Iroquois-class homeodomain protein IRX-6

Overview
NameIroquois-class homeodomain protein IRX-6
Smed IDSMED30007957
Length (bp)1028
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Iroquois-class homeodomain protein IRX-6 (SMED30007957) t-SNE clustered cells

Violin plots show distribution of expression levels for Iroquois-class homeodomain protein IRX-6 (SMED30007957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Iroquois-class homeodomain protein IRX-6 (SMED30007957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Iroquois-class homeodomain protein IRX-6 (SMED30007957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007957h1SMcG0022186 dd_Smed_v4_14656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007957h1SMcG0022186 dd_Smed_v4_14656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007957h1SMcG0022186 dd_Smed_v4_14656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007957h1SMcG0022186 dd_Smed_v4_14656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007957h1SMcG0022186 dd_Smed_v6_14656_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30007957h1SMcG0022186 DN307336smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30007957h1SMcG0022186 DN307336smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Match: IRX1 (iroquois homeobox 1 [Source:HGNC Symbol;Acc:HGNC:14358])

HSP 1 Score: 119.013 bits (297), Expect = 2.564e-29
Identity = 72/150 (48.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSI-IDMISE-PSDCSHED 890
             ++P T A      +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K        D E   LF  + E      +  ++  + SI ID I E   D S+ED
Sbjct:  103 GVHPATFAAHTAPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSK--------DQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNED 244          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Match: IRX4 (iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6129])

HSP 1 Score: 116.701 bits (291), Expect = 2.041e-28
Identity = 51/63 (80.95%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  146 RKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 208          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Match: IRX4 (iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6129])

HSP 1 Score: 116.701 bits (291), Expect = 2.041e-28
Identity = 51/63 (80.95%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  146 RKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 208          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Match: IRX4 (iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6129])

HSP 1 Score: 116.701 bits (291), Expect = 2.041e-28
Identity = 51/63 (80.95%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  146 RKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 208          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Match: IRX4 (iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6129])

HSP 1 Score: 116.701 bits (291), Expect = 2.313e-28
Identity = 51/63 (80.95%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  172 RKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 234          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Celegans
Match: irx-1 (Putative iroquois-class homeodomain protein irx-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93348])

HSP 1 Score: 100.138 bits (248), Expect = 1.705e-23
Identity = 47/84 (55.95%), Postives = 63/84 (75.00%), Query Frame = 3
Query:  471 PITLAHLHTINHA-DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            P+  +  H + H   ++ I+ K+NATRE ++ LK WL  H+ NPYPSK +K++LA+ T M+LTQVSTWFANARRRLKKENK+ W
Sbjct:   99 PMFFSDAHRLYHPYGLDGIK-KRNATREATAPLKDWLHSHRKNPYPSKADKVMLAVGTGMTLTQVSTWFANARRRLKKENKMTW 181          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Celegans
Match: ceh-60 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q45EK2])

HSP 1 Score: 49.6766 bits (117), Expect = 1.395e-6
Identity = 21/58 (36.21%), Postives = 34/58 (58.62%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKE 704
            ++N  +  +  L+ W  +H+ NPYPS  EK  LA    + ++QV+ WF N R R K++
Sbjct:  184 RRNFDKNTTDILQNWFHDHRQNPYPSDQEKAELAKQCNIKISQVNNWFGNQRIRTKQQ 241          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Match: mirr (gene:FBgn0014343 transcript:FBtr0330077)

HSP 1 Score: 116.316 bits (290), Expect = 2.427e-28
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 3
Query:  510 DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            D+N  + +KNATRE +STLKAWL EHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  222 DLNGAR-RKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 290          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Match: mirr (gene:FBgn0014343 transcript:FBtr0075911)

HSP 1 Score: 116.316 bits (290), Expect = 2.482e-28
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 3
Query:  510 DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            D+N  + +KNATRE +STLKAWL EHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  222 DLNGAR-RKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 290          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Match: mirr (gene:FBgn0014343 transcript:FBtr0075912)

HSP 1 Score: 116.316 bits (290), Expect = 2.482e-28
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 3
Query:  510 DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            D+N  + +KNATRE +STLKAWL EHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  222 DLNGAR-RKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 290          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Match: caup (gene:FBgn0015919 transcript:FBtr0075909)

HSP 1 Score: 115.931 bits (289), Expect = 3.187e-28
Identity = 50/63 (79.37%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE+++TLKAWL EHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  230 RKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 292          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Match: ara (gene:FBgn0015904 transcript:FBtr0075908)

HSP 1 Score: 114.775 bits (286), Expect = 7.681e-28
Identity = 50/63 (79.37%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE+++TLKAWL EHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  259 RKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 321          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Match: irx3b (iroquois homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-030131-525])

HSP 1 Score: 119.013 bits (297), Expect = 1.985e-30
Identity = 65/123 (52.85%), Postives = 88/123 (71.54%), Query Frame = 3
Query:  534 KNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDS--TSDSELSELFTREYEKPNSNQKITKKNHIWSIIDM--ISEPSDCSHED 890
            KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W+   ++D   +  TSD+E       + EK + +++I  +N     ID   I +  DC ++D
Sbjct:  106 KNATRESTSTLKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWVPKTRTDEDGNVYTSDNE-------DAEKRDEDEEIDLEN-----IDTEDIEDKQDCDYQD 216          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Match: irx1a (iroquois homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-040707-1])

HSP 1 Score: 119.013 bits (297), Expect = 6.702e-30
Identity = 64/129 (49.61%), Postives = 83/129 (64.34%), Query Frame = 3
Query:  402 IRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSD----NPDSTSDSELSE 776
            + SQ  L++    H A+ A + +P      +             KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D      D+  D+E +E
Sbjct:   79 MGSQYDLKDSPGVHPASFAAHTSPA----FYPYGQFQYGDPARPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKDDENIFGSDNEGDAEKNE 203          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Match: irx1a (iroquois homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-040707-1])

HSP 1 Score: 119.398 bits (298), Expect = 6.832e-30
Identity = 63/122 (51.64%), Postives = 80/122 (65.57%), Query Frame = 3
Query:  402 IRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSE 767
            + SQ  L++    H A+ A + +P      +             KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D     SD+E
Sbjct:   79 MGSQYDLKDSPGVHPASFAAHTSPA----FYPYGQFQYGDPARPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKDDENIFGSDNE 196          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Match: irx4b (iroquois homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-040712-4])

HSP 1 Score: 119.013 bits (297), Expect = 1.028e-29
Identity = 60/100 (60.00%), Postives = 71/100 (71.00%), Query Frame = 3
Query:  471 PITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGK-SDNPDSTSDSE 767
            PI         +  V+    +KNATRE +STLKAWLQEHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    K SD  +   D E
Sbjct:  123 PIGQYSYDRYGYGSVDVGTRRKNATRETTSTLKAWLQEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWSPRNKNSDEKECDDDQE 222          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Match: irx4b (iroquois homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-040712-4])

HSP 1 Score: 119.013 bits (297), Expect = 1.028e-29
Identity = 60/100 (60.00%), Postives = 71/100 (71.00%), Query Frame = 3
Query:  471 PITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGK-SDNPDSTSDSE 767
            PI         +  V+    +KNATRE +STLKAWLQEHK NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    K SD  +   D E
Sbjct:  123 PIGQYSYDRYGYGSVDVGTRRKNATRETTSTLKAWLQEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWSPRNKNSDEKECDDDQE 222          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Match: smc1b (structural maintenance of chromosomes 1B [Source:Xenbase;Acc:XB-GENE-997265])

HSP 1 Score: 122.479 bits (306), Expect = 9.110e-31
Identity = 62/107 (57.94%), Postives = 76/107 (71.03%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSE 767
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D+    SD+E
Sbjct:  102 GVHPATFAAHTTPGYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKEDDNIFGSDTE 208          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Match: fancm (FA complementation group M [Source:Xenbase;Acc:XB-GENE-994655])

HSP 1 Score: 117.472 bits (293), Expect = 5.393e-29
Identity = 52/75 (69.33%), Postives = 64/75 (85.33%), Query Frame = 3
Query:  513 VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +N    +KNATR+ ++TLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    KS
Sbjct:  108 LNDPAYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKS 182          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Match: lypla1 (lysophospholipase 1 [Source:Xenbase;Acc:XB-GENE-942736])

HSP 1 Score: 116.701 bits (291), Expect = 6.263e-29
Identity = 52/76 (68.42%), Postives = 64/76 (84.21%), Query Frame = 3
Query:  510 DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            D++    +KNATREN+STLK WL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    K+
Sbjct:  139 DISCSSRRKNATRENTSTLKTWLYEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWSPKNKA 214          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Match: fancm (FA complementation group M [Source:Xenbase;Acc:XB-GENE-994655])

HSP 1 Score: 117.087 bits (292), Expect = 9.542e-29
Identity = 52/75 (69.33%), Postives = 64/75 (85.33%), Query Frame = 3
Query:  513 VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +N    +KNATR+ ++TLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    KS
Sbjct:  108 LNDPAYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKS 182          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Match: ndufaf5 (NADH:ubiquinone oxidoreductase complex assembly factor 5 [Source:Xenbase;Acc:XB-GENE-975960])

HSP 1 Score: 116.316 bits (290), Expect = 1.507e-28
Identity = 51/69 (73.91%), Postives = 62/69 (89.86%), Query Frame = 3
Query:  534 KNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSD 740
            KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    ++D
Sbjct:  113 KNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTD 181          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Match: Irx1 (Iroquois homeobox 1 [Source:MGI Symbol;Acc:MGI:1197515])

HSP 1 Score: 120.553 bits (301), Expect = 1.444e-31
Identity = 73/150 (48.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSI-IDMISE-PSDCSHED 890
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K        D E   LF  + E      +  ++  + SI ID I E   D S+ED
Sbjct:   18 GVHPATFAAHTTPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSK--------DQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDQIDERDGDQSNED 159          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Match: Irx2 (Iroquois homeobox 2 [Source:MGI Symbol;Acc:MGI:1197526])

HSP 1 Score: 112.464 bits (280), Expect = 1.583e-30
Identity = 51/75 (68.00%), Postives = 63/75 (84.00%), Query Frame = 3
Query:  513 VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +N    +KNATR+ ++TLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    KS
Sbjct:   19 LNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKS 93          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Match: Irx1 (Iroquois homeobox 1 [Source:MGI Symbol;Acc:MGI:1197515])

HSP 1 Score: 120.939 bits (302), Expect = 2.993e-30
Identity = 73/150 (48.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSI-IDMISE-PSDCSHED 890
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K        D E   LF  + E      +  ++  + SI ID I E   D S+ED
Sbjct:  103 GVHPATFAAHTTPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSK--------DQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDQIDERDGDQSNED 244          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Match: Irx4 (Iroquois homeobox 4 [Source:MGI Symbol;Acc:MGI:1355275])

HSP 1 Score: 118.242 bits (295), Expect = 4.259e-29
Identity = 52/72 (72.22%), Postives = 63/72 (87.50%), Query Frame = 3
Query:  504 HADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +  V+    +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  138 YGTVDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 209          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Match: Irx4 (Iroquois homeobox 4 [Source:MGI Symbol;Acc:MGI:1355275])

HSP 1 Score: 118.242 bits (295), Expect = 4.259e-29
Identity = 52/72 (72.22%), Postives = 63/72 (87.50%), Query Frame = 3
Query:  504 HADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +  V+    +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:  138 YGTVDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 209          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Match: sp|Q2TAQ8|IRX1B_XENLA (Iroquois-class homeodomain protein irx-1-B OS=Xenopus laevis OX=8355 GN=irx1-b PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.150e-30
Identity = 63/107 (58.88%), Postives = 77/107 (71.96%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSE 767
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A GK D+    SD+E
Sbjct:   97 GVHPATFAAHTTPGYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGAMGKEDDNIFGSDNE 203          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Match: sp|Q6F2E3|IRX1_XENTR (Iroquois-class homeodomain protein irx-1 OS=Xenopus tropicalis OX=8364 GN=irx1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 4.826e-30
Identity = 62/107 (57.94%), Postives = 76/107 (71.03%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSE 767
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D+    SD+E
Sbjct:  102 GVHPATFAAHTTPGYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKEDDNIFGSDTE 208          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Match: sp|P81068|IRX1_MOUSE (Iroquois-class homeodomain protein IRX-1 OS=Mus musculus OX=10090 GN=Irx1 PE=1 SV=4)

HSP 1 Score: 120.939 bits (302), Expect = 2.094e-29
Identity = 73/150 (48.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSI-IDMISE-PSDCSHED 890
             ++P T A   T  +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K        D E   LF  + E      +  ++  + SI ID I E   D S+ED
Sbjct:  103 GVHPATFAAHTTPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSK--------DQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDQIDERDGDQSNED 244          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Match: sp|Q9YGK8|IRX1A_XENLA (Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis OX=8355 GN=irx1-a PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.398e-29
Identity = 58/99 (58.59%), Postives = 71/99 (71.72%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDN 743
             ++P T A   T  +    Q Q       KNATRE++ TLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D+
Sbjct:  102 GVHPATFAAHTTPGYYPYGQFQYGDPGRPKNATRESTGTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKEDD 200          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Match: sp|P78414|IRX1_HUMAN (Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens OX=9606 GN=IRX1 PE=2 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 1.231e-28
Identity = 72/150 (48.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  462 NLNPITLAHLHTINHADVNQIQV-----KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSI-IDMISE-PSDCSHED 890
             ++P T A      +    Q Q       KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K        D E   LF  + E      +  ++  + SI ID I E   D S+ED
Sbjct:  103 GVHPATFAAHTAPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSK--------DQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNED 244          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Match: A0A1I8IV93 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.627e-33
Identity = 68/119 (57.14%), Postives = 84/119 (70.59%), Query Frame = 3
Query:  396 MDIRSQDVLENWRQFHQAALANNLNPITLA---HLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDN 743
            +D +++ + ENWRQF QAA   NL+P  LA          AD+   Q +KNATRE +  LKAWL EHK NPYP+KGEKI+LAI+T M+LTQVSTWFANARRRLKKENK+ W    + D+
Sbjct:   51 LDPQTESLAENWRQFQQAAQNYNLDPHLLAIYGGSFAAGRADLAG-QRRKNATRETTGVLKAWLNEHKKNPYPTKGEKIMLAIITTMTLTQVSTWFANARRRLKKENKMTWAPRNRGDD 168          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Match: A0A1I8J4E6 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 6.231e-32
Identity = 67/110 (60.91%), Postives = 78/110 (70.91%), Query Frame = 3
Query:  423 ENWRQFHQAALANNLNPITLA---HLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDN 743
            ENWRQF QAA   NL+P  LA          AD+   Q +KNATRE +  LKAWL EHK NPYP+KGEKI+LAI+T M+LTQVSTWFANARRRLKKENK+ W    + D+
Sbjct:   25 ENWRQFQQAAQNYNLDPHLLAIYGGSFAAGRADLAG-QRRKNATRETTGVLKAWLNEHKKNPYPTKGEKIMLAIITTMTLTQVSTWFANARRRLKKENKMTWAPRNRGDD 133          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Match: A0A2H1CL68 (Homeobox domain protein OS=Fasciola hepatica OX=6192 GN=D915_04403 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.363e-30
Identity = 64/103 (62.14%), Postives = 80/103 (77.67%), Query Frame = 3
Query:  414 DVLENWRQFHQAALANNLNPITLAHLHTINHA-DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            D L+ W+QF QAA ANNL+P  LA   +     +++    +KNATRE +S LKAWL EH+ NPYP+KGEKI+LA++T+MSLTQVSTWFANARRRLKKENK+ W
Sbjct:  359 DNLDCWQQFQQAAYANNLDPHFLALYSSAGCPFELSGSSRRKNATRETTSMLKAWLNEHRKNPYPTKGEKIMLALITKMSLTQVSTWFANARRRLKKENKVTW 461          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Match: A0A433TYJ0 (Homeobox domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_005580 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.426e-30
Identity = 69/142 (48.59%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  306 YNCSRYGGIPPEHIILANKVTGFLA-MNDPNMDIRSQDVLENWRQFHQAALANNLNPITLA---HLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            Y    Y G P  ++ LA+  + F   +N P  D++  D  E+WR   Q       +P ++    +  T    D+N    +KNATREN++TLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:   62 YPTPPYSG-PQGYVPLASDPSAFYPPLNSP-YDLK--DPGESWRGIGQGPACYPYDPTSMPAYPYPSTYGGMDINSAARRKNATRENTNTLKAWLYEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 199          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Match: A0A1S8WJU4 (Homeobox domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_09474 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.960e-30
Identity = 68/112 (60.71%), Postives = 85/112 (75.89%), Query Frame = 3
Query:  420 LENWRQFHQAALANNLNPITLAHLHTINHA-DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDS 752
            L++W+QF QAA ANNL+P  LA       A +++    +KNATRE +S LKAWL EH+ NPYP+KGEKI+LAI+T+MSLTQVSTWFANARRRLKKE+KI W    ++  PDS
Sbjct:  267 LDSWQQFQQAAYANNLDPHLLALCGGTGCAFELSGNSRRKNATRETTSMLKAWLNEHRKNPYPTKGEKIMLAIVTKMSLTQVSTWFANARRRLKKESKITWGV--RTTAPDS 376          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Match: irx1a (iroquois homeobox 1 [Source:NCBI gene;Acc:103024684])

HSP 1 Score: 119.398 bits (298), Expect = 6.313e-30
Identity = 60/113 (53.10%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  402 IRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSD 740
            + SQ  L++    H A+ A + +P      +             KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D
Sbjct:   77 MGSQYELKDSPGVHPASFAAHTSPA----FYPYGQFQYGDPARPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKED 185          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Match: irx1a (iroquois homeobox 1 [Source:NCBI gene;Acc:103024684])

HSP 1 Score: 119.398 bits (298), Expect = 6.744e-30
Identity = 60/113 (53.10%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  402 IRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSD 740
            + SQ  L++    H A+ A + +P      +             KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W A  K D
Sbjct:   77 MGSQYELKDSPGVHPASFAAHTSPA----FYPYGQFQYGDPARPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKED 185          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Match: irx4a (iroquois-class homeodomain protein irx-4 [Source:NCBI gene;Acc:103025323])

HSP 1 Score: 119.013 bits (297), Expect = 9.597e-30
Identity = 63/112 (56.25%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  444 QAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGK-SDNPDSTSDSELSE 776
            QAA     +P TL       +  ++    +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    K SD      D E S+
Sbjct:  110 QAATYYPYDP-TLGQYQYDRYGSMDGGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCSDEKRYGEDEEGSQ 220          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Match: irx3b (iroquois homeobox 3 [Source:NCBI gene;Acc:103035229])

HSP 1 Score: 117.087 bits (292), Expect = 1.600e-29
Identity = 54/90 (60.00%), Postives = 66/90 (73.33%), Query Frame = 3
Query:  471 PITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSD 740
            P   A      H  +      KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    ++D
Sbjct:   80 PHAHAPFFPYGHYQLGDPSRPKNATRESTSTLKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPKTRTD 169          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Match: irx2a (iroquois homeobox 2 [Source:NCBI gene;Acc:103024999])

HSP 1 Score: 118.242 bits (295), Expect = 1.683e-29
Identity = 52/75 (69.33%), Postives = 64/75 (85.33%), Query Frame = 3
Query:  513 VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +N    +KNATR+ ++TLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    KS
Sbjct:  101 LNDPTYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWAPRSKS 175          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002620.1 (pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 gene:ENSPMAG00000002391.1 transcript:ENSPMAT00000002620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.797e-31
Identity = 52/100 (52.00%), Postives = 71/100 (71.00%), Query Frame = 3
Query:  438 FHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +H    A++     + + +      V     +KNATR+ ++TLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W+   +S
Sbjct:   10 YHPYGGASHPTLGPVGYPYGAGGCGVADPAFRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRLKKENKMTWVTKARS 109          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Sea Lamprey
Match: mkxb (mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513-2])

HSP 1 Score: 73.9442 bits (180), Expect = 1.368e-15
Identity = 34/70 (48.57%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  519 QIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLK---KENKIGW 719
            +++ K+ A ++ +  LK WL +H+ NPYP+K EKILLA+ + M+L QVS WFANARRRLK   ++ ++ W
Sbjct:    1 RVRHKRQALQDMARPLKHWLYKHRHNPYPTKTEKILLALGSHMTLVQVSNWFANARRRLKNTVRQPELSW 70          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 48.1358 bits (113), Expect = 1.497e-6
Identity = 23/63 (36.51%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  510 DVNQIQVKKNATRENSST-LKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRL 695
            D  + ++K+    ++++T +++WL +H  +PYP++ EK  +A  T ++L QV+ WF NARRR+
Sbjct:  254 DDKRARLKRGVLPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRI 316          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 50.8322 bits (120), Expect = 1.002e-7
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRR 692
            + N  +   S L  WL EH +NPYP+  EK  L   T ++  Q+S WF NARRR
Sbjct:  198 RSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 48.9062 bits (115), Expect = 3.815e-7
Identity = 23/54 (42.59%), Postives = 31/54 (57.41%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRR 692
            + N  +E    L  WL  H +NPYP++ EK  L I T ++  Q+S WF N RRR
Sbjct:  166 RSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 112.464 bits (280), Expect = 2.194e-31
Identity = 51/63 (80.95%), Postives = 59/63 (93.65%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW 719
            +KNATRE +STLKAWL EH+ NPYP+KGEKI+LAILT+M+LTQVSTWFANARRRLKKENK+ W
Sbjct:    3 RKNATRETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRLKKENKMTW 65          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Nematostella
Match: EDO41178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S544])

HSP 1 Score: 51.2174 bits (121), Expect = 1.584e-8
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  531 KKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRL 695
            + N  +++ + L+ WL EH+ N YPS+ EK  L+    +S+ QV  WF NARRR+
Sbjct:   20 RGNLPKDSVNVLRLWLWEHRFNAYPSEAEKQYLSKAANLSVLQVCNWFINARRRI 74          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 49.6766 bits (117), Expect = 6.029e-7
Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 3
Query:  564 LKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRL 695
            +KAWL +H  +PYPS+ +K  LA  T +++ QV+ WF NARRR+
Sbjct:  253 MKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRI 296          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 49.6766 bits (117), Expect = 7.067e-7
Identity = 21/50 (42.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query:  546 RENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRL 695
            ++ +S +K WL +H  +PYP++ EK  +A  T +++ QV+ WF NARRR+
Sbjct:  206 KQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRI 255          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Match: irx1a (iroquois-class homeodomain protein irx-1 [Source:NCBI gene;Acc:101162949])

HSP 1 Score: 119.783 bits (299), Expect = 6.765e-30
Identity = 60/116 (51.72%), Postives = 76/116 (65.52%), Query Frame = 3
Query:  402 IRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPD 749
            + SQ  L++    H A  A + +P      +             KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W +  K D  D
Sbjct:   81 MGSQYELKDSPGVHPAGFAAHTSPA----FYPYGQFQYGDPARPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGSRSKEDGED 192          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Match: irx4b (iroquois-class homeodomain protein irx-4-like [Source:NCBI gene;Acc:101157469])

HSP 1 Score: 118.242 bits (295), Expect = 9.007e-30
Identity = 58/94 (61.70%), Postives = 73/94 (77.66%), Query Frame = 3
Query:  501 NHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWI--ANGKSDNPDSTSDSELSE 776
             H+ ++    +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W   A   SD+     DS+ +E
Sbjct:  106 GHSCLDSSSRRKNATRETTSTLKAWLQEHQKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRLKKENKVTWSPRACKSSDDRGYEDDSDEAE 199          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Match: irx3a (iroquois homeobox 3 [Source:NCBI gene;Acc:101162111])

HSP 1 Score: 118.627 bits (296), Expect = 1.001e-29
Identity = 59/91 (64.84%), Postives = 72/91 (79.12%), Query Frame = 3
Query:  534 KNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDS--TSDSELSELFTREYEK 800
            KNATRE++STLKAWL EH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    ++D   +  TSD E  E   RE E+
Sbjct:  112 KNATRESTSTLKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNRTDEEGNVYTSDHEGEEGDKREDEE 202          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Match: irx4a (iroquois-class homeodomain protein irx-4-like [Source:NCBI gene;Acc:101159378])

HSP 1 Score: 117.472 bits (293), Expect = 4.051e-29
Identity = 56/97 (57.73%), Postives = 68/97 (70.10%), Query Frame = 3
Query:  477 TLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSE 767
            TL       +  ++    +KNATRE +STLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    K        D E
Sbjct:  127 TLGQYQYDRYGSMDGGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKGSEEKRYDDDE 223          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Match: irx2a (iroquois homeobox 2 [Source:NCBI gene;Acc:101162396])

HSP 1 Score: 117.472 bits (293), Expect = 5.235e-29
Identity = 52/75 (69.33%), Postives = 64/75 (85.33%), Query Frame = 3
Query:  513 VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS 737
            +N    +KNATR+ ++TLKAWLQEH+ NPYP+KGEKI+LAI+T+M+LTQVSTWFANARRRLKKENK+ W    KS
Sbjct:  109 LNDPAYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKS 183          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Match: SMESG000022899.1 (SMESG000022899.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 260/260 (100.00%), Postives = 260/260 (100.00%), Query Frame = 3
Query:  120 MEKPNCCLDPKMCLPFRLLDCVQTQATGYKYNVLFVKQNGNLMNCLKNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 899
            MEKPNCCLDPKMCLPFRLLDCVQTQATGYKYNVLFVKQNGNLMNCLKNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT
Sbjct:    1 MEKPNCCLDPKMCLPFRLLDCVQTQATGYKYNVLFVKQNGNLMNCLKNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 260          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Match: SMESG000022899.1 (SMESG000022899.1)

HSP 1 Score: 447.203 bits (1149), Expect = 3.197e-160
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 3
Query:  258 KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 899
            KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT
Sbjct:    7 KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 220          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Match: SMESG000022899.1 (SMESG000022899.1)

HSP 1 Score: 446.817 bits (1148), Expect = 3.771e-160
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 3
Query:  258 KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 899
            KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT
Sbjct:    4 KNHEEELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDVLENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEPSDCSHEDPAT 217          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Match: SMESG000015279.1 (SMESG000015279.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.134e-34
Identity = 80/179 (44.69%), Postives = 102/179 (56.98%), Query Frame = 3
Query:  414 DVLENWRQFHQAALANNLNPITLAHLHTINHA-DVNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGK--------------------------SDNPDSTSDSEL---SELFTREYEKPN-SNQKITKKNHIWSIIDM 857
            D  E WRQ HQA + NNL+P  LA   +  +  D      +KNATRE +S LKAWL +HK NPYP+KGEKI+LA++T+M+LTQVSTWFANARRRLKKENK+ W A  +                              DS  +SEL    E F  + EK + S  + +K N IWSI ++
Sbjct:  123 DHWETWRQIHQATINNNLSPHFLALCQSSGYPPDFPNAPRRKNATRETTSILKAWLNQHKKNPYPTKGEKIMLALITKMTLTQVSTWFANARRRLKKENKMTWTARTRHEDDIDETGDDDEDDDDEEDNENDDDISKSDSRFESELRKNDESFLSKSEKSDTSADETSKSNKIWSIAEI 301          
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Match: SMESG000026100.1 (SMESG000026100.1)

HSP 1 Score: 126.716 bits (317), Expect = 3.357e-33
Identity = 65/118 (55.08%), Postives = 85/118 (72.03%), Query Frame = 3
Query:  471 PITLAHLHTINHAD----VNQIQVKKNATRENSSTLKAWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGWIANGKS-DNPDSTSDSELSELFTREYEKPNS 809
            P++   LH  NH++    +N    +KNATRE +S LKAWL EHK NPYP+KGEKI+LA++T+M+LTQVSTWFANARRRLKKENK+ W  N KS D  D   D++ S++ +R  + P S
Sbjct:  108 PMSSRVLHVPNHSENFMEMNSHPRRKNATRETTSILKAWLNEHKKNPYPTKGEKIMLAVITKMTLTQVSTWFANARRRLKKENKMTWSPNQKSEDEADDLEDTDSSDIRSRLQDDPAS 225          
The following BLAST results are available for this feature:
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IRX12.564e-2948.00iroquois homeobox 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
IRX42.041e-2880.95iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6... [more]
IRX42.041e-2880.95iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6... [more]
IRX42.041e-2880.95iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6... [more]
IRX42.313e-2880.95iroquois homeobox 4 [Source:HGNC Symbol;Acc:HGNC:6... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
irx-11.705e-2355.95Putative iroquois-class homeodomain protein irx-1 ... [more]
ceh-601.395e-636.21C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mirr2.427e-2875.71gene:FBgn0014343 transcript:FBtr0330077[more]
mirr2.482e-2875.71gene:FBgn0014343 transcript:FBtr0075911[more]
mirr2.482e-2875.71gene:FBgn0014343 transcript:FBtr0075912[more]
caup3.187e-2879.37gene:FBgn0015919 transcript:FBtr0075909[more]
ara7.681e-2879.37gene:FBgn0015904 transcript:FBtr0075908[more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irx3b1.985e-3052.85iroquois homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-030... [more]
irx1a6.702e-3049.61iroquois homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
irx1a6.832e-3051.64iroquois homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
irx4b1.028e-2960.00iroquois homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-040... [more]
irx4b1.028e-2960.00iroquois homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1b9.110e-3157.94structural maintenance of chromosomes 1B [Source:X... [more]
fancm5.393e-2969.33FA complementation group M [Source:Xenbase;Acc:XB-... [more]
lypla16.263e-2968.42lysophospholipase 1 [Source:Xenbase;Acc:XB-GENE-94... [more]
fancm9.542e-2969.33FA complementation group M [Source:Xenbase;Acc:XB-... [more]
ndufaf51.507e-2873.91NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Irx11.444e-3148.67Iroquois homeobox 1 [Source:MGI Symbol;Acc:MGI:119... [more]
Irx21.583e-3068.00Iroquois homeobox 2 [Source:MGI Symbol;Acc:MGI:119... [more]
Irx12.993e-3048.67Iroquois homeobox 1 [Source:MGI Symbol;Acc:MGI:119... [more]
Irx44.259e-2972.22Iroquois homeobox 4 [Source:MGI Symbol;Acc:MGI:135... [more]
Irx44.259e-2972.22Iroquois homeobox 4 [Source:MGI Symbol;Acc:MGI:135... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2TAQ8|IRX1B_XENLA1.150e-3058.88Iroquois-class homeodomain protein irx-1-B OS=Xeno... [more]
sp|Q6F2E3|IRX1_XENTR4.826e-3057.94Iroquois-class homeodomain protein irx-1 OS=Xenopu... [more]
sp|P81068|IRX1_MOUSE2.094e-2948.67Iroquois-class homeodomain protein IRX-1 OS=Mus mu... [more]
sp|Q9YGK8|IRX1A_XENLA2.398e-2958.59Iroquois-class homeodomain protein irx-1-A OS=Xeno... [more]
sp|P78414|IRX1_HUMAN1.231e-2848.00Iroquois-class homeodomain protein IRX-1 OS=Homo s... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IV934.627e-3357.14Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A1I8J4E66.231e-3260.91Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A2H1CL682.363e-3062.14Homeobox domain protein OS=Fasciola hepatica OX=61... [more]
A0A433TYJ02.426e-3048.59Homeobox domain-containing protein (Fragment) OS=E... [more]
A0A1S8WJU42.960e-3060.71Homeobox domain protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irx1a6.313e-3053.10iroquois homeobox 1 [Source:NCBI gene;Acc:10302468... [more]
irx1a6.744e-3053.10iroquois homeobox 1 [Source:NCBI gene;Acc:10302468... [more]
irx4a9.597e-3056.25iroquois-class homeodomain protein irx-4 [Source:N... [more]
irx3b1.600e-2960.00iroquois homeobox 3 [Source:NCBI gene;Acc:10303522... [more]
irx2a1.683e-2969.33iroquois homeobox 2 [Source:NCBI gene;Acc:10302499... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002620.11.797e-3152.00pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 g... [more]
mkxb1.368e-1548.57mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513... [more]
pknox21.497e-636.51pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TOS81.002e-744.44Homeodomain-containing protein and putative transc... [more]
CUP93.815e-742.59Homeodomain-containing transcriptional repressor; ... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO419822.194e-3180.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411781.584e-841.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364396.029e-750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393757.067e-742.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irx1a6.765e-3051.72iroquois-class homeodomain protein irx-1 [Source:N... [more]
irx4b9.007e-3061.70iroquois-class homeodomain protein irx-4-like [Sou... [more]
irx3a1.001e-2964.84iroquois homeobox 3 [Source:NCBI gene;Acc:10116211... [more]
irx4a4.051e-2957.73iroquois-class homeodomain protein irx-4-like [Sou... [more]
irx2a5.235e-2969.33iroquois homeobox 2 [Source:NCBI gene;Acc:10116239... [more]
back to top
BLAST of Iroquois-class homeodomain protein IRX-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022899.10.000e+0100.00SMESG000022899.1[more]
SMESG000022899.13.197e-160100.00SMESG000022899.1[more]
SMESG000022899.13.771e-160100.00SMESG000022899.1[more]
SMESG000015279.11.134e-3444.69SMESG000015279.1[more]
SMESG000026100.13.357e-3355.08SMESG000026100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007957 ID=SMED30007957|Name=Iroquois-class homeodomain protein IRX-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1028bp
AATTTTTTTATTGATGACTTAAATAGACGGTAAAGGTGACAAAATGATCA
AATCACGAAAAATTTCAAGCTGAATTTTCATAAAACAATTTTTTGTTATT
TTAAAAAAAAAAAATTTCCATGGAAAAGCCAAATTGTTGTCTCGACCCGA
AAATGTGTTTGCCGTTCAGACTATTAGACTGTGTTCAGACCCAAGCTACC
GGATATAAATATAACGTTTTATTTGTAAAGCAGAATGGTAATTTAATGAA
CTGTTTAAAGAACCATGAAGAAGAATTACGAGATCGCAATTTGTTTTCCA
CGTACTACAACTGTTCCCGATATGGAGGAATTCCACCGGAACATATTATT
CTCGCCAATAAGGTGACAGGATTTTTAGCGATGAATGACCCAAACATGGA
TATTCGAAGCCAAGATGTCCTGGAAAATTGGAGACAGTTTCACCAAGCAG
CTTTAGCCAATAACCTCAACCCTATTACACTGGCCCATCTTCATACTATA
AATCATGCCGATGTCAATCAGATTCAAGTAAAAAAAAATGCCACCCGAGA
AAACTCCAGCACTCTCAAAGCCTGGCTACAAGAACACAAAGACAATCCTT
ATCCTTCGAAAGGTGAGAAAATTCTGCTCGCAATTCTCACACAAATGAGC
TTAACCCAAGTAAGTACTTGGTTTGCCAATGCTCGAAGACGATTGAAAAA
AGAAAACAAAATCGGTTGGATTGCAAATGGAAAATCAGACAATCCCGATT
CCACTTCAGATTCAGAATTATCAGAACTTTTTACTCGAGAATACGAGAAA
CCGAATTCCAATCAGAAAATTACCAAAAAAAATCACATTTGGTCTATTAT
TGACATGATTTCCGAACCGAGTGATTGCTCTCATGAAGACCCTGCAACTT
AAGGTCTTCGGTACTTAACTAATTAACTTCTGAACGTTTCAAATGGTATG
AAACTTTGCTTATCTGTAAATAATCACTAGACATGCATTTGTCATTATAA
ATACATTTTTTCCTGATTTAAAAAAAAA
back to top

protein sequence of SMED30007957-orf-1

>SMED30007957-orf-1 ID=SMED30007957-orf-1|Name=SMED30007957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
MEKPNCCLDPKMCLPFRLLDCVQTQATGYKYNVLFVKQNGNLMNCLKNHE
EELRDRNLFSTYYNCSRYGGIPPEHIILANKVTGFLAMNDPNMDIRSQDV
LENWRQFHQAALANNLNPITLAHLHTINHADVNQIQVKKNATRENSSTLK
AWLQEHKDNPYPSKGEKILLAILTQMSLTQVSTWFANARRRLKKENKIGW
IANGKSDNPDSTSDSELSELFTREYEKPNSNQKITKKNHIWSIIDMISEP
SDCSHEDPAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR008422Homeobox_KN_domain
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007507heart development
GO:0030154cell differentiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus