A4V3SAF1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010949 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.273e-14
Identity = 64/212 (30.19%), Postives = 99/212 (46.70%), Query Frame = 1
Query: 1987 VPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQ--KSDLYLLGCQMCTCLIACHQLXXXXXXXXXXXXXXESFNSKV----------------FQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKN---------CSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLAR 2541
            +P+EL   +   FQG  L+ WLC       ++G     +L  L   +CTCL+    L   +        +     S +                F   Q Y+W+       +D  E+      +    N            SR Q  + E+ K   ++ Y+++RL +E EL++F+VKN+GVMK+CQL D++E LE++VEKYRILAGIE L +
Sbjct:  356 LPDELR-FTAEGFQGRTLVQWLCRQLV---RTGVAWSYNLITLVAHICTCLMRLGVLHLDQSKPDNSKSAQTRLPSSLPSEIMASGATSEIFERFDLNQHYKWSGYRPGQLTDLRELCSTNRPFNLTANSMRSSQESLPFPSRFQPDLSELRK---EYEYELERLAREHELQLFRVKNQGVMKVCQLTDRIEVLEQEVEKYRILAGIERLTK 560          
BLAST of FH2 domain-containing protein vs. TrEMBL
Match: A0A4S2KIC6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010949 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.803e-14
Identity = 65/218 (29.82%), Postives = 101/218 (46.33%), Query Frame = 1
Query: 1987 VPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQ--KSDLYLLGCQMCTCLIACHQLXXXXXXXXXXXXXXESFNSKV----------------FQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKN---------CSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLARQMWHEE 2559
            +P+EL   +   FQG  L+ WLC       ++G     +L  L   +CTCL+    L   +        +     S +                F   Q Y+W+       +D  E+      +    N            SR Q  + E+ K   ++ Y+++RL +E EL++F+VKN+GVMK+CQL D++E LE++VEKYRILAGIE L +    +E
Sbjct:  356 LPDELR-FTAEGFQGRTLVQWLCRQLV---RTGVAWSYNLITLVAHICTCLMRLGVLHLDQSKPDNSKSAQTRLPSSLPSEIMASGATSEIFERFDLNQHYKWSGYRPGQLTDLRELCSTNRPFNLTANSMRSSQESLPFPSRFQPDLSELRK---EYEYELERLAREHELQLFRVKNQGVMKVCQLTDRIEVLEQEVEKYRILAGIERLTKSPMLDE 566          
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Match: FMN2 (formin 2 [Source:NCBI gene;Acc:103027765])

HSP 1 Score: 65.4698 bits (158), Expect = 4.836e-10
Identity = 59/254 (23.23%), Postives = 105/254 (41.34%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   +V  +       E       K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS V+  Y+  + +     +  +PLPEP DL      +M  +  +KD  K+   ++          +C+ +  SV  IS       +  K+ + + +A+ EL   +  +    K F  L   FS K       V+   FF+ W +F+ + K LW K
Sbjct: 1369 FLYQLSQIPNFSGRVFCILFQSTFSECSSSIHRKLEILQRVCKILQSGSGVTRVLGLVLAFGNFMNGGNRTRGQADGFALDILPKLKDVKSSDNTRSLLSYVVAYYLRHFDEDAGRETCVYPLPEPQDL--FQASQMKFEDFTKDLLKLRKDLR----------ACTVEVESVCQISSDENLQPFKDKMEEFVSQAKSELEAQESQLKDTHKTFLELTAFFSVKPKSGEKEVSPNTFFSVWHEFSTDFKDLWKK 1610          
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Match: FMN2 (formin 2 [Source:NCBI gene;Acc:103027765])

HSP 1 Score: 65.0846 bits (157), Expect = 5.265e-10
Identity = 59/254 (23.23%), Postives = 105/254 (41.34%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   +V  +       E       K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS V+  Y+  + +     +  +PLPEP DL      +M  +  +KD  K+   ++          +C+ +  SV  IS       +  K+ + + +A+ EL   +  +    K F  L   FS K       V+   FF+ W +F+ + K LW K
Sbjct: 1373 FLYQLSQIPNFSGRVFCILFQSTFSECSSSIHRKLEILQRVCKILQSGSGVTRVLGLVLAFGNFMNGGNRTRGQADGFALDILPKLKDVKSSDNTRSLLSYVVAYYLRHFDEDAGRETCVYPLPEPQDL--FQASQMKFEDFTKDLLKLRKDLR----------ACTVEVESVCQISSDENLQPFKDKMEEFVSQAKSELEAQESQLKDTHKTFLELTAFFSVKPKSGEKEVSPNTFFSVWHEFSTDFKDLWKK 1614          
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Match: FMN2 (formin 2 [Source:NCBI gene;Acc:103027765])

HSP 1 Score: 65.0846 bits (157), Expect = 5.387e-10
Identity = 59/254 (23.23%), Postives = 105/254 (41.34%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDIS------VYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   +V  +       E       K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS V+  Y+  + +     +  +PLPEP DL      +M  +  +KD  K+   ++          +C+ +  SV  IS       +  K+ + + +A+ EL   +  +    K F  L   FS K       V+   FF+ W +F+ + K LW K
Sbjct: 1373 FLYQLSQIPNFSGRVFCILFQSTFSECSSSIHRKLEILQRVCKILQSGSGVTRVLGLVLAFGNFMNGGNRTRGQADGFALDILPKLKDVKSSDNTRSLLSYVVAYYLRHFDEDAGRETCVYPLPEPQDL--FQASQMKFEDFTKDLLKLRKDLR----------ACTVEVESVCQISSDENLQPFKDKMEEFVSQAKSELEAQESQLKDTHKTFLELTAFFSVKPKSGEKEVSPNTFFSVWHEFSTDFKDLWKK 1614          
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000011493.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:13758594:13808554:1 gene:ENSAMXG00000011189.2 transcript:ENSAMXT00000011493.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.506e-9
Identity = 58/252 (23.02%), Postives = 104/252 (41.27%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLW 3867
            F  +L  IP    +V  +       E I     K+     V   L++ + +  +L LV+   N       +  Q     L++L +LK++    +  S+LS ++  Y+  + +     +  +PLPEP DL      +M  D   +D  K+    K +N       +CS +T  V  +S       +  K+   + +A+ EL   ++ +   +K F  L   FS K       V+    F+ W +F+ + K LW
Sbjct:   66 FLLQLAGIPQFSGRVFCILFQSTFTECISNVQRKVQMLQRVCTSLQSGKGVLQVLGLVLAFGNYMNGGNRSRGQADGFTLDILPKLKDVKSSDNSQSLLSYIVSYYLRHFDEDAGRETCVYPLPEPQDL--FQASQMKFDDFQRDLRKLR---KDLN-------ACSSETEKVCAVSSEEHLQPFKDKMEQFLTQARTELEEQEKQLADTQKCFVELTLFFSVKPKAGEKEVSPNTLFSVWHEFSSDFKELW 305          
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Match: FMN2 (formin 2 [Source:NCBI gene;Acc:103027765])

HSP 1 Score: 56.6102 bits (135), Expect = 1.911e-7
Identity = 57/254 (22.44%), Postives = 102/254 (40.16%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDIS------VYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   +V  +       E       K+     V   L++   +  +L LV+   N       T  Q     L++L +LK++    +  S+LS V+  Y+  + +     +  +PLPEP DL      +M  +  +KD  K+   ++          +C+ +  SV  IS       +  K+ + + + +           + EK F  L   FS K       V+   FF+ W +F+ + K LW K
Sbjct: 1054 FLYQLSQIPNFSGRVFCILFQSTFSECSSSIHRKLEILQRVCKILQSGSGVTRVLGLVLAFGNFMNGGNRTRGQADGFALDILPKLKDVKSSDNTRSLLSYVVAYYLRHFDEDAGRETCVYPLPEPQDL--FQASQMKFEDFTKDLLKLRKDLR----------ACTVEVESVCQISSDENLQPFKDKMEEFVSQGK---PAASPSPLQPEKMFLELTAFFSVKPKSGEKEVSPNTFFSVWHEFSTDFKDLWKK 1292          
BLAST of FH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000965.1 (pep scaffold:Pmarinus_7.0:GL477904:33046:60753:-1 gene:ENSPMAG00000000875.1 transcript:ENSPMAT00000000965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.065e-9
Identity = 61/252 (24.21%), Postives = 104/252 (41.27%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLS-FPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVK--SMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIKN 3876
            F  EL+ IP   E+V  +       E I     K+     V   L +SE +  +L L++ + N       T  Q     LE+L +L ++    +  S++S ++  Y+   I  N G   S FPLPEP DL      ++  D   KD  K+   ++         C LS      S  ++  + S++ + ++KA++E    +  + +    F    + F  K       V+   FF+ W +F    K  W K+
Sbjct:  128 FLYELSRIPCFAERVFCVIFQATFTEGITTIRRKMLILQRVCKSLRSSEGVQQVLGLILALGNYMNGGNRTRGQADGFGLEILPKLSDVKSSDNRISLVSYIVTFYLR-NIDKNAGTDHSVFPLPEPQDL--FQVSQLKFDDFQKDLRKLRKDLQVCETEMAKVCRLS------SEENLEPFKSEMEEFVEKAKVEQDAEERFLEESHASFLETARFFGIKPRSGEKEVSPNHFFSLWHEFCSHFKDCWKKD 370          
BLAST of FH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000679.1 (pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 gene:ENSPMAG00000000612.1 transcript:ENSPMAT00000000679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.571e-6
Identity = 52/251 (20.72%), Postives = 107/251 (42.63%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVS---DISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  EL+ IP   E+V  +       E I+    ++      S  L+ S  +  +LSL++   N       T  Q     LE+L +L+++    +  S+++ ++  Y+  + +        FPLPEP +L  L   ++  + + +D  ++   +K++     C L   ++ + +S    I  + S +     +A ++  + ++ + + +  F +    F  K       V    FF+ WL+F  + K  W K
Sbjct:  392 FLYELSQIPCFFERVFCIVFQSTFTEHIKSIHCRLELVHRNSKLLKTSAGVHKVLSLILTFGNYMNGGNRTRGQADGFALEILPKLRDVKSNDNRISLVNYIVAYYLQNFDEDAGTERSIFPLPEPQEL--LQAAQVKFEDIQRDMRELRKDLKALK---ACELEM-KKVYKLSKSEHIEPFKSHMEAFTHQANIDREVEEKCLQETQASFLDTAAFFCFKPKSGEKEVTPSHFFSVWLEFCSDFKENWKK 636          
BLAST of FH2 domain-containing protein vs. Ensembl Nematostella
Match: EDO45866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ1])

HSP 1 Score: 64.3142 bits (155), Expect = 1.762e-10
Identity = 58/252 (23.02%), Postives = 114/252 (45.24%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNIKSTN----CQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVL-----LKEHITK---CEKQFSNLQQKFSTK---VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +++ I   EE++  L       + ++     +  F  V   L+  +++ NI+ L++   N  +       Q     LE++ +LK++  +++  ++L  ++  Y+ ++ +     S  FPLPEP DL   +  ++S D +  D   IE  ++S + +   +L  S             + LV   KK   + ++     LKE I     C+K+FS L   F  +   + ++ FF+ W+ F  + KV+W K
Sbjct:  123 FLLDVSKIVCYEERLACLIARTTVRDGLEEIGQMLTNFRLVCEELQKGKNVHNIMGLILAFGNFMNGGNIARGQADGFDLEIIPKLKDVKSRNNTSNLLCYLVQEYVMIFDKDAGTLSAKFPLPEPADLQ--SASQVSFDDVQADLRNIEKKIESCDVMVTRVLRES------------DANLVQPFKKIMNKFLVENRNELKEQIQALEDCQKRFSVLLPFFYNQLPTLTAQEFFDIWVKFTSDFKVIWKK 360          
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039523.1 (formin 2 [Source:NCBI gene;Acc:101170259])

HSP 1 Score: 67.3958 bits (163), Expect = 1.156e-10
Identity = 64/254 (25.20%), Postives = 108/254 (42.52%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDIS------VYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   ++  +       E +     K+     V   L++SE++  IL LV+   N       T  Q     L++L +LK++       S+LS +   Y+  + +     +  FPLPEP+DL      +M          K ED  K +    R + +CS +   V  +S       +  K+ D + +AQ +L  L+  ++  +K F  L   FS K       V+   FF+ W DF+ + K  W K
Sbjct: 1106 FLYQLSLIPNFSGRLFCILFQSSFSECMTSITKKLDTLQKVCKALQDSETVKRILGLVLAFGNYMNGGNRTRGQADGFSLDILPKLKDVKSSDSTKSLLSYITAYYLKHFDEDAGRDTCVFPLPEPHDL--FQASQM----------KFEDFQKDLTRHRRDLRACSAEVEKVCKLSDQDNLQPFKDKMEDFLAQAQSDLQTLEAQLSSTQKLFLELTVFFSVKPKAGEKEVSPNTFFSIWHDFSSDFKEQWKK 1347          
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Match: FMN1 (formin 1 [Source:NCBI gene;Acc:101172295])

HSP 1 Score: 60.077 bits (144), Expect = 1.867e-8
Identity = 68/310 (21.94%), Postives = 127/310 (40.97%), Query Frame = 1
Query: 3034 DIQIPIENIDINLLK-EFQEMIPKNAEISEKMD--------SKTTVSNLLT---MFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIKN 3876
            DI+  + N+D +++  E  E + +N   SE+M+        SK   + LL     F  EL+ IP+   +   +    + +++I     K+   S V   L    +L +++ LV+   N       T  Q     LE+L +LK++  + +  +++  V+  Y+  + +        FPLPEP +       ++  D L+KD  K++          R + +C +    V   S       +  K+   +  AQ E    ++ +   EK F ++   F  K       V     F  W +F  + K  WI++
Sbjct:  935 DIRQAVLNVDNSVVDLETIEALYENRATSEEMERILSHFQTSKEDEAKLLDKPEQFLYELSQIPNFAGRAHCIIFQSVFLDTISSLHRKVEIISSVCKDLLECNALQDVMGLVLAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNHINLVDYVVLYYLRNFDKHAGTEKSVFPLPEPQNF--FQAAQVKFDDLAKDVRKLK----------RDLTACEKNVEDVCSKSPEDHLQPFKEKMEAFMSAAQNEHSAEEDRLNAAEKSFQSVVDYFGVKPKGGEKEVTPSYVFMLWFEFCNDFKNAWIRH 1232          
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Match: FMN1 (formin 1 [Source:NCBI gene;Acc:101172295])

HSP 1 Score: 59.6918 bits (143), Expect = 2.605e-8
Identity = 69/310 (22.26%), Postives = 128/310 (41.29%), Query Frame = 1
Query: 3034 DIQIPIENIDINLLK-EFQEMIPKNAEISEKMD--------SKTTVSNLL---TMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIKN 3876
            DI+  + N+D +++  E  E + +N   SE+M+        SK   + LL     F  EL+ IP+   +   +    + +++I     K+   S V   L    +L +++ LV+   N       T  Q     LE+L +LK++  + +  +++  V+  Y+  + +        FPLPEP +    A  ++  D L+KD  K++          R + +C +    V   S       +  K+   +  AQ E    ++ +   EK F ++   F  K       V     F  W +F  + K  WI++
Sbjct:  906 DIRQAVLNVDNSVVDLETIEALYENRATSEEMERILSHFQTSKEDEAKLLDKPEQFLYELSQIPNFAGRAHCIIFQSVFLDTISSLHRKVEIISSVCKDLLECNALQDVMGLVLAFGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNHINLVDYVVLYYLRNFDKHAGTEKSVFPLPEPQNFFQAA--QVKFDDLAKDVRKLK----------RDLTACEKNVEDVCSKSPEDHLQPFKEKMEAFMSAAQNEHSAEEDRLNAAEKSFQSVVDYFGVKPKGGEKEVTPSYVFMLWFEFCNDFKNAWIRH 1203          
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006619.2 (formin-2 [Source:NCBI gene;Acc:101164834])

HSP 1 Score: 56.9954 bits (136), Expect = 8.975e-8
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGC-SVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISV------YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ I +  E+V  +       E I     K+     V   +++++S+  IL LV+   N       +  Q     L++L +LK++   SD C S+LS ++  Y+  + +     +  +PLPEP DL      +M  +   +D  K+    K +N       +C  +T  V  +S       +  K+ + + +A+ +L + ++ +T+ +  F  L   FS K       V+   FF+ W +F+ + K  W K
Sbjct:   92 FLFQLSQISNFSERVFCILFQSTFQECITSILRKMEVLQKVCTSIQSNKSVMRILGLVLAFGNYMNGGNRSRGQADGFTLDILPKLKDVK-SSDNCQSLLSYIVAYYLRHFDEDAGKETCVYPLPEPQDL--FQASQMKFEDFQRDLRKLR---KDLN-------ACLAETEKVCKLSSEENLHPFKEKMDEFLNQAKTDLEMQEKQLTETQNTFLELTVSFSVKPKAGEKEVSPNTFFSIWHEFSSDFKEQWKK 333          
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038010.1 (formin 2 [Source:NCBI gene;Acc:101170259])

HSP 1 Score: 55.0694 bits (131), Expect = 6.643e-7
Identity = 60/254 (23.62%), Postives = 101/254 (39.76%), Query Frame = 1
Query: 3163 FWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNI----KSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDIS------VYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTK-------VNSRAFFNQWLDFAQELKVLWIK 3873
            F  +L+ IP+   ++  +       E +     K+     V   L++SE++  IL LV+   N       T  Q     L++L +LK++     G        D  +             FPLPEP+DL      +M  +   KD ++            R + +CS +   V  +S       +  K+ D + +AQ +L  L+  ++  +K F  L   FS K       V+   FF+ W DF+ + K  W K
Sbjct: 1106 FLYQLSLIPNFSGRLFCILFQSSFSECMTSITKKLDTLQKVCKALQDSETVKRILGLVLAFGNYMNGGNRTRGQADGFSLDILPKLKDVKSSDAG-------RDTCV-------------FPLPEPHDL--FQASQMKFEDFQKDLTRHR----------RDLRACSAEVEKVCKLSDQDNLQPFKDKMEDFLAQAQSDLQTLEAQLSSTQKLFLELTVFFSVKPKAGEKEVSPNTFFSIWHDFSSDFKEQWKK 1327          
BLAST of FH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000034094.1 (SMESG000034094.1)

HSP 1 Score: 2283.83 bits (5917), Expect = 0.000e+0
Identity = 1241/1252 (99.12%), Postives = 1244/1252 (99.36%), Query Frame = 1
Query:  256 MGQKASLLSHHDRQSQRGGSFHISSQANRRREAFKAAKKTHFSFGDEPFRHSIHQKESTGTQGSRRHKPSAVGTTSNGNKSFSPPKTILTPENEFHSLSSSLSNNKQTLNCQRSFHSECPTLLNIPEPLHEFSLFPSGNRSQSPADSINRXXXXXXXXXXXXVKLSEDEDISSEYSNQNYKNSPLLSLSRSKDKYSPSQSPHGGKQISDSMSSRTQVKLVKAPRTPSPNSTFTKSATIDTHKKTPRAIMSNDSDIKSSQNKDKNDKYQXXXXXXXXXKKRQTIPMRNPSEMHKTIDLSQENLVXXXXXXXXXXQRERKISLAPHKLSPYNLSPRSLSPXXXXXXXXXXXXXXXXXXKESGNTRDSFMSNDFHNNFLAKQKPGSKVTPNILINSAAFKNSIDYSPEDIDVQHACERKYTDSQTLLGLESHSYRDAKLTNKTFNNQEFYLFGGNLFSINSKSDTSLSSVSFHKTPSIGLSPTAERGGGLASFLFNSDNKFQIHHPHNETINKLKDYNQGLEKSLSMEYFKAKASPNHMXXXXXXXXXXXXXXHEPVSKPQNLALTRRSSLISQIVWPRSVPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQKSDLYLLGCQMCTCLIACHQLXXXXXXXXXXXXXXESFNSKVFQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKNCSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLARQMWHEEALTANPSLVMSKSPTLQXXXXXXXXXXXXXXXXXXXXDTSDLDDIIQYKTTGEEANNDLYTLSTAFIYPPDSLIAYPLSPVESNISIKKSKEDTRQRLFNEDPAKSKKLQRVSSITESPSTDQLNKKKNREKDDSPLQXXXXXXXXXXXXADVIKRWLDIQIPIENIDINLLKEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNIKSTNCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRAFFNQWLDFAQELKVLWIKNIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQENSI 4011
            MGQKASLLSHHDRQSQRGGSFHISSQANRRREAFKAAKKTHFSFGDEPFRHSIHQKESTGTQGSRRHKPSAV TTSNGNK FSPPKTILTPENEFHSLSSSLSNNK TLNCQRSFHSECPTLLNIPEPLHEFSLFPSGNRSQSPADSINRSLHAASCSHHSSVKLSEDEDISSEYSNQNYKNSPLLSLSRSKDKYSPSQSPHGGKQISDSMSSRTQVKLVKAPRTPSPNSTFTKSATIDTHKKTPRAIMSNDSDIKSSQNKDKNDKYQPPLPPPPLLKKRQTIPMRNPSEMHKTIDLSQENLVAALLPPSPLSQRERKISLAPHKLSPYNLSPRSLSPSQMSLHSLTSGSSNSYLLKESGNTRDSFMSNDFHNNFLAKQKPGSKVTPNILINSAAFKNSIDYSPEDIDVQHACERKYTDSQTLLGLESHSYRDAKLTNKTFNNQEFYLFGGNLFSINSKSDTSLSSVSFHKTPSIGLSPTAERGGGLASFLFNSDNKFQIHHPHNE INKLKDYNQGLEKSLSMEYFKAKASPNHMNEEKNKNQNKREKEHEPVSKPQNLALTRR SLISQIVWPRSVPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQKSDLYLLGCQMCTCLIACHQLI GRRSRGTGSISTESFNSKVFQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKNCSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLARQMWHEEALTANPSLVMSKSPTLQSIGTNSSNIKSINSTKSCSTDTSDLDDIIQYKTTGEEANNDLYTLSTAFIYPP+SLIAYPLSPVESNISIKKSKEDTRQRLFNEDPAKSKKLQRVSSITESPSTD+LN+KKNREKDDSPLQSLNNLINSKSINADVIKRWLDIQIPIENIDINLLKEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNIKS NCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDIS YSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRAFFNQWLDFAQELKVLWIKNIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQENSI
Sbjct:    1 MGQKASLLSHHDRQSQRGGSFHISSQANRRREAFKAAKKTHFSFGDEPFRHSIHQKESTGTQGSRRHKPSAVATTSNGNKPFSPPKTILTPENEFHSLSSSLSNNKLTLNCQRSFHSECPTLLNIPEPLHEFSLFPSGNRSQSPADSINRSLHAASCSHHSSVKLSEDEDISSEYSNQNYKNSPLLSLSRSKDKYSPSQSPHGGKQISDSMSSRTQVKLVKAPRTPSPNSTFTKSATIDTHKKTPRAIMSNDSDIKSSQNKDKNDKYQPPLPPPPLLKKRQTIPMRNPSEMHKTIDLSQENLVAALLPPSPLSQRERKISLAPHKLSPYNLSPRSLSPSQMSLHSLTSGSSNSYLLKESGNTRDSFMSNDFHNNFLAKQKPGSKVTPNILINSAAFKNSIDYSPEDIDVQHACERKYTDSQTLLGLESHSYRDAKLTNKTFNNQEFYLFGGNLFSINSKSDTSLSSVSFHKTPSIGLSPTAERGGGLASFLFNSDNKFQIHHPHNEAINKLKDYNQGLEKSLSMEYFKAKASPNHMNEEKNKNQNKREKEHEPVSKPQNLALTRRFSLISQIVWPRSVPEELNSLSCLDFQGHQLLSWLCHWCAPHFKSGQKSDLYLLGCQMCTCLIACHQLIRGRRSRGTGSISTESFNSKVFQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKNCSRCQGIVQEIHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEKYRILAGIEGLARQMWHEEALTANPSLVMSKSPTLQSIGTNSSNIKSINSTKSCSTDTSDLDDIIQYKTTGEEANNDLYTLSTAFIYPPNSLIAYPLSPVESNISIKKSKEDTRQRLFNEDPAKSKKLQRVSSITESPSTDKLNEKKNREKDDSPLQSLNNLINSKSINADVIKRWLDIQIPIENIDINLLKEFQEMIPKNAEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRFDFKIHQFSFVSHFLENSESLDNILSLVMEICNIKSINCQNPTLPLEMLKQLKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATKEMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISAYSSKLVDVIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRAFFNQWLDFAQELKVLWIKNIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQENSI 1252          
The following BLAST results are available for this feature:
BLAST of FH2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FMN11.748e-1224.21formin 1 [Source:HGNC Symbol;Acc:HGNC:3768][more]
FMN12.060e-1223.81formin 1 [Source:HGNC Symbol;Acc:HGNC:3768][more]
FMN13.966e-1224.21formin 1 [Source:HGNC Symbol;Acc:HGNC:3768][more]
FMN14.258e-1224.21formin 1 [Source:HGNC Symbol;Acc:HGNC:3768][more]
FMN25.395e-923.49formin 2 [Source:HGNC Symbol;Acc:HGNC:14074][more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU695215.31.670e-1424.58formin-like [Source:NCBI gene;Acc:103909278][more]
fmn2a8.731e-1324.21formin 2a [Source:ZFIN;Acc:ZDB-GENE-101107-1][more]
fmn2a1.610e-1224.21formin 2a [Source:ZFIN;Acc:ZDB-GENE-101107-1][more]
fmn2b1.255e-821.77formin 2b [Source:ZFIN;Acc:ZDB-GENE-080225-35][more]
fmn2b1.305e-821.77formin 2b [Source:ZFIN;Acc:ZDB-GENE-080225-35][more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itgb33.211e-1122.38integrin subunit beta 3 [Source:Xenbase;Acc:XB-GEN... [more]
itgb33.447e-1123.12integrin subunit beta 3 [Source:Xenbase;Acc:XB-GEN... [more]
itgb35.065e-1124.16integrin subunit beta 3 [Source:Xenbase;Acc:XB-GEN... [more]
itgb35.397e-922.38integrin subunit beta 3 [Source:Xenbase;Acc:XB-GEN... [more]
itgb36.797e-821.82integrin subunit beta 3 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fmn17.809e-1424.39formin 1 [Source:MGI Symbol;Acc:MGI:101815][more]
Fmn18.223e-1423.58formin 1 [Source:MGI Symbol;Acc:MGI:101815][more]
Fmn11.433e-1324.39formin 1 [Source:MGI Symbol;Acc:MGI:101815][more]
Fmn11.689e-1324.39formin 1 [Source:MGI Symbol;Acc:MGI:101815][more]
Fmn21.472e-622.18formin 2 [Source:MGI Symbol;Acc:MGI:1859252][more]
back to top
BLAST of FH2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q68DA7|FMN1_HUMAN2.045e-1124.21Formin-1 OS=Homo sapiens OX=9606 GN=FMN1 PE=1 SV=3[more]
sp|Q9NZ56|FMN2_HUMAN2.591e-823.49Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4[more]
back to top
BLAST of FH2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419PPX98.540e-1530.99Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
G7YBH41.277e-1431.46Sphingosine phosphate lyase OS=Clonorchis sinensis... [more]
A0A1I8IG241.913e-1433.16FH2 domain-containing protein OS=Macrostomum ligna... [more]
A0A4V3SAF13.273e-1430.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2KIC63.803e-1429.82Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FMN24.836e-1023.23formin 2 [Source:NCBI gene;Acc:103027765][more]
FMN25.265e-1023.23formin 2 [Source:NCBI gene;Acc:103027765][more]
FMN25.387e-1023.23formin 2 [Source:NCBI gene;Acc:103027765][more]
ENSAMXT00000011493.21.506e-923.02pep primary_assembly:Astyanax_mexicanus-2.0:9:1375... [more]
FMN21.911e-722.44formin 2 [Source:NCBI gene;Acc:103027765][more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000965.11.065e-924.21pep scaffold:Pmarinus_7.0:GL477904:33046:60753:-1 ... [more]
ENSPMAT00000000679.13.571e-620.72pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 ge... [more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO458661.762e-1023.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FH2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039523.11.156e-1025.20formin 2 [Source:NCBI gene;Acc:101170259][more]
FMN11.867e-821.94formin 1 [Source:NCBI gene;Acc:101172295][more]
FMN12.605e-822.26formin 1 [Source:NCBI gene;Acc:101172295][more]
ENSORLT00000006619.28.975e-823.53formin-2 [Source:NCBI gene;Acc:101164834][more]
ENSORLT00000038010.16.643e-723.62formin 2 [Source:NCBI gene;Acc:101170259][more]
back to top
BLAST of FH2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034094.10.000e+099.12SMESG000034094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007990 ID=SMED30007990|Name=FH2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4064bp
TAATGAAATATAGACAAAATAAGTGAAGGCAGCAGATGCCACAGAAATTT
GTGGATAGGAAGAAAATCCATATTTACTCACTCCTAGCATATGCCTGTTA
ATGGGAGAGATTTCTCTCTCTCAAAACAAAGAAAAATGGTTTGTCTGGTT
TTTTTTTATTTAGATAGTTTTCGGAAATTAAATTTTACTGTTAAAATTTG
GAAATTATGACCAAATAATTTCTGAAGTGTGGAAACTTTTCAATTTGATT
TTCCAATGGGACAAAAGGCCTCACTTTTATCCCATCATGATCGTCAATCG
CAACGTGGTGGATCATTTCACATTTCCAGTCAAGCAAACAGAAGACGGGA
GGCTTTTAAAGCCGCAAAGAAAACTCATTTTTCATTTGGCGATGAACCAT
TTCGACATTCAATTCATCAAAAAGAATCCACTGGCACCCAAGGCTCTCGG
CGACATAAGCCAAGTGCAGTTGGGACTACTTCAAATGGAAATAAATCCTT
TTCTCCCCCAAAAACAATTCTCACGCCCGAAAATGAGTTTCATTCATTAT
CAAGTTCTTTATCTAACAACAAACAAACTTTAAATTGTCAAAGGAGTTTT
CATAGTGAGTGTCCGACTCTTCTCAATATTCCGGAGCCTTTGCACGAGTT
CTCTTTATTTCCAAGTGGTAATAGGTCTCAATCACCAGCTGATTCAATTA
ATAGAAGTCTACATGCTGCCTCTTGCAGTCATCACTCAAGTGTTAAGCTA
AGTGAAGATGAAGACATAAGCAGTGAATATTCGAATCAAAACTATAAAAA
TTCTCCTTTATTATCTTTATCTCGATCGAAGGATAAATATTCACCTTCAC
AATCTCCGCATGGAGGCAAGCAAATTTCCGATTCGATGTCATCTAGAACC
CAGGTGAAGCTGGTAAAAGCTCCAAGAACTCCTTCACCTAACTCAACATT
CACAAAATCAGCTACTATAGATACTCACAAAAAAACTCCTAGGGCCATTA
TGTCTAATGATTCTGACATAAAATCATCTCAAAACAAAGATAAAAATGAT
AAATATCAACCTCCTTTGCCACCTCCTCCACTTTTGAAAAAACGTCAAAC
GATTCCAATGAGGAATCCTAGTGAAATGCATAAAACCATAGACCTCAGTC
AAGAAAATTTAGTTGCTGCTCTTTTGCCCCCTTCACCATTAAGTCAACGC
GAAAGGAAAATATCTTTGGCTCCACACAAACTGTCACCGTATAACCTCTC
TCCAAGAAGTCTTTCTCCTTCGCAAATGTCTCTTCATTCTTTAACTAGTG
GATCTAGTAATTCATATTTGCTGAAAGAAAGTGGAAACACTCGAGACAGT
TTTATGTCAAATGATTTTCATAATAATTTCCTAGCAAAACAAAAGCCTGG
GTCTAAAGTTACTCCAAATATTCTCATAAATTCAGCTGCTTTCAAGAATT
CCATTGACTACAGTCCAGAGGACATTGATGTACAACATGCCTGTGAGAGA
AAATACACCGATTCCCAAACTCTTCTCGGATTGGAAAGTCATTCTTATCG
GGACGCAAAATTAACAAATAAAACATTCAACAATCAAGAGTTTTATTTAT
TCGGAGGAAATTTATTCAGCATTAATTCTAAATCTGACACAAGTTTATCG
TCGGTTTCATTTCACAAAACTCCATCAATTGGATTGAGTCCAACAGCTGA
GCGAGGTGGCGGTCTGGCAAGTTTTCTTTTCAATTCCGACAACAAATTCC
AGATCCATCATCCACACAATGAGACCATTAATAAACTGAAAGATTATAAT
CAGGGTCTTGAAAAATCATTGTCAATGGAATATTTTAAGGCTAAGGCGTC
TCCAAATCACATGAACGAAGAAAAGAACAAGAACCAGAATAAGAGAGAAA
AAGAACATGAGCCTGTTAGTAAACCGCAAAATTTGGCTCTCACGCGGCGA
TCTTCATTAATCAGCCAAATTGTATGGCCACGAAGCGTGCCCGAAGAGTT
AAACAGTTTATCATGTTTAGATTTTCAAGGCCACCAACTTCTGTCATGGT
TGTGTCATTGGTGTGCTCCACATTTTAAATCAGGTCAAAAATCTGACCTC
TACCTATTAGGATGTCAAATGTGCACTTGTTTGATTGCTTGCCATCAATT
AATCAGTGGTAGACGTTCGAGAGGAACCGGATCAATTTCAACTGAGTCTT
TCAATTCAAAAGTTTTTCAACCGGAACAAATGTATCGGTGGAATTCTTCT
GGCAGAGATATTCAAAGTGATGAAAACGAGATCGGTGAAAAGAAATTACA
TTACCTGAAGAAAATGAACAAAAATTGCTCACGGTGTCAGGGTATTGTGC
AAGAAATACACAAAAGAGATTTAGATCATTCTTATGATATTCAGCGATTA
AAACAAGAGCAAGAGTTAGAAATATTCAAAGTTAAAAATGAAGGAGTGAT
GAAAATGTGTCAACTCAATGATAAAGTTGAACATTTAGAACGACAAGTAG
AAAAATATCGAATCCTTGCAGGAATTGAAGGGTTAGCCAGACAAATGTGG
CATGAAGAAGCGTTAACAGCGAACCCAAGCTTAGTTATGTCAAAAAGTCC
GACCCTTCAAAGCATTGGTACCAATTCCAGTAATATTAAATCCATCAACA
GCACAAAATCCTGTTCAACTGACACCAGTGATCTTGATGACATTATCCAA
TACAAAACTACTGGAGAAGAAGCTAACAATGACCTTTACACATTAAGCAC
GGCCTTCATTTATCCTCCAGATTCATTAATTGCCTACCCTTTGTCACCTG
TTGAATCCAATATCAGTATAAAAAAATCAAAAGAGGATACTCGACAGAGG
TTATTCAATGAAGATCCAGCGAAATCCAAGAAATTGCAAAGAGTTTCGAG
TATCACTGAAAGTCCATCAACCGATCAATTAAACAAAAAGAAGAATAGAG
AGAAAGATGATTCTCCTCTTCAGTCTCTAAACAATTTGATAAATTCCAAA
TCCATCAACGCAGACGTAATCAAGCGTTGGCTGGATATTCAGATTCCAAT
TGAGAATATTGATATCAATTTGTTGAAAGAATTCCAAGAAATGATACCTA
AAAATGCTGAAATCAGTGAAAAGATGGATAGTAAAACCACAGTATCCAAT
TTATTGACTATGTTTTGGAATGAACTGAATTCGATTCCTCACTTAGAAGA
AAAAGTTCAATTTTTATACCTCTACAAAATACATATTGAGTCCATTCAGC
GTTTTGATTTCAAAATTCATCAATTTAGTTTTGTTTCGCATTTCCTAGAA
AACAGTGAATCTCTCGACAATATTCTATCCCTAGTAATGGAGATCTGTAA
TATCAAGTCAACAAACTGTCAAAATCCCACCTTACCACTAGAAATGTTGA
AACAGCTAAAAAATATGCATTTACAGAGTGATGGATGCAGTGTTCTCAGT
ATTGTCATGGACAGATATATTCACGTGTATATTCAATCAAATTTAGGAGG
AAGTTTGAGCTTTCCTCTTCCAGAACCAAATGACCTTGCTATTCTTGCCA
CAAAAGAAATGAGTCTTGATCAACTTTCAAAGGATTTTTCAAAGATCGAA
GATGGCGTTAAATCAATGAATCACATATCGAGGTGCATTCTCTCATGTAG
CCGCCAGACGTTCAGTGTGTCAGATATTAGCGTCTATTCTTCCAAGTTGG
TTGATGTCATAAAAAAAGCTCAATTGGAACTAGTTTTGCTGAAAGAACAT
ATTACCAAGTGTGAAAAGCAATTCTCAAATTTACAACAAAAATTCTCAAC
CAAAGTCAATAGCAGAGCGTTTTTTAATCAATGGCTTGATTTTGCACAAG
AACTGAAAGTGTTGTGGATAAAAAATATAATTTCTGCTCAGAGATCACAA
AAAGATTCATTTAACAAACAAAATTTAAAGCCTATTGGAAAAGTCATACC
AAGAAGACCAAACGACGAAGTTGTGTTGAACACAAACCAACTACATCAAG
AAAACTCAATTTAAATCAAATGTTTTTTCTACATCAATAAATTAAATTAG
TAACATTCAGAAAG
back to top

protein sequence of SMED30007990-orf-1

>SMED30007990-orf-1 ID=SMED30007990-orf-1|Name=SMED30007990-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1253bp
MGQKASLLSHHDRQSQRGGSFHISSQANRRREAFKAAKKTHFSFGDEPFR
HSIHQKESTGTQGSRRHKPSAVGTTSNGNKSFSPPKTILTPENEFHSLSS
SLSNNKQTLNCQRSFHSECPTLLNIPEPLHEFSLFPSGNRSQSPADSINR
SLHAASCSHHSSVKLSEDEDISSEYSNQNYKNSPLLSLSRSKDKYSPSQS
PHGGKQISDSMSSRTQVKLVKAPRTPSPNSTFTKSATIDTHKKTPRAIMS
NDSDIKSSQNKDKNDKYQPPLPPPPLLKKRQTIPMRNPSEMHKTIDLSQE
NLVAALLPPSPLSQRERKISLAPHKLSPYNLSPRSLSPSQMSLHSLTSGS
SNSYLLKESGNTRDSFMSNDFHNNFLAKQKPGSKVTPNILINSAAFKNSI
DYSPEDIDVQHACERKYTDSQTLLGLESHSYRDAKLTNKTFNNQEFYLFG
GNLFSINSKSDTSLSSVSFHKTPSIGLSPTAERGGGLASFLFNSDNKFQI
HHPHNETINKLKDYNQGLEKSLSMEYFKAKASPNHMNEEKNKNQNKREKE
HEPVSKPQNLALTRRSSLISQIVWPRSVPEELNSLSCLDFQGHQLLSWLC
HWCAPHFKSGQKSDLYLLGCQMCTCLIACHQLISGRRSRGTGSISTESFN
SKVFQPEQMYRWNSSGRDIQSDENEIGEKKLHYLKKMNKNCSRCQGIVQE
IHKRDLDHSYDIQRLKQEQELEIFKVKNEGVMKMCQLNDKVEHLERQVEK
YRILAGIEGLARQMWHEEALTANPSLVMSKSPTLQSIGTNSSNIKSINST
KSCSTDTSDLDDIIQYKTTGEEANNDLYTLSTAFIYPPDSLIAYPLSPVE
SNISIKKSKEDTRQRLFNEDPAKSKKLQRVSSITESPSTDQLNKKKNREK
DDSPLQSLNNLINSKSINADVIKRWLDIQIPIENIDINLLKEFQEMIPKN
AEISEKMDSKTTVSNLLTMFWNELNSIPHLEEKVQFLYLYKIHIESIQRF
DFKIHQFSFVSHFLENSESLDNILSLVMEICNIKSTNCQNPTLPLEMLKQ
LKNMHLQSDGCSVLSIVMDRYIHVYIQSNLGGSLSFPLPEPNDLAILATK
EMSLDQLSKDFSKIEDGVKSMNHISRCILSCSRQTFSVSDISVYSSKLVD
VIKKAQLELVLLKEHITKCEKQFSNLQQKFSTKVNSRAFFNQWLDFAQEL
KVLWIKNIISAQRSQKDSFNKQNLKPIGKVIPRRPNDEVVLNTNQLHQEN
SI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005884actin filament
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0045010actin nucleation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0000478pharynx musculature
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042201FH2_Formin_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1152..1179
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 168..282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 860..905
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 889..903
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 860..876
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 28..54
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..238
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 532..555
NoneNo IPR availableSUPERFAMILYSSF101447Formin homology 2 domain (FH2 domain)coord: 915..1214
IPR042201Formin, FH2 domain superfamilyGENE3DG3DSA:1.20.58.2220coord: 894..1225
e-value: 4.5E-14
score: 54.2