slc30a-3

Overview
Nameslc30a-3 (AKN21623.1)
Smed IDSMED30007967
Length (bp)2748
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc30a-3 (SMED30007967) t-SNE clustered cells

Violin plots show distribution of expression levels for slc30a-3 (SMED30007967) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc30a-3 (SMED30007967) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc30a-3 (SMED30007967) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007967

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30007967SMESG000022672.1 dd_Smed_v4_5007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007967SMESG000022672.1 dd_Smed_v4_5007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007967SMESG000022672.1 dd_Smed_v4_5007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007967SMESG000022672.1 Contig49474newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007967SMESG000022672.1 Contig49474uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
collecting ductSMED30007967SMESG000022672.1 Smed-slc30a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30007967SMESG000022672.1 Smed-slc30a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc30a-3 vs. Ensembl Human
Match: SLC30A2 (solute carrier family 30 member 2 [Source:HGNC Symbol;Acc:HGNC:11013])

HSP 1 Score: 335.495 bits (859), Expect = 1.849e-106
Identity = 187/369 (50.68%), Postives = 244/369 (66.12%), Query Frame = 2
Query: 1577 ELAHRDNIETDHCHS----DSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            ELA + N    HCH+    DS  D     A+R+L +AS +CL+FMI E+VGG LA+SLA+MTDAAHLL+DFAS +ISLF+L+++SRPATK M+FGW RAE++GALVSVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VN+IM  +LHQ  H H     N+                                       ++ N +VRAAFIHVIGD +QS GVL+AA+++Y+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  V++ LL +EGV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A+  L  KFH    TIQ+E+Y  DM DC+ C+ P
Sbjct:   44 ELAAQSN---HHCHAQKGPDSHCDPKKGKAQRQLYVASAICLLFMIGEVVGGYLAHSLAVMTDAAHLLTDFASMLISLFSLWMSSRPATKTMNFGWQRAEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQ---------------------------------------QEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGP 370          
BLAST of slc30a-3 vs. Ensembl Human
Match: SLC30A3 (solute carrier family 30 member 3 [Source:HGNC Symbol;Acc:HGNC:11014])

HSP 1 Score: 296.204 bits (757), Expect = 2.939e-91
Identity = 158/358 (44.13%), Postives = 225/358 (62.85%), Query Frame = 2
Query: 1610 HCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D     G+  +R+ ARR+L  A  +C +FM  E+VGG LA+SLAIMTDAAHLL+D  S M SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A +R+++ DY+IE   ML+T+ + V  NL+MA            H    P S  +    A+Y                 +      P+   N +VRAAF+HV+GDL+QSFGVL A+ +IY+KP +K ADPI TF+FSI  L +T   LRD + +LMEGTP+++ F+ V++TLL + GV   H L +W+LT      S HLA+D   + + +L EA+  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:   54 HCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMA---------FVLHQAGPPHS--HGSRGAEY---------------APLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP 385          
BLAST of slc30a-3 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 265.003 bits (676), Expect = 1.737e-80
Identity = 161/358 (44.97%), Postives = 226/358 (63.13%), Query Frame = 2
Query: 1610 HCHSDSET--DGIDRVA--RRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCHS S+    G +  A  + KL  AS +C IFMIAE+VGG +A SLA++TDAAHLL D  SF++SLF+L+L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVY+A  R++  DY I+AT+M+I S   V  N+++   LH                                          +  +  N+   + N +VRAAF+H +GDL QS  VLI+A +IY+KP +KIADPICTFIFSILVL +TI IL+D   +LMEG PKSL++  VKE +L ++GV+ +H+L IWSLT N+  LS H+A   +++ QV+ +E  + L   F +   TIQ+E+ V    DC  C+ P
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLH------------------------------------------QRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDP 318          
BLAST of slc30a-3 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 265.003 bits (676), Expect = 1.737e-80
Identity = 161/358 (44.97%), Postives = 226/358 (63.13%), Query Frame = 2
Query: 1610 HCHSDSET--DGIDRVA--RRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCHS S+    G +  A  + KL  AS +C IFMIAE+VGG +A SLA++TDAAHLL D  SF++SLF+L+L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVY+A  R++  DY I+AT+M+I S   V  N+++   LH                                          +  +  N+   + N +VRAAF+H +GDL QS  VLI+A +IY+KP +KIADPICTFIFSILVL +TI IL+D   +LMEG PKSL++  VKE +L ++GV+ +H+L IWSLT N+  LS H+A   +++ QV+ +E  + L   F +   TIQ+E+ V    DC  C+ P
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLH------------------------------------------QRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDP 318          
BLAST of slc30a-3 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 265.003 bits (676), Expect = 1.737e-80
Identity = 161/358 (44.97%), Postives = 226/358 (63.13%), Query Frame = 2
Query: 1610 HCHSDSET--DGIDRVA--RRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCHS S+    G +  A  + KL  AS +C IFMIAE+VGG +A SLA++TDAAHLL D  SF++SLF+L+L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVY+A  R++  DY I+AT+M+I S   V  N+++   LH                                          +  +  N+   + N +VRAAF+H +GDL QS  VLI+A +IY+KP +KIADPICTFIFSILVL +TI IL+D   +LMEG PKSL++  VKE +L ++GV+ +H+L IWSLT N+  LS H+A   +++ QV+ +E  + L   F +   TIQ+E+ V    DC  C+ P
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLH------------------------------------------QRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDP 318          
BLAST of slc30a-3 vs. Ensembl Celegans
Match: cdf-2 (Cation Diffusion Facilitator family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVP5])

HSP 1 Score: 280.026 bits (715), Expect = 4.131e-86
Identity = 163/375 (43.47%), Postives = 231/375 (61.60%), Query Frame = 2
Query: 1562 EIANSELAHRDNIETD--HCHSDSE-TDGID--RVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
             I N++   +  +  D  HCH +++ TD  D  R A R L +   LCL FM+ E++GG LA SLAI+TDAAHLL+DFAS +ISLF+L++A RP +++MSFG+HRAEV+GA  SV LIW+VTG+LV +A++RI++ DY +E  IM +T+ +GV+VNL+M   L+   HSH     +                                    N  +R   I+V    +  +G       VL+AA  IY++PSW I DPICT +FS++VLCTTI ILRD M VL+EG P ++DF  V  +L ++EGV  +H+LRIWSLT +K ALSVHL +D N + Q IL+E  ++L   +++ + TIQ+E + A+  DC KC  P
Sbjct:   15 HIYNTDEGRKTTVTYDNFHCHDEADSTDSHDSNRRATRILWLTVVLCLFFMVCEVIGGVLAGSLAIVTDAAHLLTDFASVLISLFSLYIARRPPSQKMSFGFHRAEVLGAFFSVFLIWIVTGVLVVLAIMRIVSGDYEVEGGIMALTAALGVVVNLVMLALLYFGGHSHSHGGGSSHGHSHGGGNG------------------------DNINVRAAFIHVLGDLLQSLG-------VLVAALFIYFQPSWVIIDPICTLVFSVIVLCTTIYILRDAMIVLLEGRPSNIDFAKVFSSLEDIEGVKKVHDLRIWSLTMDKIALSVHLEIDANSQSQSILRETRKMLKQTYNVHEITIQIEEFGANRSDCGKCDFP 358          
BLAST of slc30a-3 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 236.113 bits (601), Expect = 4.074e-69
Identity = 153/358 (42.74%), Postives = 216/358 (60.34%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA-CXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVD-PNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            H HS  E     R A + L   + L  +F+ AE VGG  A SLAIMTDA H+LSD  SF+IS+FA+  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ RI+N ++ ++A +MLIT+GVGVL N++M             TH  +      +D +N                  V VR               AA IHVIGDLVQS GVLIAA +I +   W +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D  DVK+ L  LEGV  +H+L +WS+  +KTA SVHLA++ PN+ ++ +  EA  ++  +F ++ AT+Q+E +   +D C  C+  ++
Sbjct:   87 HKHSHDEKYQKGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHFGTGGHGHTHGGHSSHGHAHDGKN------------------VNVR---------------AALIHVIGDLVQSIGVLIAALIIRFT-GWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENV-AEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQQQET 409          
BLAST of slc30a-3 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 232.646 bits (592), Expect = 7.263e-69
Identity = 153/360 (42.50%), Postives = 217/360 (60.28%), Query Frame = 2
Query: 1604 TDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA-CXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVD-PNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            TD   S  +T    R A + L   + L  +F+ AE VGG  A SLAIMTDA H+LSD  SF+IS+FA+  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ RI+N ++ ++A +MLIT+GVGVL N++M             TH  +      +D +N                  V VR               AA IHVIGDLVQS GVLIAA +I +   W +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D  DVK+ L  LEGV  +H+L +WS+  +KTA SVHLA++ PN+ ++ +  EA  ++  +F ++ AT+Q+E +   +D C  C+  ++
Sbjct:   11 TDSASSREDTG---RRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHFGTGGHGHTHGGHSSHGHAHDGKN------------------VNVR---------------AALIHVIGDLVQSIGVLIAALIIRFT-GWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENV-AEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQQQET 332          
BLAST of slc30a-3 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 233.802 bits (595), Expect = 1.576e-68
Identity = 157/385 (40.78%), Postives = 222/385 (57.66%), Query Frame = 2
Query: 1589 RDNIETDHCH--------------------SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA-CXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVD-PNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            R +I T HCH                    S S  +   R A + L   + L  +F+ AE VGG  A SLAIMTDA H+LSD  SF+IS+FA+  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ RI+N ++ ++A +MLIT+GVGVL N++M             TH  +      +D +N                  V VR               AA IHVIGDLVQS GVLIAA +I +   W +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D  DVK+ L  LEGV  +H+L +WS+  +KTA SVHLA++ PN+ ++ +  EA  ++  +F ++ AT+Q+E +   +D C  C+  ++
Sbjct:   41 RRSILTTHCHYWDENDDDMVARVERGGSTDSASSREDTGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHFGTGGHGHTHGGHSSHGHAHDGKN------------------VNVR---------------AALIHVIGDLVQSIGVLIAALIIRF-TGWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENV-AEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQQQET 390          
BLAST of slc30a-3 vs. Ensembl Celegans
Match: cdf-1 (Cation diffusion facilitator family protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95QW4])

HSP 1 Score: 71.2478 bits (173), Expect = 1.898e-12
Identity = 47/187 (25.13%), Postives = 89/187 (47.59%), Query Frame = 2
Query: 1463 MHARSKSDSVAHKDFNNSLNYQTFNNFAYKK---NQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNL 2014
            M  RS     A +D NN+ + +        K   N       L H   ++ +         G+ R     L+I  G+ +IF   E + G + +S+A++ D+ H+ +D  + +++   + +A+RP+T R+ +GW RAE +G   + + +  V  ++   AV RI+N         +L+   +G+L+NL
Sbjct:    5 MEDRSVKADKADRDDNNTTSTELLGKMRQTKVIDNCSHGTHTLEHDLRLKGEPIGKSESVKGVSR----SLIIQIGMTVIFCALEFITGVVCSSIAMLADSYHMAADVMALIVAFTCIKIATRPST-RLGYGWVRAETLGGFFNGIFMCTVCVLVFQEAVGRIINVHMITHPLQVLVIGFIGLLINL 186          

HSP 2 Score: 53.5286 bits (127), Expect = 5.373e-7
Identity = 32/117 (27.35%), Postives = 66/117 (56.41%), Query Frame = 2
Query: 2192 RKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIA---DPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAV 2533
            +  N+N+   ++H++ D   S  V+I+A  +Y+ P+WKIA   DPI +   + ++  T + +++ +   L++ TP+ LD + VK+ L  + GV  +  L +W+L   +   + H+ +
Sbjct:  337 KDKNVNIHGVWLHLLSDAFGSVIVMISAGFVYFLPTWKIAAYLDPILSISLASIMGFTAVVLVKTSGEKLLKQTPEGLDLEKVKKDLCSIVGVSKVEKLSVWTLCGQRIIAAAHVNI 453          
BLAST of slc30a-3 vs. Ensembl Fly
Match: ZnT33D (gene:FBgn0051860 transcript:FBtr0302984)

HSP 1 Score: 298.13 bits (762), Expect = 1.045e-88
Identity = 169/354 (47.74%), Postives = 240/354 (67.80%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH      G+D+ ARR L+IA  LC IF+I E++GG L+NSLAI TDAAHLL+D ASF+IS+ AL LA RP+++R+++GWHRAEV+GA+VS+  IWVVTGILVYMA++R +N+D+ ++A IMLITS + +L N+IMA  L              P   +   ++A       ++    KS  ++   K +      NINVRAA IHV+GD++QSFGV +AA +I++ P W   D +CTF+FS+LVL  T  ILRD + VLME TP  +D+++VK+T L + GV  +HNLRIW+L+ NK ALS HLA+  + + Q+IL+EAT ++  +F   + TIQ+E Y   M++C +C +P
Sbjct:  323 HCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQLQHGHSHSL------PGVHKMS-KDAGSVLGSKMILLLGKSVSMQYAAKGHE-----NINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNLRIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFKFFETTIQIEEYSPGMENCGQCLSP 664          
BLAST of slc30a-3 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080714)

HSP 1 Score: 202.216 bits (513), Expect = 2.935e-56
Identity = 95/145 (65.52%), Postives = 125/145 (86.21%), Query Frame = 2
Query: 1592 DNIET-DHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA 2023
            +N+E  DHCH  + ++G+D  ARRKL+IAS LCL+FMIAEIVGG L+NSLAI TDAAHLL+DFASFMISLFA+++A RP+T+RMSFGW+RAEV+GA+ SV +IWV+TGILV++A+ R+++ DY + A IMLITSG+ +LVN+IM 
Sbjct:   67 NNVEVRDHCHR-ARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMG 210          

HSP 2 Score: 152.91 bits (385), Expect = 3.003e-39
Identity = 79/158 (50.00%), Postives = 110/158 (69.62%), Query Frame = 2
Query: 2201 NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
            N+NVRAA IHVIGD++QS GV +AA VIY+ P + I DPICTF+FSI+VL TT  I++D + VLMEGTP  + + +V +    +EGV  +HNLRIW+L+ NK ALS HLA+  N   + IL  AT  +  +++  + TIQ+E+Y A M+ C +C  P+
Sbjct:  314 NMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQCNVPE 471          
BLAST of slc30a-3 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080715)

HSP 1 Score: 201.06 bits (510), Expect = 4.302e-56
Identity = 93/139 (66.91%), Postives = 121/139 (87.05%), Query Frame = 2
Query: 1607 DHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA 2023
            DHCH  + ++G+D  ARRKL+IAS LCL+FMIAEIVGG L+NSLAI TDAAHLL+DFASFMISLFA+++A RP+T+RMSFGW+RAEV+GA+ SV +IWV+TGILV++A+ R+++ DY + A IMLITSG+ +LVN+IM 
Sbjct:   41 DHCHR-ARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMG 178          

HSP 2 Score: 153.68 bits (387), Expect = 9.728e-40
Identity = 80/167 (47.90%), Postives = 113/167 (67.66%), Query Frame = 2
Query: 2180 NNPIRK--TNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
              P+ +   N+NVRAA IHVIGD++QS GV +AA VIY+ P + I DPICTF+FSI+VL TT  I++D + VLMEGTP  + + +V +    +EGV  +HNLRIW+L+ NK ALS HLA+  N   + IL  AT  +  +++  + TIQ+E+Y A M+ C +C  P+
Sbjct:  273 GGPVGREAVNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQCNVPE 439          
BLAST of slc30a-3 vs. Ensembl Fly
Match: ZnT33D (gene:FBgn0051860 transcript:FBtr0302985)

HSP 1 Score: 142.124 bits (357), Expect = 7.917e-36
Identity = 62/101 (61.39%), Postives = 81/101 (80.20%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTG 1912
            HCH      G+D+ ARR L+IA  LC IF+I E++GG L+NSLAI TDAAHLL+D ASF+IS+ AL LA RP+++R+++GWHRAEV+GA+VS+  IWVVTG
Sbjct:  323 HCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTG 423          
BLAST of slc30a-3 vs. Ensembl Fly
Match: ZnT41F (gene:FBgn0025693 transcript:FBtr0086054)

HSP 1 Score: 136.732 bits (343), Expect = 1.231e-33
Identity = 62/123 (50.41%), Postives = 93/123 (75.61%), Query Frame = 2
Query: 1652 ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIM 2020
            A+ K+++A  LC +FMI E +GG +A SLAIMTDAAHL SD  SF+I L A+++  RP  +RMSFG+ R EV+GAL S+L IW VT +LV +A+ RI ++D+ + A +M++ SG+G+++N++M
Sbjct:  129 AKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIVM 251          

HSP 2 Score: 105.531 bits (262), Expect = 2.329e-23
Identity = 61/143 (42.66%), Postives = 94/143 (65.73%), Query Frame = 2
Query: 2201 NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMS-KFHISDATIQLE 2626
            N+N+RAA IHVIGDLVQS GV +AA +I   P  K ADP+CT IFSI+V+ TT+ + R+++ +++   P++L+   +   L  +EGV  LH+L +W  T+ +  L VHL  D   +   +L+ AT ++ S +++I  +TIQLE
Sbjct:  352 NLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLE 494          
BLAST of slc30a-3 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 328.176 bits (840), Expect = 4.276e-104
Identity = 173/357 (48.46%), Postives = 240/357 (67.23%), Query Frame = 2
Query: 1610 HCHSDSETDGIDR---VARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH         R   +A++KL IAS +CL+FMI E++GG LA+SLAIMTDAAHLL+DF S M+SLF+L+++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVY+A+ RI+  DY IE  +ML+TSG  V+VN+IMA  LH               S  +    + Y   D               + ++      N +VRAAFIHV+GDL+QSFGV++AA +IY++P +KIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + F+ VKE LL L+ V  +H+L +W+LT +++ LSVH+A++ N + Q +LKEAT +L +KF     TIQ+E Y  DM  C +C+ P
Sbjct:   14 HCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILHH--------------STTFHSHGSGYHKIDESGMSPVGHGHSHSLLGNHG-----NTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDP 351          
BLAST of slc30a-3 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 329.331 bits (843), Expect = 6.146e-104
Identity = 180/397 (45.34%), Postives = 255/397 (64.23%), Query Frame = 2
Query: 1499 KDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETD---HCHSDSETDGIDR---VARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            K ++  LN +   +     N  + N E+A    ++     HCH         R   +A++KL IAS +CL+FMI E++GG LA+SLAIMTDAAHLL+DF S M+SLF+L+++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVY+A+ RI+  DY IE  +ML+TSG  V+VN+IMA  LH               S  +    + Y   D               + ++      N +VRAAFIHV+GDL+QSFGV++AA +IY++P +KIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + F+ VKE LL L+ V  +H+L +W+LT +++ LSVH+A++ N + Q +LKEAT +L +KF     TIQ+E Y  DM  C +C+ P
Sbjct:   19 KIYSLKLNSEFSGSKESCPNLPLGNGEMAGAIELKRPVGTHCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILHH--------------STTFHSHGSGYHKIDESGMSPVGHGHSHSLLGNHG-----NTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDP 396          
BLAST of slc30a-3 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 318.161 bits (814), Expect = 1.559e-100
Identity = 170/357 (47.62%), Postives = 236/357 (66.11%), Query Frame = 2
Query: 1610 HCHSDSETDGIDR---VARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH         R   +A++KL IAS +CL+FMI E++GG LA+SLAIMTDAAHLL+DF S M+SLF+L+++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVY+A+ RI+  DY IE  +ML+TSG  V+VN+I                     S  + ++ +  S                  +  N+     N +VRAAFIHV+GDL+QSFGV++AA +IY++P +KIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + F+ VKE LL L+ V  +H+L +W+LT +++ LSVH+A+DP    Q +LKEAT +L +KF     TIQ+E Y  DM  C +C+ P
Sbjct:   14 HCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIHG-------------------SGYHKIDESGMSPVGHGHSH---------SLLGNH----GNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIDP----QSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDP 334          
BLAST of slc30a-3 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 304.679 bits (779), Expect = 1.082e-94
Identity = 167/367 (45.50%), Postives = 243/367 (66.21%), Query Frame = 2
Query: 1592 DNIETDHCHSDS----ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXX--XXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIR-KTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            D  +  HCH ++    + +   ++A+++L I S +CL+FM+ EI+GG  A SLA+MTDAAHLL D  SF+ISL +L+L+SRPAT+ +++GWHRAE++GAL+S+  IW+VTG+LVY+AV RI+N ++ IE T+MLITSG  VL N+IMA +LHQ  H H           S ++  EN       +  D           ++   P + + N +VRAAF+HVIGDL+QS  VL++A +I++KP +KIADPICTF+FS+ VL TT  I+RD + VLMEGTP  +++++V++ LL ++GV  +HNL IW+LT N+  LS H+A D   + Q +L+E T+V  +K+     TIQLE       DC  C+ P
Sbjct:   31 DMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSAGHGHSHDHGKENGHSHSDGSHHD-----------VEEQRPGKTQANASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVATDETVDPQEVLREMTQVCFTKYSFHSVTIQLEPQADQRPDCSLCQDP 386          
BLAST of slc30a-3 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 303.523 bits (776), Expect = 2.135e-94
Identity = 167/367 (45.50%), Postives = 242/367 (65.94%), Query Frame = 2
Query: 1592 DNIETDHCHSDS----ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXX--XXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIR-KTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            D  +  HCH ++    + +   ++A+++L I S +CL+FM+ EI+GG  A SLA+MTDAAHLL D  SF+ISL +L+L+SRPAT+ +++GWHRAE++GAL+S+  IW+VTG+LVY+AV RI+N ++ IE T+MLITSG  VL N+IMA +LHQ  H H           S ++  EN       +              ++   P + + N +VRAAF+HVIGDL+QS  VL++A +I++KP +KIADPICTF+FS+ VL TT  I+RD + VLMEGTP  +++++V++ LL ++GV  +HNL IW+LT N+  LS H+ VDP    Q +L+E T+V  +K+     TIQLE       DC  C+ P
Sbjct:   29 DMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSAGHGHSHDHGKENGHSHSDGSHH-----------DVEEQRPGKTQANASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVTVDP----QEVLREMTQVCFTKYSFHSVTIQLEPQADQRPDCSLCQDP 380          
BLAST of slc30a-3 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 356.681 bits (914), Expect = 2.007e-114
Identity = 200/369 (54.20%), Postives = 253/369 (68.56%), Query Frame = 2
Query: 1577 ELAHRDNIETDHCHSDSETDGID----RVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            EL H+ N    HCHS+ E D  +    + ARRKL +AS +CL+FMI E++GG LA+SLAIMTDAAHLL+DFAS MISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV RI++ DY IE   MLITS   V VN+IM  +LHQ  H H     N                                   S+      N +VRAAFIHV+GDL+QS GVLIAA+VIYYKP +KI DPICTF+FS+LVL TT+ ILRD + VLMEGTPK +DF+ VK+TLL ++GV  LH+L IW+LT  +  LSVH+A++ N + Q +LKEA+  L +KFH    TIQ+ENY  DM DC++C+ P
Sbjct:   42 ELGHQGN---QHCHSNRELDDWNAKEKKRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLHQTGHGHSHGDGNS-------------------------------HSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQECQDP 376          
BLAST of slc30a-3 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 356.295 bits (913), Expect = 2.374e-114
Identity = 200/369 (54.20%), Postives = 253/369 (68.56%), Query Frame = 2
Query: 1577 ELAHRDNIETDHCHSDSETDGID----RVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            EL H+ N    HCHS+ E D  +    + ARRKL +AS +CL+FMI E++GG LA+SLAIMTDAAHLL+DFAS MISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV RI++ DY IE   MLITS   V VN+IM  +LHQ  H H     N                                   S+      N +VRAAFIHV+GDL+QS GVLIAA+VIYYKP +KI DPICTF+FS+LVL TT+ ILRD + VLMEGTPK +DF+ VK+TLL ++GV  LH+L IW+LT  +  LSVH+A++ N + Q +LKEA+  L +KFH    TIQ+ENY  DM DC++C+ P
Sbjct:   41 ELGHQGN---QHCHSNRELDDWNAKEKKRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLHQTGHGHSHGDGNS-------------------------------HSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQECQDP 375          
BLAST of slc30a-3 vs. Ensembl Xenopus
Match: ENSXETT00000033890.1 (solute carrier family 30 (zinc transporter), member 3 [Source:NCBI gene;Acc:100497671])

HSP 1 Score: 323.939 bits (829), Expect = 1.083e-101
Identity = 176/384 (45.83%), Postives = 253/384 (65.89%), Query Frame = 2
Query: 1532 FNNFAYKKNQEIANSELAHRDNIETDHCH----SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            F +F ++      + EL   +     HCH    S +ET+     ARRKL  A  +C IFMI E+VGG+LA+SLAIMTDAAHLL+D  S  +S+F+L++++RP TK M+FGWHR+E++GAL SVL IW+VTG+LVY+A  RI+N DY+I+  +MLITSG  V VN+IMA               + PL       +     S      +  S+ + +R+   +     N +VRAAFIHVIGDL+QS GV++AA VIY+KP +KIADP+CTF+FSI VL TT+ ILRD   VLMEG P+ + +  VKE LL + GV  +H+LR+W+LT ++ A++VHLA+D + E +  ++EAT +L S+F +  +T+Q+E Y+ +M++C +C+ P
Sbjct:   35 FPDFPFQNGSPAVSIEL---ERPVPRHCHGASLSSAETNQ-KLQARRKLYFACAVCFIFMIGEVVGGSLAHSLAIMTDAAHLLTDLGSMCVSIFSLWISTRPPTKSMNFGWHRSEILGALASVLSIWIVTGVLVYLAAARIINNDYDIDGHVMLITSGCAVGVNVIMA----------YILHQSSPL-------HGHSHGSGYEKIGESPSNSLALRLGGPH----GNTSVRAAFIHVIGDLLQSIGVMVAAIVIYFKPQYKIADPLCTFLFSIFVLATTVTILRDVFWVLMEGAPRGIAYGSVKEVLLSVRGVRSVHSLRLWALTLSQNAVTVHLAIDESTEPESAVREATELLRSQFELCHSTVQVERYLEEMEECPQCRDP 393          
BLAST of slc30a-3 vs. Ensembl Xenopus
Match: nbr1 (neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GENE-949692])

HSP 1 Score: 283.493 bits (724), Expect = 9.888e-87
Identity = 164/381 (43.04%), Postives = 240/381 (62.99%), Query Frame = 2
Query: 1550 KKNQEIANSELAHRDNIETD-HCHSDSET--DGIDR---VARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXX-XXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            +KN   +   L   +N ++  HCH++++   D   R    A++KL IAS +C +F+ AEIVGG +A SLA++TDAAHLL D +SF ISL +L+L+S+ +T R++FGWHRAE++GAL+SV+ IW+VTG+LVY+A  R++  DY I+ T+MLITS   +  NL++A  LHQ           +E ++ EY  +                                TN ++RAAFIHVIGDL QS  VLI+A +IY+KP +K+ADPICTFIFSI VL TT+ +LRD + VLMEGTP+ + + DVK+++L+++GV  +H+L +W+LT N+  LS H+A D   E + ILK+ T+ + ++F     TIQ+E       +C  C  P
Sbjct:   25 EKNHP-SKPPLQDEENPQSKYHCHNNNKKAYDARQREQTFAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSKSSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACALGANLVLALILHQSGHGHSHAGGKHEHMASEYKPQ--------------------------------TNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILDVDGVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIEDQSPECMFCYEP 372          
BLAST of slc30a-3 vs. Ensembl Xenopus
Match: gmip (GEM interacting protein [Source:Xenbase;Acc:XB-GENE-977540])

HSP 1 Score: 227.639 bits (579), Expect = 1.370e-65
Identity = 145/372 (38.98%), Postives = 221/372 (59.41%), Query Frame = 2
Query: 1589 RDNIETDHC-----HSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA---CXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPN-----KEVQVILKEATRVLMSKFHISDATIQLENYVADMDD-CKKC 2662
            ++ ++T+ C     H +    G     +RKLL+A+ L L+FM+ E+VGG +ANSLAIMTDA H+LSD +S +++L AL L+S+P  KR +FG+HR EV+ A+VSV+L++++TG L+Y A+ R ++ DYNI   +MLIT+ VGV VNLIM         H         N P                                 S +     ++ VRAAF+H +GDL QS GVLIAA++I +KP +KIADPICT+IFS+LV+ TT+ ++ DT+ +++EG P+ L+ D +K+ L+++E V  + +L +WSLTT K+A  +HL + P+     +EVQ    +A  VL+    +    IQ+++Y  +    C  C
Sbjct:   85 QNRVKTEPCEKCSNHRERRKQG---KVKRKLLLAAALYLLFMVGELVGGYVANSLAIMTDALHMLSDLSSIILTLLALCLSSKPPNKRFTFGFHRLEVLSAIVSVILVYILTGFLLYEAIQRTIHMDYNINGDVMLITAAVGVAVNLIMGILLSQSGHHHSHSHGPAANSP---------------------------------SPHGHSHGSLAVRAAFVHALGDLAQSIGVLIAAYIIRFKPEYKIADPICTYIFSVLVVFTTVRLVWDTVLIILEGVPRHLNVDRIKDDLMKIEDVYSVKDLNVWSLTTGKSAAIIHLQLCPDASSKWEEVQ---NKARHVLLKTHGMYKCFIQIQSYGQEESTRCTDC 417          
BLAST of slc30a-3 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 332.413 bits (851), Expect = 2.077e-105
Identity = 189/363 (52.07%), Postives = 242/363 (66.67%), Query Frame = 2
Query: 1598 IETDH-CH----SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            ++++H CH    S S  D   + ARRKL +AS +CL+FMI EI+GG LA SLAIMTDAAHLL+DFAS +ISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VNLIM  +LHQ  H H      +  S++                               NP      +VRAAFIHVIGDL+QS GVL+AA++IY+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  VK  LL ++GV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A   L  KF+    TIQ+E Y  DM +C+ C+ P
Sbjct:   43 VQSNHYCHAQKDSGSHPDPEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDSSQQ------------------------------QNP------SVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGP 369          
BLAST of slc30a-3 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 304.294 bits (778), Expect = 7.648e-96
Identity = 173/325 (53.23%), Postives = 218/325 (67.08%), Query Frame = 2
Query: 1697 MIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            MI EI+GG LA SLAIMTDAAHLL+DFAS +ISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VNLIM  +LHQ  H H      +  S++                               NP      +VRAAFIHVIGDL+QS GVL+AA++IY+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  VK  LL ++GV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A   L  KF+    TIQ+E Y  DM +C+ C+ P
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDSSQQ------------------------------QNP------SVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGP 289          
BLAST of slc30a-3 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 304.294 bits (778), Expect = 7.648e-96
Identity = 173/325 (53.23%), Postives = 218/325 (67.08%), Query Frame = 2
Query: 1697 MIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            MI EI+GG LA SLAIMTDAAHLL+DFAS +ISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VNLIM  +LHQ  H H      +  S++                               NP      +VRAAFIHVIGDL+QS GVL+AA++IY+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  VK  LL ++GV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A   L  KF+    TIQ+E Y  DM +C+ C+ P
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDSSQQ------------------------------QNP------SVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGP 289          
BLAST of slc30a-3 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 284.648 bits (727), Expect = 8.305e-88
Identity = 162/358 (45.25%), Postives = 228/358 (63.69%), Query Frame = 2
Query: 1610 HCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D     G+  +RV ARR+L  A  +C IFM  E+VGG LA+SLAIMTDAAHLL+D  S + SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A LR+++ DY+IEA  ML+T+ + V  NL+MA            H    P S  +    A+Y                 +      P+   N +VRAAF+HV+GDL+QSFGVL A+ +IY+KP +K+ADPI TF+FSI  L +T   LRD + VLMEG P+S++F+ V++TLL + GV   H+L +W+LT      S HLA+D   + + +L EA+  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:    5 HCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMA---------FVLHQTGAPHS--HGSTGAEY---------------APLEEGHGYPMSLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP 336          
BLAST of slc30a-3 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 285.034 bits (728), Expect = 2.665e-87
Identity = 162/364 (44.51%), Postives = 230/364 (63.19%), Query Frame = 2
Query: 1592 DNIETDHCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            + +   HCH D     G+  +RV ARR+L  A  +C IFM  E+VGG LA+SLAIMTDAAHLL+D  S + SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A LR+++ DY+IEA  ML+T+ + V  NL+MA            H    P S  +    A+Y                 +      P+   N +VRAAF+HV+GDL+QSFGVL A+ +IY+KP +K+ADPI TF+FSI  L +T   LRD + VLMEG P+S++F+ V++TLL + GV   H+L +W+LT      S HLA+D   + + +L EA+  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:   48 EGMAFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMA---------FVLHQTGAPHS--HGSTGAEY---------------APLEEGHGYPMSLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP 385          
BLAST of slc30a-3 vs. UniProt/SwissProt
Match: sp|Q2HJ10|ZNT2_MOUSE (Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc30a2 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.453e-104
Identity = 189/363 (52.07%), Postives = 242/363 (66.67%), Query Frame = 2
Query: 1598 IETDH-CH----SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            ++++H CH    S S  D   + ARRKL +AS +CL+FMI EI+GG LA SLAIMTDAAHLL+DFAS +ISLFAL+++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VNLIM  +LHQ  H H      +  S++                               NP      +VRAAFIHVIGDL+QS GVL+AA++IY+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  VK  LL ++GV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A   L  KF+    TIQ+E Y  DM +C+ C+ P
Sbjct:   43 VQSNHYCHAQKDSGSHPDPEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDSSQQ------------------------------QNP------SVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGP 369          
BLAST of slc30a-3 vs. UniProt/SwissProt
Match: sp|Q62941|ZNT2_RAT (Zinc transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc30a2 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 5.743e-103
Identity = 187/369 (50.68%), Postives = 244/369 (66.12%), Query Frame = 2
Query: 1577 ELAHRDNIETDHCH----SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            ELA + N    +CH    S S  +   + ARRKL +AS +CL+FMI EI+GG LA SLAIMTDAAHLL+DFAS +ISLF+L+++SRPATK M+FGW RAE++GAL+SVL IWVVTG+LVY+AV R+++ DY I+   MLITSG  V VN+IM  +LHQ  H H     +E  S++                                   + N +VRAAFIHV+GDL+QS GVL+AA++IY+KP +K  DPICTF+FSILVL TT+ ILRD + VLMEGTPK +DF  VK  LL ++GV  LH+L IW+LT  +  LSVH+A+  N + Q +LK A   L  KF+    TIQ+E+Y  DM  C++C+ P
Sbjct:   27 ELAVQSN---HYCHAQKDSGSHPNSEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALHQSGHGHSHGHSHEDSSQQ-----------------------------------QQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGP 357          
BLAST of slc30a-3 vs. UniProt/SwissProt
Match: sp|Q08E25|ZNT3_BOVIN (Zinc transporter 3 OS=Bos taurus OX=9913 GN=SLC30A3 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.275e-92
Identity = 162/358 (45.25%), Postives = 227/358 (63.41%), Query Frame = 2
Query: 1610 HCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D     G+  +R+ A+R+L  A  +C +FM  E+VGG LA+SLAIMTDAAHLL+D  S M SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A +R+++ DY+IE   ML+T+ + V  NL+MA            H    P S  +    A+Y                 +   S  P+   N +VRAAF+HV+GDL+QS GVLIA+ +IY+KP +K ADPI TF+FSI  L +T   LRD + VLMEGTP+S+ F+ V++TLL + GV  +H L +WSLT      S HLA+D   + + +L EAT  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:   54 HCHRDPLPQPGLTPERMQAQRQLCTACAVCCVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFIRLLHSDYHIEGGAMLLTASIAVCANLLMA---------FVLHQAGPPHS--HGSRGAEY---------------APLEEGSGEPLPLGNTSVRAAFVHVLGDLLQSLGVLIASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRVLMEGTPRSVSFEPVRDTLLSVPGVRAIHELHLWSLTFTHYVASAHLAIDSTADPEAVLAEATSRLHSRFGFSSCTLQVEQYQPEMAQCLRCQEP 385          
BLAST of slc30a-3 vs. UniProt/SwissProt
Match: sp|Q5R617|ZNT3_PONAB (Zinc transporter 3 OS=Pongo abelii OX=9601 GN=SLC30A3 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.032e-90
Identity = 158/358 (44.13%), Postives = 226/358 (63.13%), Query Frame = 2
Query: 1610 HCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D     G+  +R+ ARR+L  A  +C +FM  E+VGG LA+SLAIMTDAAHLL+D  S M SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A +R+++ DY+IE   ML+T+ + V  NL+MA            H    P S  +  + A+Y                 +      P+   N +VRAAF+HV+GDL+QSFGVL A+ +IY+KP +K ADPI TF+FSI  L +T   LRD + +LMEGTP+++ F+ V++TLL + GV   H L +W+LT      S HLA+D   + + +L EA+  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:   54 HCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMA---------FVLHQAGPPHS--HGSKGAEY---------------APLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP 385          
BLAST of slc30a-3 vs. UniProt/SwissProt
Match: sp|Q99726|ZNT3_HUMAN (Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC30A3 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.411e-90
Identity = 158/358 (44.13%), Postives = 225/358 (62.85%), Query Frame = 2
Query: 1610 HCHSDS-ETDGI--DRV-ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D     G+  +R+ ARR+L  A  +C +FM  E+VGG LA+SLAIMTDAAHLL+D  S M SLF+L+L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+Y+A +R+++ DY+IE   ML+T+ + V  NL+MA            H    P S  +    A+Y                 +      P+   N +VRAAF+HV+GDL+QSFGVL A+ +IY+KP +K ADPI TF+FSI  L +T   LRD + +LMEGTP+++ F+ V++TLL + GV   H L +W+LT      S HLA+D   + + +L EA+  L S+F  S  T+Q+E Y  +M  C +C+ P
Sbjct:   54 HCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMA---------FVLHQAGPPHS--HGSRGAEY---------------APLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP 385          
BLAST of slc30a-3 vs. TrEMBL
Match: A0A0H3YKE2 (Slc30a-3 OS=Schmidtea mediterranea OX=79327 GN=slc30a-3 PE=2 SV=1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 405/405 (100.00%), Postives = 405/405 (100.00%), Query Frame = 2
Query: 1463 MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS
Sbjct:    1 MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 405          
BLAST of slc30a-3 vs. TrEMBL
Match: A0A0H3YKE4 (Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc30a-8 PE=2 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 3.885e-135
Identity = 222/356 (62.36%), Postives = 274/356 (76.97%), Query Frame = 2
Query: 1604 TDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            +DHCH  SE  G+D+ AR+KLL+AS LCLIFMI EIVGG +A+SLAIMTDAAHLL+DFASFMISLFA++LASRPATKRMSFGWHRAEV+GALVSVL+IWVVTGILVY+AV+R+++ ++ IE  IMLITS  G+++NLIMA +LHQH H+H +   N    +E+                            S+    K NINVRAAFIHVIGDLVQS GV IAA VIY KP +KIADPICTFIFSILVL TTINILRDTM VLMEGTPK LDF++VK    +L GV+ +HNLR+WSLT +KTALSVH+A+DP++E   IL++A+ +L  +F I+D TIQLENYV++M +C++C+ P
Sbjct:   53 SDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHG--------------------------HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 382          
BLAST of slc30a-3 vs. TrEMBL
Match: A0A4V3SEZ4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005297 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 6.832e-124
Identity = 214/363 (58.95%), Postives = 267/363 (73.55%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNE--PLS---EEYDVENAQYXXXXXXXXXXXXXXXVE----VRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D+   GID+ A+RKLLIASGLCL FMI E+VGG LA SLAIMTDAAHLL+DFASF+ISL ALFLA RP+TK+MSFGWHRAEV+GAL SVL+IW+VTGILVY+AV+RIMN  Y+I+  IMLITS VGV VN+IM  +LH H H H      E  PL+     +D  +A  +  D      +     E    V  K     ++ NI VRAA IHVIGDLVQS GV+IAA +IY++P  K+ DPICTF+FSILVL TTIN+LRD ++VLME TP+ LDF+DVK  L ++ GVV LHNLR+WSLTTNKTA+SVHLA++P  + Q IL +A+ +L  ++ + + TIQLE Y A+M DC++C+ P
Sbjct:   47 HCHDDTTDRGIDKRAKRKLLIASGLCLCFMIGEVVGGALAQSLAIMTDAAHLLTDFASFLISLLALFLAQRPSTKKMSFGWHRAEVVGALASVLMIWLVTGILVYLAVMRIMNNHYDIDGKIMLITSAVGVAVNIIMLLTLHDHGHGHSHAAPKETSPLTAIGHTHDSVHANGTKLDHEKHSHQHEHGGEHVHQVSPKLEQENKRQNITVRAALIHVIGDLVQSVGVMIAAMIIYFRPHLKVVDPICTFLFSILVLITTINVLRDALSVLMEATPRGLDFNDVKNALNDVPGVVELHNLRMWSLTTNKTAVSVHLAIEPQVDPQEILYQASTILRKRYLVHEVTIQLEPYSAEMADCQRCQEP 409          
BLAST of slc30a-3 vs. TrEMBL
Match: A0A4S2LRS6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005297 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 8.308e-124
Identity = 214/363 (58.95%), Postives = 267/363 (73.55%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNE--PLS---EEYDVENAQYXXXXXXXXXXXXXXXVE----VRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D+   GID+ A+RKLLIASGLCL FMI E+VGG LA SLAIMTDAAHLL+DFASF+ISL ALFLA RP+TK+MSFGWHRAEV+GAL SVL+IW+VTGILVY+AV+RIMN  Y+I+  IMLITS VGV VN+IM  +LH H H H      E  PL+     +D  +A  +  D      +     E    V  K     ++ NI VRAA IHVIGDLVQS GV+IAA +IY++P  K+ DPICTF+FSILVL TTIN+LRD ++VLME TP+ LDF+DVK  L ++ GVV LHNLR+WSLTTNKTA+SVHLA++P  + Q IL +A+ +L  ++ + + TIQLE Y A+M DC++C+ P
Sbjct:   22 HCHDDTTDRGIDKRAKRKLLIASGLCLCFMIGEVVGGALAQSLAIMTDAAHLLTDFASFLISLLALFLAQRPSTKKMSFGWHRAEVVGALASVLMIWLVTGILVYLAVMRIMNNHYDIDGKIMLITSAVGVAVNIIMLLTLHDHGHGHSHAAPKETSPLTAIGHTHDSVHANGTKLDHEKHSHQHEHGGEHVHQVSPKLEQENKRQNITVRAALIHVIGDLVQSVGVMIAAMIIYFRPHLKVVDPICTFLFSILVLITTINVLRDALSVLMEATPRGLDFNDVKNALNDVPGVVELHNLRMWSLTTNKTAVSVHLAIEPQVDPQEILYQASTILRKRYLVHEVTIQLEPYSAEMADCQRCQEP 384          
BLAST of slc30a-3 vs. TrEMBL
Match: A0A4S2LRT4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005297 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 9.013e-124
Identity = 214/363 (58.95%), Postives = 267/363 (73.55%), Query Frame = 2
Query: 1610 HCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNE--PLS---EEYDVENAQYXXXXXXXXXXXXXXXVE----VRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH D+   GID+ A+RKLLIASGLCL FMI E+VGG LA SLAIMTDAAHLL+DFASF+ISL ALFLA RP+TK+MSFGWHRAEV+GAL SVL+IW+VTGILVY+AV+RIMN  Y+I+  IMLITS VGV VN+IM  +LH H H H      E  PL+     +D  +A  +  D      +     E    V  K     ++ NI VRAA IHVIGDLVQS GV+IAA +IY++P  K+ DPICTF+FSILVL TTIN+LRD ++VLME TP+ LDF+DVK  L ++ GVV LHNLR+WSLTTNKTA+SVHLA++P  + Q IL +A+ +L  ++ + + TIQLE Y A+M DC++C+ P
Sbjct:   47 HCHDDTTDRGIDKRAKRKLLIASGLCLCFMIGEVVGGALAQSLAIMTDAAHLLTDFASFLISLLALFLAQRPSTKKMSFGWHRAEVVGALASVLMIWLVTGILVYLAVMRIMNNHYDIDGKIMLITSAVGVAVNIIMLLTLHDHGHGHSHAAPKETSPLTAIGHTHDSVHANGTKLDHEKHSHQHEHGGEHVHQVSPKLEQENKRQNITVRAALIHVIGDLVQSVGVMIAAMIIYFRPHLKVVDPICTFLFSILVLITTINVLRDALSVLMEATPRGLDFNDVKNALNDVPGVVELHNLRMWSLTTNKTAVSVHLAIEPQVDPQEILYQASTILRKRYLVHEVTIQLEPYSAEMADCQRCQEP 409          
BLAST of slc30a-3 vs. Ensembl Cavefish
Match: slc30a2 (zinc transporter 2 [Source:NCBI gene;Acc:103036936])

HSP 1 Score: 321.627 bits (823), Expect = 4.698e-101
Identity = 174/385 (45.19%), Postives = 246/385 (63.90%), Query Frame = 2
Query: 1526 QTFNNFAYKKNQEIANSELAHRDNIETDHCHSDS---ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            +++ N  ++        EL         HCH      E +    VA++KL IAS +CL+FMI E++GG LA+SLAIMTDAAHLL+DF S M+SLF+L+++SRP TK M+FG+HR+E++GA +SV+ IW+VTG+LVY+A+ RI+  DY IE  +ML+TSG  V+VN+IMA  LH               S  +    + Y   D               +  +      N +VRAAFIHV+GDL+QSFGVL+AA +IY++P +K+ADPICTF+FS+ VL TTI ILRD   +LMEG P+ ++F+ VKE LL L+ V  +H+L +W+LT  ++ +SVH+A++ N + Q +LKEAT +L +KF     TIQ+E Y  DM  C  C+ P
Sbjct:   34 ESYPNLPFENGDTAGAIELKRPTG---THCHGKKTAWEENREKLVAKKKLYIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGFHRSEILGAFISVMSIWIVTGVLVYLAIERIVKNDYEIEGHVMLLTSGCAVVVNIIMAYILHH--------------STTFHGHGSGYHKIDENGMSPVGHGHSHSLLSGHG-----NTSVRAAFIHVLGDLLQSFGVLVAAIIIYFRPEYKVADPICTFLFSVFVLGTTITILRDVFRILMEGAPRGIEFNSVKEVLLSLKAVKAIHSLHLWALTVGQSLVSVHVAIEENADHQSVLKEATELLQTKFGFYSTTIQIEPYCEDMAYCTLCQDP 396          
BLAST of slc30a-3 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 309.301 bits (791), Expect = 1.951e-96
Identity = 169/369 (45.80%), Postives = 237/369 (64.23%), Query Frame = 2
Query: 1601 ETDHCHSDS----ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKT-------NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
            ++ HCH  S    + +   +VAR++L I S +CL+FM+ EI+GG  A SLA+MTDAAHLL DF SF+ISL +L+L+SRPAT  +++GWHRAE++GAL+SV  IW+VTG+LVY+AV R+++ DY IE T+MLITSG  VL N+IMA       H       +  LS +    +          +             S+NP  KT       N +VRAAF+HVIGDL+QS  VL++A +I+++P +K+ADPICTF+FS+ VL TT  I+RD + VLMEGTP  +D+ +V+E LL ++GV  +HNL IW+LT N+  LS H+A+D   E QV+L+E T+   + +     TIQLE       DC  C+ P+
Sbjct:   36 DSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVFTIWLVTGVLVYLAVERLISDDYEIEGTVMLITSGCAVLANIIMA----LTLHQSGHGHSHGGLSSQ---GHGHSHSGAHSHEKKNGHSHAYANGDSHNPENKTTGKKTQENASVRAAFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDCTLCQDPK 397          
BLAST of slc30a-3 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 287.73 bits (735), Expect = 5.929e-89
Identity = 163/361 (45.15%), Postives = 221/361 (61.22%), Query Frame = 2
Query: 1610 HCH-------SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH        + E  G    A RKLLI S LCL+FMI E++GG  A+SLA+MTDAAHLL+DF S +ISLF+L+++SRPA+K M++GWHR+EV+G L+SVL IW VT +LV++A+ RI+  DY I +  MLITSG  V+VN++MA              H  P                        +        SN  +R       AAFIHV+GDL+QS GV +AA +IY+ P WKIADP+CTF+FSIL+L TT  IL+D   +LMEGTP  +DFD VKE LL + GV  +H+L +W+LT ++  +SVH  +D     Q +L + T +L S F+  + TIQ+E Y  D   C++C+ P
Sbjct:   35 HCHNSRAAWAQNEEKSG----AWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMA-----------LILHQSP------------------------AHHGHSHGHSNTSVR-------AAFIHVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRECQDP 349          
BLAST of slc30a-3 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 281.952 bits (720), Expect = 1.484e-86
Identity = 160/361 (44.32%), Postives = 218/361 (60.39%), Query Frame = 2
Query: 1610 HCH-------SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH        + E  G    A RKLLI S LCL+FMI E++GG  A+SLA+MTDAAHLL+DF S +ISLF+L+++SRPA+K M++GWHR+EV+G L+SVL IW VT +LV++A+ RI+  DY I +  MLITSG  V+VN++MA              H  P                        +        SN  +R   I       HV+GDL+QS GV +AA +IY+ P WKIADP+CTF+FSIL+L TT  IL+D   +LMEGTP  +DFD VKE LL + GV  +H+L +W+LT ++  +SVH  +D     Q +L + T +L S F+  + TIQ+E Y  D   C++C+ P
Sbjct:   48 HCHNSRAAWAQNEEKSG----AWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMA-----------LILHQSP------------------------AHHGHSHGHSNTSVRAAFI-------HVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRECQDP 362          
BLAST of slc30a-3 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 236.113 bits (601), Expect = 7.628e-70
Identity = 141/362 (38.95%), Postives = 209/362 (57.73%), Query Frame = 2
Query: 1601 ETDHCHSDS----ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
            ++ HCH  S    + +   +VAR++L I S +CL+FM+ EI+GG  A SLA+MTDAAHLL DF SF+ISL +L+L+SRPAT  +++GWHRAE++GAL+SV                           TI L+T   GVLV L +                   +S++Y++E      +            + +     +     + +  +AF+HVIGDL+QS  VL++A +I+++P +K+ADPICTF+FS+ VL TT  I+RD + VLMEGTP  +D+ +V+E LL ++GV  +HNL IW+LT N+  LS H+A+D   E QV+L+E T+   + +     TIQLE       DC  C+ P+
Sbjct:   36 DSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVF--------------------------TIWLVT---GVLVYLAV----------------ERLISDDYEIEGTVMLITSGCAVLANIIMALTL-----HQSGHGHGHSHSAFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDCTLCQDPK 347          
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 308.145 bits (788), Expect = 8.954e-97
Identity = 175/364 (48.08%), Postives = 239/364 (65.66%), Query Frame = 2
Query: 1610 HCHSDS-----ETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHR-AEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIR--KTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            +CH+        ++G  R ARRKL IA+ +CL+FM  EI GG LA+SLAIMTDAAHL +DFASF ISLF+L+++SRP TK M+FGW+R  E++GAL+SVL IWVVTG+LVY+A LR++ KD+ IE T ML+TSG  + VN+IM+ +L+Q +H H         +E   +  A+                         P+   + N +VRAAFIHV+GDL+QS GVLIAA VIY +P +KIADPICTF+FS  VL TT+ ILRD + VLMEG P+++ F DV+E LL L  V  +H++ +WSLT N  A+  H+ VD   + + +++EAT VL ++F  S  TIQ+E +  DM  C+ C+ P  
Sbjct:   50 YCHARGARNTDRSEGERRHARRKLCIAAVICLLFMAGEIFGGFLAHSLAIMTDAAHLFADFASFSISLFSLWVSSRPPTKTMNFGWYRMPEILGALLSVLTIWVVTGVLVYLASLRLIYKDFEIEGTAMLVTSGCAIAVNVIMSFTLYQANHLHSHGGVTADATEPKPLTMAE------------------------GPVSGPQANPSVRAAFIHVVGDLLQSIGVLIAACVIYAEPEYKIADPICTFVFSFFVLFTTVTILRDVLLVLMEGAPRAVKFTDVQEALLALPHVCSVHDVHLWSLTINHCAICAHVCVDDIGKGEEVVREATVVLQTRFSFSVLTIQVEKFTEDMHSCRDCQEPSG 389          
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 175.252 bits (443), Expect = 2.046e-50
Identity = 95/216 (43.98%), Postives = 137/216 (63.43%), Query Frame = 2
Query: 1652 ARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPS 2299
            A+R+L + S +C +F+I E VGG LA+SLAIMTD AHLL+DFASF ISL +L+LA RP +KRM+FGW+RAE++GAL+S+  IWVVTG+LVY+A  R++++D+ IE T ML TS   V+VN++                        + V +  +S                  ++S+     +N ++RAAFIH +GDL+QS GVL+AA +I++K S
Sbjct:    2 AKRQLYLVSVICFVFIIGEAVGGILAHSLAIMTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVNIMCV--------------------RLHTVSHHGHS-----------------HLQSH-----SNPSIRAAFIHALGDLLQSIGVLVAACIIFFKVS 175          
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 155.606 bits (392), Expect = 5.537e-44
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 2
Query: 1745 MTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRK-TNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIAD 2314
            MTD AHLL+DFASF ISL +L+LA RP +KRM+FGW+RAE++GAL+S+  IWVVTG+LVY+A  R++++D+ IE T ML TS   V+VN+IMA  L +  HS      +E                            V + +  ++ ++  +N ++RAAFIH +GDL+QS GVL+AA +I++KP   + +
Sbjct:    1 MTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVNIIMAVLLARGHHSSGPSGDSE------------------------APPAVPLHLHGHSHLQSHSNPSIRAAFIHALGDLLQSIGVLVAACIIFFKPPLPMPE 167          
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 75.0998 bits (183), Expect = 7.428e-15
Identity = 74/306 (24.18%), Postives = 136/306 (44.44%), Query Frame = 2
Query: 1640 IDRVARRKLLIASGLCL--IFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKP-------SWKI-ADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHL 2527
            + R + R   +   LC   +F + E+V G + NSLA++ D+ ++LSD  S    L +  LA  PAT R ++G  R EV+ AL +   +  ++  +   A+  +   D      ++LI   +G+ VNL             +       L   +   NA     D       +     V+    N      IN+R   +H +GD + S  V+I A +   +P       +W+   DP  T   +++++ + + ++R+   +L++  P  +   D+++ L  + GV  +H L +W LT  +   SVH+
Sbjct:    1 MGRYSGRSFRLICMLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFLVALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVNL-------TGLMLFQDCFSCSRLCARF---NAAEGTDDRKPRTGDEEMGASVKRSKENA-----INIRGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHI 291          
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 65.4698 bits (158), Expect = 1.654e-11
Identity = 72/323 (22.29%), Postives = 139/323 (43.03%), Query Frame = 2
Query: 1640 IDRVARRKLLIASGLCL--IFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNL--------IMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNN---PIRKTNINVRAA-FIHVIGDLVQSFGVLIAAFVIYYKP-------SWKI-ADPICTFIFSILVLCTTINILRDTMNVLMEGTP-----KSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHL 2527
            + R + R   +   LC   +F + E+V G + NSLA++ D+ ++LSD  S    L +  LA  PAT R ++G  R EV+ AL +   +  ++  +   A+  +   D      ++LI   +G+ VNL          +CS      +      +         +N                   + R +++N     R  ++  R    +H +GD + S  V+I A +   +P       +W+   DP  T   +++++ + + ++R+   +L++  P     K + +   ++ L  + GV  +H L +W LT  +   SVH+
Sbjct:    1 MGRYSGRSFRLICMLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFLVALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVNLTGLMLFQDCFSCSRLCARFNAAEGTDDRKPRTGDKSKNPSPLKH-------------QCRRRTHNYSGVTRAAHVRRRPGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIGWGPAEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHI 310          
BLAST of slc30a-3 vs. Ensembl Yeast
Match: COT1 (Vacuolar transporter that mediates zinc transport into the vacuole; overexpression confers resistance to cobalt and rhodium; protein abundance increases in response to DNA replication stress; COT1 has a paralog, ZRC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005843])

HSP 1 Score: 66.2402 bits (160), Expect = 8.931e-12
Identity = 46/168 (27.38%), Postives = 91/168 (54.17%), Query Frame = 2
Query: 2192 RKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKP-SWK-IADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS*RLN 2689
            RK ++N+   F+HV+GD + + GV+++AF I+    SWK   DP+ + I + ++  + + +      +L++ TP +L  D V+  LL++ G++ +H+  IW+LT +    S+H+ +D + E    L +  R  + ++ I  AT+Q E    ++   ++    Q   L 
Sbjct:  235 RKRSLNMHGVFLHVLGDALGNIGVMLSAFFIWKTDYSWKYYTDPLVSLIITGIIFSSALPLSCKASKILLQATPSTLSGDQVEGDLLKIPGIIAIHDFHIWNLTESIFIASLHIQLDISPEQFTDLAKIVRSKLHRYGIHSATLQPEFITREVTSTERAGDSQGDHLQ 402          

HSP 2 Score: 57.3806 bits (137), Expect = 6.162e-9
Identity = 42/126 (33.33%), Postives = 76/126 (60.32%), Query Frame = 2
Query: 1646 RVARRKLLIASGLCL--IFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLA-SRPATKRMSFGWHRAEVMGALV-SVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVN 2011
            ++  +++ I S L L  +F   EI  G L++SLA++ D+ H+L+D  S +++L+A+ +A +R      ++GW RAE++GAL+ +V LI +   IL+  A+ RI+     IE    ++  GV  L++
Sbjct:    2 KLGSKQVKIISLLLLDTVFFGIEITTGYLSHSLALIADSFHMLNDIISLVVALWAVNVAKNRNPDSTYTYGWKRAEILGALINAVFLIALCVSILI-EALQRIIAPPV-IENPKFVLYVGVAGLIS 125          
BLAST of slc30a-3 vs. Ensembl Yeast
Match: ZRC1 (Vacuolar membrane zinc transporter; transports zinc from cytosol to vacuole for storage; also has role in resistance to zinc shock resulting from sudden influx of zinc into cytoplasm; human ortholog SLC30A10 functions as a Mn transporter and mutations in SLC30A10 cause neurotoxic accumulation of Mn in liver and brain; ZRC1 has a paralog, COT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004856])

HSP 1 Score: 58.5362 bits (140), Expect = 2.813e-9
Identity = 34/126 (26.98%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 1649 VARRKLLIASGLCL--IFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLA-SRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLI 2017
            +  ++L I S L L  +F + EI  G +++SLA++ D+ H+L+D  S +++L+A+ +A +R    + ++GW RAE++GAL++ + +  +   ++  A+ R++         ++L     G++ N++
Sbjct:    2 ITGKELRIISLLTLDTVFFLLEITIGYMSHSLALIADSFHMLNDIISLLVALWAVDVAKNRGPDAKYTYGWKRAEILGALINAVFLIALCFSIMIEALQRLIEPQEIQNPRLVLYVGVAGLISNVV 127          

HSP 2 Score: 56.9954 bits (136), Expect = 7.712e-9
Identity = 42/161 (26.09%), Postives = 89/161 (55.28%), Query Frame = 2
Query: 2174 KSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKP-SWK-IADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDD 2650
            +S  P  ++ +N+   F+HV+GD + + GV+ AA  I+    SW+  +DPI + I +I++  + + + R    +L++ TP ++  D ++  +L + GV+ +H+  +W+LT +    S+H+ +D   +  +   +  R +  +  I  AT+Q E    D+++
Sbjct:  221 ESKKPGHRS-LNMHGVFLHVLGDALGNIGVIAAALFIWKTEYSWRYYSDPIVSLIITIIIFSSALPLSRRASRILLQATPSTISADQIQREILAVPGVIAVHDFHVWNLTESIYIASIHVQIDCAPDKFMSSAKLIRKIFHQHGIHSATVQPEFVSGDVNE 380          
BLAST of slc30a-3 vs. Ensembl Yeast
Match: MMT2 (Putative metal transporter involved in mitochondrial iron accumulation; MMT2 has a paralog, MMT1, that arose from the whole genome duplication [Source:SGD;Acc:S000006145])

HSP 1 Score: 48.1358 bits (113), Expect = 4.274e-6
Identity = 25/72 (34.72%), Postives = 42/72 (58.33%), Query Frame = 2
Query: 1700 IAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGI 1915
            + + VGG   +S A++ D+ H LSD  S  ++LF++  ASR  T    +G+ + E +G+L +V  I  + GI
Sbjct:  145 VGKFVGGITFHSQALLADSVHALSDLVSDFLTLFSVQYASRKPTSEYPYGYGKVETVGSL-AVSTILAMAGI 215          
BLAST of slc30a-3 vs. Ensembl Nematostella
Match: EDO43612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY04])

HSP 1 Score: 312.768 bits (800), Expect = 4.680e-99
Identity = 172/339 (50.74%), Postives = 237/339 (69.91%), Query Frame = 2
Query: 1655 RRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEG-TPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVAD-MDDCKKCK 2665
            R+KL  AS +CL F++AE+VGG LA+SLAIMTDAAH+LSDFA+FMISLFA+++A     K+ +FG++RAE++GALVSVL+IWV+TGILVY+AV R++ KD++I A IMLIT+GV + +N+++                   L +        +                  + +S + + K NINVRAAFIHV+GD+VQS GVLIAA++I YKPSWK+ADPICTF+FSILVL TT+NI+RDT++VLMEG TPK+++++ VK  L  ++GVV  H+L IWSLT NK AL+VHLA+ PN + Q +L  A + L ++F I  +TIQ+E Y    M  C +C+
Sbjct:    4 RKKLTTASVVCLFFVVAEVVGGYLAHSLAIMTDAAHMLSDFAAFMISLFAIWVAEWQPDKKRTFGYYRAEILGALVSVLIIWVLTGILVYLAVQRVITKDFDINADIMLITAGVALGINILLGII----------------LHQSGVGHGHSHGGGGHDHGGSHSHSASHGKPRSGSVLEKENINVRAAFIHVLGDVVQSVGVLIAAYIIKYKPSWKLADPICTFLFSILVLITTLNIVRDTIHVLMEGSTPKNVNYNAVKAGLENIQGVVAAHSLHIWSLTVNKAALAVHLAIGPNVDSQKVLNIAHQKLKTQFQIFHSTIQVELYQESVMQSCTECQ 326          
BLAST of slc30a-3 vs. Ensembl Nematostella
Match: EDO30554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G7])

HSP 1 Score: 310.457 bits (794), Expect = 1.578e-98
Identity = 170/340 (50.00%), Postives = 226/340 (66.47%), Query Frame = 2
Query: 1658 RKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLE-NYVADMDDCKKCKTPQ 2674
            R+L IAS LCL FMIAE VGG  +NSLAIMTDAAH+LSDFA FMISLFA+++A+RPATK +S+GW+RAEVMGA++SVL+IWV+TG+LVYMA+ R++ K+Y ++A +MLIT+  G+L+N+IM   L                   Y   +                         ++   + N+NVRAAFIHVIGD +QS GV +AA +I++KP W IADPICTFIFSI+VL TT+ IL+D + VLMEG PK L F+D+K +L  + GV  +H+L +WSLT    ALSVHL VD +   Q IL+ A++V    F I  +TIQ+E +  +  + CKKC  PQ
Sbjct:   10 RRLRIASFLCLFFMIAEFVGGYFSNSLAIMTDAAHMLSDFAGFMISLFAIWVATRPATKTLSYGWYRAEVMGAVLSVLVIWVLTGVLVYMALQRLIMKEYEVDAKVMLITASGGLLINVIMGAIL-------------------YQKGHGH-----------------------SHGEEEENVNVRAAFIHVIGDFLQSLGVFVAALIIWFKPEWAIADPICTFIFSIIVLFTTLAILKDALIVLMEGMPKGLSFNDLKTSLTAIPGVEAVHDLHVWSLTVGTDALSVHLVVDNSANTQDILEAASQVCSKSFDIHHSTIQIETDNGSRKESCKKCDDPQ 307          
BLAST of slc30a-3 vs. Ensembl Nematostella
Match: EDO48857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHI7])

HSP 1 Score: 191.43 bits (485), Expect = 8.121e-55
Identity = 115/328 (35.06%), Postives = 189/328 (57.62%), Query Frame = 2
Query: 1658 RKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRI-----MNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLE 2626
            R+L+IA+  C++F+  E+ GG +ANSLA+M DA H L D  S + SL A ++A      + ++G+ RAE++GA + +L++W++TG+LVY A+LR+     M    ++ A +M+IT+G     N+++A  L                   +   +  Y                    K++N   + NIN+RAAF+H IGD++ +FGVL+A  +I  KP W+ AD IC+ + +++VL TT  ++RD+ N+L EG P+ +   +VK  L  L  VV  HN+ +W+LT+ +  L+ HL V+P  + Q +LK A++ L SK+ +   T+QLE
Sbjct:    1 RRLIIATLFCVVFIACEVTGGVIANSLAVMNDALHQLFDLNSLLASLLAAWIAGWKPNSQKTYGYFRAEILGACLVILMLWLLTGVLVYEALLRLLAGTAMGHSDHVNADVMMITAGFTCAANIVLAFMLSGV--------------GRHHHSHGSYE-------------------KNDNC--EGNINIRAAFLHTIGDIIYAFGVLLAGLIIKIKPEWQKADAICSLVGAVIVLVTTYAVIRDSFNILFEGVPRDVRIAEVKRDLSTLHHVVSFHNVHVWALTSGRNLLTAHLVVEPEADTQTLLKIASKRLSSKYSLYHCTLQLE 293          
BLAST of slc30a-3 vs. Ensembl Nematostella
Match: EDO34617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW3])

HSP 1 Score: 72.7886 bits (177), Expect = 4.417e-13
Identity = 71/347 (20.46%), Postives = 147/347 (42.36%), Query Frame = 2
Query: 1640 IDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNI-----NVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTP------------KSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLEN 2629
            ++    R++     L L+F   E++ G   NSL +++D  H+L D  + ++ L A  ++   A++  S+G+ R E++   V+ + + VV    V++A ++ +     +    +L  S  G+LVNL+                 +                                   S +P R  N+     +    F+HV+ D + S GV IA+ ++  +    IADP+C+   + L+  + + +L+++  VL++ TP            K L FD           V+   +   W  + +    ++H+ V P+   Q I+++ T  L  ++ +++ ++Q+E 
Sbjct:  375 LEESESRQIFYFLCLNLMFTGVELLYGVWTNSLGLISDGFHMLFDCTALVLGLCASLMSRWKASRTFSYGFGRVEILSGFVNGIFL-VVIAFFVFLAAVQRLFDPPKVSTERLLAVSVGGLLVNLV---------GILAFRHAHAHAHGGGGSCGGGGGSHGHGHSHTHGHGHSHDHHPSTHPDRSVNMQGMYSHAHGVFLHVVADTLGSVGV-IASSILIDQFGLFIADPVCSLFIASLIFLSVLPLLKESSLVLLQRTPLDMEKSLTGALNKILSFDG----------VLSFRDHHFWQHSESVVCGTIHVQVAPSASEQKIIQQVTS-LFKEYGVNNLSVQVEK 699          
BLAST of slc30a-3 vs. Ensembl Nematostella
Match: EDO29786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N0])

HSP 1 Score: 53.1434 bits (126), Expect = 3.013e-8
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 2
Query: 1706 EIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLI 2017
            E+  G   NSL ++TD+ H+  D  + +  L A  +A     +R S+G+ RAE+M   V+ L +  V   +   AV R+ +    ++   + + S +G LVNL+
Sbjct:   27 ELAYGIWTNSLGLITDSFHMFFDCTALLAGLVASVIAHWGRNERFSYGYARAEIMAGFVNGLFLIFVAFFIFSEAVERVFHPP-EVKHERLFVVSVLGFLVNLV 129          
BLAST of slc30a-3 vs. Ensembl Medaka
Match: slc30a2 (solute carrier family 30 member 3 [Source:NCBI gene;Acc:101167260])

HSP 1 Score: 332.028 bits (850), Expect = 1.135e-105
Identity = 176/358 (49.16%), Postives = 236/358 (65.92%), Query Frame = 2
Query: 1610 HCH----SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            HCH       E  G   +A+RKL IASG+CLIFMI E++GG LA+SLAIMTDAAHLL+DF S M+SLF+L+++SRP TK M+FGWHR+E++GA VSV+ IWVVTG LVY+A+ RI+  DY IE  +ML TSG  V+VN+IMA  LH               S       + Y   D             + +  +     +N +VRAAFIHVIGDL+QS GV++AA +IY +P +K+ADPICTF+FS+ VLCTT+ ILRD   +LMEG+PK ++F  VKE LL ++ V  +H L +W+LT  ++ +SVHLA++   + Q IL+EAT +L++KF     TIQ+E Y  DM  C  C+ P
Sbjct:   14 HCHRSKPPHGEQSGDKVLAKRKLFIASGVCLIFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGWHRSEILGAFVSVMSIWVVTGALVYLAIERIVQNDYEIEGHVMLATSGCAVIVNIIMAYILHH--------------STTLHPHGSGYHQIDEDGRSPVNHGHAHMLLGGH-----SNTSVRAAFIHVIGDLLQSIGVMVAAIIIYVRPEYKVADPICTFLFSLFVLCTTVTILRDVFRILMEGSPKGIEFSSVKEVLLSVKAVKSMHCLHLWALTLGQSLVSVHLAIEEEADPQAILQEATDLLIAKFGFHSITIQVELYSEDMSHCSHCQDP 352          
BLAST of slc30a-3 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 317.775 bits (813), Expect = 9.900e-100
Identity = 174/362 (48.07%), Postives = 249/362 (68.78%), Query Frame = 2
Query: 1607 DHCH------SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
            +HCH       D ET+   +VA+R+L + S +CL+FM+AEIVGG LA SLA+MTDAAHLL+D  SF+ISLF+L+L+S+PAT+++SFGWHRAE++GAL+SV  IW+VTG+LVY+AV R++  D+ IE +IMLITSG  V+ N+IMA +LHQ  H H         S  +  EN + +   +     +  D+ +         ++ N +VRAAF+HVIGDL+QS  VLI+A VI+++P +KIADPICTF+FSILVLCTT  I+RD + VLMEGTP  + + +V++ LL ++GV  +HNL IW+LT N+  LS H+A+D + + Q++L+E T+   S ++    TIQ+E        C  C+ P+
Sbjct:   33 EHCHDNSRAQEDRETE--KKVAKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLHQSGHGHSHGGLG---SHGHSHENGKPNKQMSNSVHSELIDMEQSLPDHGGRTQQANASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCENPK 389          
BLAST of slc30a-3 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 317.775 bits (813), Expect = 9.900e-100
Identity = 174/362 (48.07%), Postives = 249/362 (68.78%), Query Frame = 2
Query: 1607 DHCH------SDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQ 2674
            +HCH       D ET+   +VA+R+L + S +CL+FM+AEIVGG LA SLA+MTDAAHLL+D  SF+ISLF+L+L+S+PAT+++SFGWHRAE++GAL+SV  IW+VTG+LVY+AV R++  D+ IE +IMLITSG  V+ N+IMA +LHQ  H H         S  +  EN + +   +     +  D+ +         ++ N +VRAAF+HVIGDL+QS  VLI+A VI+++P +KIADPICTF+FSILVLCTT  I+RD + VLMEGTP  + + +V++ LL ++GV  +HNL IW+LT N+  LS H+A+D + + Q++L+E T+   S ++    TIQ+E        C  C+ P+
Sbjct:   33 EHCHDNSRAQEDRETE--KKVAKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLHQSGHGHSHGGLG---SHGHSHENGKPNKQMSNSVHSELIDMEQSLPDHGGRTQQANASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCENPK 389          
BLAST of slc30a-3 vs. Ensembl Medaka
Match: slc30a4 (solute carrier family 30 member 4 [Source:NCBI gene;Acc:101171398])

HSP 1 Score: 227.254 bits (578), Expect = 1.432e-65
Identity = 149/363 (41.05%), Postives = 225/363 (61.98%), Query Frame = 2
Query: 1607 DHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPN-----KEVQVILKEATRVLMSKFHISDATIQLENYVADM-DDCKKCKTPQS 2677
            D+C    E     RV +R L+IA+ L  +FM  EI+GG ++NSLAIMTDA H+L+D    + SL AL+L+++P TKR +FG HR EV+ A++SV+LI+++TG+L+Y AV R +++D++I+  +MLIT+ VGV VNLIM   L+Q  H H     +           ++ +                    S  P    ++ VRAAFIH +GDL+QS GVLIAA+V+ +KP +K+ADPICT+IFS+LVL TTI I+RDT+ +++EG P+ LD   ++E LL+LE V  +  L +W+LT +KTA  VHL + P+     ++VQ    +A  +L+  + +S  T+Q++ +   M   C  C  P +
Sbjct:   97 DNCTKKRERIKHRRVMKR-LVIAALLYFLFMTGEIIGGYVSNSLAIMTDAVHMLADVVGILFSLLALWLSTKPPTKRFTFGLHRLEVVSAVLSVVLIYILTGVLLYEAVQRTVHQDFSIDGDVMLITAAVGVAVNLIMGFLLNQGGHLHSHSHGHGHSHSSAAAAGSRPA-------------------GSGQP--HGSLAVRAAFIHALGDLLQSVGVLIAAYVVRFKPEFKLADPICTYIFSVLVLFTTIRIIRDTIVIVLEGVPRHLDTQRIREDLLKLEDVQSIDELNVWALTADKTAAIVHLQLTPSSGHSWEDVQA---KARHLLLHTYGLSRCTVQVQTHRERMVRSCANCLQPSA 434          
BLAST of slc30a-3 vs. Ensembl Medaka
Match: slc30a5 (solute carrier family 30 member 5 [Source:NCBI gene;Acc:101161255])

HSP 1 Score: 92.8189 bits (229), Expect = 7.925e-19
Identity = 81/338 (23.96%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 1622 DSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLD--FDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLEN 2629
            DS    ++    R++     L L F   E+  G   NSL +++D  H+L D ++ ++ LFA  +    AT+  S+G+ R E++   ++ L + V+   +   +V R+++   NI   ++   S  G+LVNL+  C+                  + +D  ++      +                  +     N N+R  F+HV+ D + S GV+I+  +I  +  W IADPIC+   + L+  + I +L++   VL+  TP   +   +   E + +LEGV+   +   W  + N  A ++HL V  +   Q I ++ T  L+    +++ ++Q+E 
Sbjct:  403 DSLKQILEEYDSRQIFYFLCLNLAFTFVELFYGVWTNSLGLISDGFHMLFDCSALVLGLFAALMTRWKATRIFSYGFGRVEILSGFINGLFLMVIAFFVFMESVTRLLDPP-NINTDMLTPVSVGGLLVNLVGICAFSHAHSHGGKS------CQSHDHGHSHGEHGHSHGGHGHSHAHGGHGHAHGSLTGGMNANMRGVFLHVLADTLGSVGVIISTLLI-RQFGWLIADPICSLFIATLIFLSVIPLLKEACEVLLLRTPPEHEKVLNGALEKIDKLEGVLSHRDAHFWRHSANMVAGTIHLQVMSDVVEQRITQQVT-ALLKDAGVNNLSVQVEK 731          
BLAST of slc30a-3 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 405/405 (100.00%), Postives = 405/405 (100.00%), Query Frame = 2
Query: 1463 MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS
Sbjct:    1 MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 405          
BLAST of slc30a-3 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 373/374 (99.73%), Postives = 373/374 (99.73%), Query Frame = 2
Query: 1556 NQEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 2677
            N EIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS
Sbjct:   18 NIEIANSELAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTPQS 391          
BLAST of slc30a-3 vs. Planmine SMEST
Match: SMESG000013136.1 (SMESG000013136.1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.080e-138
Identity = 222/356 (62.36%), Postives = 274/356 (76.97%), Query Frame = 2
Query: 1604 TDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPLSEEYDVENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 2671
            +DHCH  SE  G+D+ AR+KLL+AS LCLIFMI EIVGG +A+SLAIMTDAAHLL+DFASFMISLFA++LASRPATKRMSFGWHRAEV+GALVSVL+IWVVTGILVY+AV+R+++ ++ IE  IMLITS  G+++NLIMA +LHQH H+H +   N    +E+                            S+    K NINVRAAFIHVIGDLVQS GV IAA VIY KP +KIADPICTFIFSILVL TTINILRDTM VLMEGTPK LDF++VK    +L GV+ +HNLR+WSLT +KTALSVH+A+DP++E   IL++A+ +L  +F I+D TIQLENYV++M +C++C+ P
Sbjct:   53 SDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHG--------------------------HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 382          
BLAST of slc30a-3 vs. Planmine SMEST
Match: SMESG000002070.1 (SMESG000002070.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.572e-45
Identity = 84/157 (53.50%), Postives = 119/157 (75.80%), Query Frame = 2
Query: 1556 NQEIANSELAHRDNIETDHCHSDSE-TDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMA 2023
            N+E+ +  L  RD +    C   S  +  +DR A+ KL+IA  LC++F + EI+GG +ANSLAI+TD+AHL SD +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVLLIW+VTG+L+Y A+LRI+N +Y I A IMLI S VGV++N+++A
Sbjct:   10 NEELDSLPLL-RDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLA 165          

HSP 2 Score: 154.836 bits (390), Expect = 1.569e-40
Identity = 79/143 (55.24%), Postives = 110/143 (76.92%), Query Frame = 2
Query: 2201 NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLEN 2629
            NIN+RAAFIHVIGD++QSFGVL AAF+IY+KP WKIADPICTF+FS LV+ TTI I RD + VL+E  P+ ++++ V   +  + G+V +HNLR+WS+T  KTALS HL VD +++ Q IL++   + + +F IS+ TIQ+E+
Sbjct:  251 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 393          
BLAST of slc30a-3 vs. Planmine SMEST
Match: SMESG000069698.1 (SMESG000069698.1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.527e-18
Identity = 87/360 (24.17%), Postives = 165/360 (45.83%), Query Frame = 2
Query: 1658 RKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACXXXXXXXXXXXXXXNEPL--------SEEYD----VENAQYXXXXXXXXXXXXXXXVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPS--------WKI-ADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDXXXXXXXXXXXXXXXXXRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCK---KCK 2665
            RKL I   L + +  AE++ GT   +++++ D+ H+LSD  S +I + A+ ++  P +   +FGW RAEV G+L++ + +  ++  +   A+ R    +   +  IML     G+ +N I    L            N  L        SE  D     E+      +            +VR+ + N     ++N+ A F+HV  D V S  V I+A ++ Y P         +K+  DP  + I  I+++  TI++++    VL++  P+ ++   +   + +++ V+ +H+L IW L       +VH+ V    +   +   A + L+  ++I   T+Q E +    +D K   KC+
Sbjct:   10 RKLSIILSLTIGYFFAELIVGTWIKAISLVADSFHMLSDVVSIIIGIVAIKVSKLPKSGLNTFGWQRAEVFGSLINCISLIALSFTVFVSAIQRFFEPEKVSDPLIMLFVGTGGLFINFIGLVLLSSTHSHKIKEIENPKLPNYVKSTDSEGEDTLIPTESQISEIENKDDLIMGPPIPGQVRLSTIN--EDQSMNMTAVFLHVFADFVGSVIVCISALLLLYGPGDIKSSSGLYKLYVDPSLSIIMVIIIVLPTISLVKQASLVLLQSVPQEINIKHLSNDIRQIKNVISMHDLHIWRLRPKVIIGTVHVKVRSIDDFN-LTALAVKKLLHDYNIHCTTVQPE-FTQSSEDNKSDDKCE 365          
The following BLAST results are available for this feature:
BLAST of slc30a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC30A21.849e-10650.68solute carrier family 30 member 2 [Source:HGNC Sym... [more]
SLC30A32.939e-9144.13solute carrier family 30 member 3 [Source:HGNC Sym... [more]
SLC30A81.737e-8044.97solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A81.737e-8044.97solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A81.737e-8044.97solute carrier family 30 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdf-24.131e-8643.47Cation Diffusion Facilitator family [Source:UniPr... [more]
ttm-14.074e-6942.74Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-17.263e-6942.50Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-11.576e-6840.78Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
cdf-11.898e-1225.13Cation diffusion facilitator family protein 1 [So... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZnT33D1.045e-8847.74gene:FBgn0051860 transcript:FBtr0302984[more]
ZnT35C2.935e-5665.52gene:FBgn0028516 transcript:FBtr0080714[more]
ZnT35C4.302e-5666.91gene:FBgn0028516 transcript:FBtr0080715[more]
ZnT33D7.917e-3661.39gene:FBgn0051860 transcript:FBtr0302985[more]
ZnT41F1.231e-3350.41gene:FBgn0025693 transcript:FBtr0086054[more]
back to top
BLAST of slc30a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a24.276e-10448.46solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a26.146e-10445.34solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a21.559e-10047.62solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a81.082e-9445.50solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
slc30a82.135e-9445.50solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a22.007e-11454.20solute carrier family 30 member 2 [Source:NCBI gen... [more]
slc30a22.374e-11454.20solute carrier family 30 member 2 [Source:NCBI gen... [more]
ENSXETT00000033890.11.083e-10145.83solute carrier family 30 (zinc transporter), membe... [more]
nbr19.888e-8743.04neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GE... [more]
gmip1.370e-6538.98GEM interacting protein [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc30a22.077e-10552.07solute carrier family 30 (zinc transporter), membe... [more]
Slc30a27.648e-9653.23solute carrier family 30 (zinc transporter), membe... [more]
Slc30a27.648e-9653.23solute carrier family 30 (zinc transporter), membe... [more]
Slc30a38.305e-8845.25solute carrier family 30 (zinc transporter), membe... [more]
Slc30a32.665e-8744.51solute carrier family 30 (zinc transporter), membe... [more]
back to top
BLAST of slc30a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ10|ZNT2_MOUSE1.453e-10452.07Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc... [more]
sp|Q62941|ZNT2_RAT5.743e-10350.68Zinc transporter 2 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q08E25|ZNT3_BOVIN9.275e-9245.25Zinc transporter 3 OS=Bos taurus OX=9913 GN=SLC30A... [more]
sp|Q5R617|ZNT3_PONAB1.032e-9044.13Zinc transporter 3 OS=Pongo abelii OX=9601 GN=SLC3... [more]
sp|Q99726|ZNT3_HUMAN1.411e-9044.13Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC3... [more]
back to top
BLAST of slc30a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKE20.000e+0100.00Slc30a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKE43.885e-13562.36Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4V3SEZ46.832e-12458.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LRS68.308e-12458.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LRT49.013e-12458.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a24.698e-10145.19zinc transporter 2 [Source:NCBI gene;Acc:103036936... [more]
slc30a81.951e-9645.80solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
SLC30A25.929e-8945.15zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
SLC30A21.484e-8644.32zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
slc30a87.628e-7038.95solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a28.954e-9748.08solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a22.046e-5043.98solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a25.537e-4443.46solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a107.428e-1524.18solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
slc30a101.654e-1122.29solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
COT18.931e-1227.38Vacuolar transporter that mediates zinc transport ... [more]
ZRC12.813e-926.98Vacuolar membrane zinc transporter; transports zin... [more]
MMT24.274e-634.72Putative metal transporter involved in mitochondri... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436124.680e-9950.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305541.578e-9850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488578.121e-5535.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346174.417e-1320.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297863.013e-829.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc30a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a21.135e-10549.16solute carrier family 30 member 3 [Source:NCBI gen... [more]
slc30a89.900e-10048.07solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a89.900e-10048.07solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a41.432e-6541.05solute carrier family 30 member 4 [Source:NCBI gen... [more]
slc30a57.925e-1923.96solute carrier family 30 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc30a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022672.10.000e+0100.00SMESG000022672.1[more]
SMESG000022672.10.000e+099.73SMESG000022672.1[more]
SMESG000013136.11.080e-13862.36SMESG000013136.1[more]
SMESG000002070.11.572e-4553.50SMESG000002070.1[more]
SMESG000069698.17.527e-1824.17SMESG000069698.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007967
GenBankAKN21623.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007967 ID=SMED30007967|Name=slc30a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2748bp
ATATATATATATATATATACTATGCTCGCGGCTTTCAATCGACAATGTTT
CGGAACCGTTGTGCGGAGAAGGCCGGAAGCCTTTCTAGTGTATATGAAAT
ACAGGAAAACATATACACTAGATCAAACACTAAACCTATTGGAGTTTGAG
ATTTATTACTACGCATATTTAATGATTTTAAAGATATAAAGAGTCCAGCG
GCTTAGTTATAATATTTGCTTTAATAACAGGAAAGAGGTTAAGGTGATTG
ATGAGGAGAAAGGCATAAATATGGAGCAGGAGATTTAATCAAATTCTCAT
AACGATCATAGAAATCTTTCTGAAAAGCTAGCGTTAAATAATTTCTTATG
ACAAAGATTTAGTAGAGATTCGACATATTTAAAAATAGAAGTGTTATTCT
TATGATTGTTTATGTTGCATCAGATTTGTGGCGTACGGTCACTTGATTCG
AATCAAATCAAGGAAGAACTTGCGGTGTAATGATGACTATTGGTCTTGCT
GGTTTCATAAAGGACGCGGGGAGTCAGAAATAATTGCTTTCCTGCTCGGA
TTATTTAATAATCCGCCAATGTGAATGAGACCAATTTACTAAAATTAAAA
ATCTTGAATCAAATTTAATGTTTTTTAAAATGTTATTCAACCGAATATTT
TGCTCAAGGTGATTTGCTCAAGGTGGCAGCTTGTTAATCAAGAATTTCCA
CATTGTAAGTCCTCATAAACTACAAGACTATAAATTGCTATCAAACATAT
AGGAAATGGTCTCGCATTTTCACGCTTGTCTAGGCCTTGCCTGGGACTAA
ATCCTCCACTGATGCTGGTATACCCGCAATATACTGCCGTAAATATAGGA
TATCCCAGGGTCACCTCATATATGCTAGATGGGACAATATAATAAATGTG
TCCCACAGTTTACTGCCGTTTTCCTTGTCAAAACATTAAACATATTTCAT
CCGTAAATATTAGTACTAATATTCTAGATATTTTAAAAATCGAAGGTCAC
CCTTTTCTTGTTTAAATTAACAAACGTTCGTGTCATTTATCGTTACTATA
CAGTCGGCGGATGATGTAATTTGGTAGCTTTATGCGTGCATTCAGTGCTA
ACTGATGAACGTGACGGAAGTGACCATTTCCTGTCACCTTCATCTACTGA
ATCTACTTGTCTATTGAACCCCACTAACAATCTCAATTGGCCGTTTACTC
GTGGACTCTCCTTTCTGAATTCTGATTTTTCTCTTTGAATTTTACCATAT
AATTCCGACCGAAACAATTCGATGGACATTGACCAATCGCTGTATTGCAA
TTCACATATTCGAACTCGAATGCATAAATGTGAACAGCACAGTTGATGTT
ATTAACGGCCAATCATCATTGAGATAAGTGCCTAAATGTGAATGTCGACT
AATCCGATCATATAAATTGTTCAGCCAAGACATTTTACTCATAAATACCA
AACATTTTTATCATGCACGCAAGGTCTAAAAGCGATTCAGTCGCCCATAA
AGATTTTAATAATTCACTCAACTATCAAACATTTAATAATTTTGCATACA
AGAAGAATCAAGAAATTGCAAATTCCGAATTGGCTCATAGAGATAATATA
GAAACGGATCATTGCCACTCAGACAGCGAGACTGATGGGATAGACCGAGT
AGCTCGCCGTAAGCTCCTGATAGCGAGCGGCCTCTGTCTCATATTCATGA
TCGCAGAGATTGTTGGTGGCACTTTGGCAAATAGTCTAGCTATAATGACT
GATGCGGCTCATTTGTTGAGTGATTTTGCCAGTTTTATGATCAGCTTATT
TGCGCTATTTCTTGCGTCTCGGCCTGCGACTAAGCGCATGAGTTTCGGAT
GGCACAGAGCAGAGGTTATGGGAGCATTGGTATCGGTGTTGTTGATTTGG
GTGGTCACTGGGATCCTTGTCTATATGGCTGTGTTGCGGATCATGAATAA
GGATTACAATATTGAGGCTACCATCATGCTAATCACGTCCGGTGTAGGGG
TCCTTGTAAATCTCATTATGGCCTGCTCATTGCATCAGCATTCTCATTCC
CATGAGACACATCCACATAATGAACCCTTGTCAGAGGAATACGATGTTGA
AAATGCACAATATTCCGATTCTGATGCTCTTCTTGATGACGATAAAAAGT
CGGATTTGGTTGAAGTGAGGATAAAGTCGAATAATCCTATAAGGAAGACC
AATATCAATGTTAGGGCGGCATTTATACACGTCATTGGCGATTTGGTGCA
AAGTTTTGGTGTTCTGATAGCAGCTTTTGTGATATATTACAAGCCATCTT
GGAAAATCGCAGATCCGATATGCACTTTCATTTTCTCCATACTCGTTCTG
TGCACAACAATTAATATTCTTAGGGATACCATGAATGTTCTTATGGAGGG
GACGCCAAAATCCCTTGATTTTGATGATGTCAAGGAAACTTTGTTGGAAT
TGGAAGGTGTTGTTCTCCTTCATAATTTAAGAATTTGGAGTTTAACAACG
AATAAAACTGCGTTATCAGTTCATTTGGCAGTAGACCCCAATAAAGAAGT
GCAAGTGATACTAAAGGAAGCTACAAGAGTCCTGATGTCGAAGTTCCACA
TCTCAGATGCAACGATACAACTAGAGAATTATGTAGCCGATATGGATGAT
TGCAAGAAGTGCAAGACCCCCCAGTCGTAACGATTGAATTACCGATTTTG
TTTTTCATTTATCTGTAAATTTTTAAAGAAATTATTTTGTCTTTTTTT
back to top

protein sequence of SMED30007967-orf-1

>SMED30007967-orf-1 ID=SMED30007967-orf-1|Name=SMED30007967-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MHARSKSDSVAHKDFNNSLNYQTFNNFAYKKNQEIANSELAHRDNIETDH
CHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAH
LLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTG
ILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETH
PHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINV
RAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTI
NILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTA
LSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKC
KTPQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000047collecting duct
PLANA:0000087proximal tubule
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036837Cation_efflux_CTD_sf
IPR002524Cation_efflux
IPR027469Cation_efflux_TMD_sf
IPR027470Cation_efflux_CTD
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006812cation transport
GO:0098655cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008324cation transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027469Cation efflux transmembrane domain superfamilyGENE3DG3DSA:1.20.1510.10coord: 63..203
e-value: 3.2E-22
score: 81.1
coord: 230..311
e-value: 1.6E-8
score: 36.3
IPR027469Cation efflux transmembrane domain superfamilySUPERFAMILYSSF161111Cation efflux protein transmembrane domain-likecoord: 62..312
IPR002524Cation efflux proteinTIGRFAMTIGR01297TIGR01297coord: 65..390
e-value: 1.8E-92
score: 307.6
IPR002524Cation efflux proteinPFAMPF01545Cation_effluxcoord: 68..311
e-value: 4.2E-51
score: 173.5
NoneNo IPR availablePANTHERPTHR11562CATION EFFLUX PROTEIN/ ZINC TRANSPORTERcoord: 11..403
NoneNo IPR availablePANTHERPTHR11562:SF84LD05335Pcoord: 11..403
NoneNo IPR availableTMHMMTMhelixcoord: 105..122
NoneNo IPR availableTMHMMTMhelixcoord: 286..303
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
IPR036837Cation efflux protein, cytoplasmic domain superfamilySUPERFAMILYSSF160240Cation efflux protein cytoplasmic domain-likecoord: 318..388