AP complex subunit beta

Overview
NameAP complex subunit beta
Smed IDSMED30007943
Length (bp)3112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AP complex subunit beta (SMED30007943) t-SNE clustered cells

Violin plots show distribution of expression levels for AP complex subunit beta (SMED30007943) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AP complex subunit beta (SMED30007943) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AP complex subunit beta (SMED30007943) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007943

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007943h1SMcG0004493 dd_Smed_v4_893_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AP complex subunit beta vs. Ensembl Human
Match: AP1B1 (adaptor related protein complex 1 subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:554])

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 654/963 (67.91%), Postives = 766/963 (79.54%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGD-ADSVDIVKEAAPTQT---VIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTL-----------ADIFGNFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PP++FV+ G+  V + L  RT   + A+S +     AP      VIP+Q  L+GDL++LDL P             P    P++ S                   +    G  +D+L           A +  N GAP+G G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPL+  G VMK+E L  +QVA++ NIDV YF  + PL+IL +++G+M++++FL+TWKDIP   E Q+++    L+AE  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG    TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGP-------------PVSGPPLATSSV--------------QMGAVDLLGGGLDSLIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAY 933          
BLAST of AP complex subunit beta vs. Ensembl Human
Match: AP1B1 (adaptor related protein complex 1 subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:554])

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 654/963 (67.91%), Postives = 766/963 (79.54%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGD-ADSVDIVKEAAPTQT---VIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTL-----------ADIFGNFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PP++FV+ G+  V + L  RT   + A+S +     AP      VIP+Q  L+GDL++LDL P             P    P++ S                   +    G  +D+L           A +  N GAP+G G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPL+  G VMK+E L  +QVA++ NIDV YF  + PL+IL +++G+M++++FL+TWKDIP   E Q+++    L+AE  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG    TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGP-------------PVSGPPLATSSV--------------QMGAVDLLGGGLDSLIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAY 933          
BLAST of AP complex subunit beta vs. Ensembl Human
Match: AP1B1 (adaptor related protein complex 1 subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:554])

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 654/963 (67.91%), Postives = 766/963 (79.54%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGD-ADSVDIVKEAAPTQT---VIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTL-----------ADIFGNFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PP++FV+ G+  V + L  RT   + A+S +     AP      VIP+Q  L+GDL++LDL P             P    P++ S                   +    G  +D+L           A +  N GAP+G G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPL+  G VMK+E L  +QVA++ NIDV YF  + PL+IL +++G+M++++FL+TWKDIP   E Q+++    L+AE  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG    TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGP-------------PVSGPPLATSSV--------------QMGAVDLLGGGLDSLIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAY 933          
BLAST of AP complex subunit beta vs. Ensembl Human
Match: AP2B1 (adaptor related protein complex 2 subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:563])

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. Ensembl Human
Match: AP1B1 (adaptor related protein complex 1 subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:554])

HSP 1 Score: 1252.27 bits (3239), Expect = 0.000e+0
Identity = 652/968 (67.36%), Postives = 763/968 (78.82%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGD-ADSVDIVKEAAPTQT---VIPSQDTLIGDLMDLDLNP-------------IQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYT---LSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PP++FV+ G+  V + L  RT   + A+S +     AP      VIP+Q  L+GDL++LDL P             +    + GG  +     +P                           T       A +  N GAP+G G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPL+  G VMK+E L  +QVA++ NIDV YF  + PL+IL +++G+M++++FL+TWKDIP   E Q+++    L+AE  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG    T   LSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEP----------------------EGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAY 943          
BLAST of AP complex subunit beta vs. Ensembl Celegans
Match: apb-1 (AP complex subunit beta [Source:UniProtKB/TrEMBL;Acc:Q7YZG8])

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 489/657 (74.43%), Postives = 560/657 (85.24%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLN----SRTEGGDADSVDIVKEA----APTQTVIPSQDTLIGDLMDLDLNPIQGNQ---MFGGS 2056
            TDSKYFTTTKKGEIFELK ELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDN+ELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRV+KIT YLCDPLR+C+KDEDPYVRKTAAVCVAKL+D++  +V++ GF+ELL DLLSD+NPMVVANAVAA++E+ E         ++  +  +VNKLLTALNECTEWGQVFILDA+A Y P+D+ E Q ICER+ PRL+HANAAVVLS VKV+MKL++M+    DF+  + KKLAPP+VT LSAEPEIQYVALRNINLIVQKR +ILK E+KVFFVKYNDPIYVK+EKLDIMIRL    NI QVL+ELKEYA EVDVDFVRKSVRAIGRCAIKVEA++ERC+ TL++LIQTKVNYVVQEA+VVIKDIFRKYPN+YESII+ LCENLDTLDEPEA+ASMIWIIGEYAERIDNA+ELLESF+EGF DENTQVQLQLLTA+VKLFLKRP   Q LVQ VLSLATQ+SDNPDLRDRG+IYWRLLS DPAAAK VVL EKPLISEETDLLEPSLL++L+CH+ TLASVYH+PP++F+D      RQ+N    ++      D+      A    A   TVIPSQD +I DL+ LDLN    +     FGG+
Sbjct:    2 TDSKYFTTTKKGEIFELKNELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVEKITEYLCDPLRRCMKDEDPYVRKTAAVCVAKLHDMNPALVKEQGFVELLNDLLSDANPMVVANAVAALTEMNE------QQTVIEVNSQMVNKLLTALNECTEWGQVFILDALAGYTPRDERETQNICERISPRLAHANAAVVLSTVKVLMKLIDMMPADSDFITQLTKKLAPPMVTLLSAEPEIQYVALRNINLIVQKRPDILKQEMKVFFVKYNDPIYVKMEKLDIMIRLAQQNNIAQVLSELKEYATEVDVDFVRKSVRAIGRCAIKVEASSERCVQTLLELIQTKVNYVVQEAVVVIKDIFRKYPNRYESIISALCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFVEGFHDENTQVQLQLLTAVVKLFLKRPGVAQALVQRVLSLATQDSDNPDLRDRGFIYWRLLSADPAAAKNVVLTEKPLISEETDLLEPSLLEQLVCHIGTLASVYHKPPSAFIDPAKAPLRQINPIPAAKFGSSLLDTSSTPNAARNGSAAAPTVIPSQDQVIADLLSLDLNAPAASANTGAFGGA 652          
BLAST of AP complex subunit beta vs. Ensembl Celegans
Match: apb-1 (AP complex subunit beta [Source:UniProtKB/TrEMBL;Acc:Q7YZG8])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 488/657 (74.28%), Postives = 558/657 (84.93%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSV--------DIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQ---MFGGS 2056
            TDSKYFTTTKKGEIFELK ELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDN+ELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRV+KIT YLCDPLR+C+KDEDPYVRKTAAVCVAKL+D++  +V++ GF+ELL DLLSD+NPMVVANAVAA++E+ E         ++  +  +VNKLLTALNECTEWGQVFILDA+A Y P+D+ E Q ICER+ PRL+HANAAVVLS VKV+MKL++M+    DF+  + KKLAPP+VT LSAEPEIQYVALRNINLIVQKR +ILK E+KVFFVKYNDPIYVK+EKLDIMIRL    NI QVL+ELKEYA EVDVDFVRKSVRAIGRCAIKVEA++ERC+ TL++LIQTKVNYVVQEA+VVIKDIFRKYPN+YESII+ LCENLDTLDEPEA+ASMIWIIGEYAERIDNA+ELLESF+EGF DENTQVQLQLLTA+VKLFLKRP   Q LVQ VLSLATQ+SDNPDLRDRG+IYWRLLS DPAAAK VVL EKPLISEETDLLEPSLL++L+CH+ TLASVYH+PP++F+D      RQ+N         S+             +A   TVIPSQD +I DL+ LDLN    +     FGG+
Sbjct:    2 TDSKYFTTTKKGEIFELKNELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVEKITEYLCDPLRRCMKDEDPYVRKTAAVCVAKLHDMNPALVKEQGFVELLNDLLSDANPMVVANAVAALTEMNE------QQTVIEVNSQMVNKLLTALNECTEWGQVFILDALAGYTPRDERETQNICERISPRLAHANAAVVLSTVKVLMKLIDMMPADSDFITQLTKKLAPPMVTLLSAEPEIQYVALRNINLIVQKRPDILKQEMKVFFVKYNDPIYVKMEKLDIMIRLAQQNNIAQVLSELKEYATEVDVDFVRKSVRAIGRCAIKVEASSERCVQTLLELIQTKVNYVVQEAVVVIKDIFRKYPNRYESIISALCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFVEGFHDENTQVQLQLLTAVVKLFLKRPGVAQALVQRVLSLATQDSDNPDLRDRGFIYWRLLSADPAAAKNVVLTEKPLISEETDLLEPSLLEQLVCHIGTLASVYHKPPSAFIDPAKAPLRQINPIPAAKFGSSLLDTSSTPNAARNGSAAAPTVIPSQDQVIADLLSLDLNAPAASANTGAFGGA 652          
BLAST of AP complex subunit beta vs. Ensembl Celegans
Match: apb-3 (AP-3 complex subunit beta [Source:UniProtKB/TrEMBL;Acc:O62348])

HSP 1 Score: 220.32 bits (560), Expect = 4.145e-59
Identity = 167/547 (30.53%), Postives = 283/547 (51.74%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKD---------DSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDN-AEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAK---EVVLAEKP 1762
            +LKA L+S +   K +A+K++I  +  GKDVS LF  VV  +   N+ELKKLV++YL+ YA+ Q D A+L+++TF R   DPN LIR  A+R +  IRV  +   +   ++  ++D  PYVRK AA  + KLY ++  +  +   ++ +  LL+D   +V+ +AV A  EI  C    D  H+           L   L +  EWGQ+ +++ +  Y   +         D++   +     P L   N +VV++ V    +L   + P     +  + ++A  LV  L    E QYV L NI  I ++   +    +K FFV+  D   VK  KL ++  L +  N+  +L EL+ Y    D+     +V AIGRCA++V A +++CMT L+ LI +    VV  A+VVIK +   + +   ++++ L   +  +   +A+A +IW++  + E++ + A + L    + F  EN  V+L+ L   VKL+L +   ++++VQ V  LA  +    D+RDR      L+      ++   E+ +++KP
Sbjct:   30 DLKAMLDSNKDNLKVDAMKRIINLIAKGKDVSELFAAVVKNVAAKNVELKKLVFVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRGSALRVLTSIRVPMVAPIMLLAIKDAVRDMSPYVRKVAAHAIPKLYSLEPEL--EPQLVDCIDFLLADRRSLVLGSAVYAFDEI--CPHRLDLLHKHF-------RALCRGLADVDEWGQIVMINMLTRYARHELADPDRGPPDTDVVLLLNSARPLLQSRNCSVVMAVV----QLFYHVAP-----KAQLSQIARALVRLLRGPRETQYVVLTNIATICERNPTMFDPFLKSFFVRSCDSSLVKKLKLHVLTSLVSEANVHIILRELQTYVHMSDL--ASPAVEAIGRCAVRVGAVSDQCMTGLVQLISSSDEKVVCSAVVVIKRLL--HASAPLNLLSRLMRLMPNMIAAQARACVIWLVATHVEQVLHMAPDFLRLIAKKFSTENELVKLEALKLAVKLWLVKRDDSEKIVQYVFQLARFDLSY-DVRDRCRFLRNLMFNTEILSQHMEEIFMSKKP 551          
BLAST of AP complex subunit beta vs. Ensembl Celegans
Match: apb-3 (AP-3 complex subunit beta [Source:UniProtKB/TrEMBL;Acc:O62348])

HSP 1 Score: 212.616 bits (540), Expect = 1.333e-56
Identity = 167/557 (29.98%), Postives = 283/557 (50.81%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKD---------DSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKR----------SEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDN-AEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAK---EVVLAEKP 1762
            +LKA L+S +   K +A+K++I  +  GKDVS LF  VV  +   N+ELKKLV++YL+ YA+ Q D A+L+++TF R   DPN LIR  A+R +  IRV  +   +   ++  ++D  PYVRK AA  + KLY ++  +  +   ++ +  LL+D   +V+ +AV A  EI  C    D  H+           L   L +  EWGQ+ +++ +  Y   +         D++   +     P L   N +VV++ V    +L   + P     +  + ++A  LV  L    E QYV L NI  I ++             +    +K FFV+  D   VK  KL ++  L +  N+  +L EL+ Y    D+     +V AIGRCA++V A +++CMT L+ LI +    VV  A+VVIK +   + +   ++++ L   +  +   +A+A +IW++  + E++ + A + L    + F  EN  V+L+ L   VKL+L +   ++++VQ V  LA  +    D+RDR      L+      ++   E+ +++KP
Sbjct:   30 DLKAMLDSNKDNLKVDAMKRIINLIAKGKDVSELFAAVVKNVAAKNVELKKLVFVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRGSALRVLTSIRVPMVAPIMLLAIKDAVRDMSPYVRKVAAHAIPKLYSLEPEL--EPQLVDCIDFLLADRRSLVLGSAVYAFDEI--CPHRLDLLHKHF-------RALCRGLADVDEWGQIVMINMLTRYARHELADPDRGPPDTDVVLLLNSARPLLQSRNCSVVMAVV----QLFYHVAP-----KAQLSQIARALVRLLRGPRETQYVVLTNIATICERNPVEEGTYAISKTMFDPFLKSFFVRSCDSSLVKKLKLHVLTSLVSEANVHIILRELQTYVHMSDL--ASPAVEAIGRCAVRVGAVSDQCMTGLVQLISSSDEKVVCSAVVVIKRLL--HASAPLNLLSRLMRLMPNMIAAQARACVIWLVATHVEQVLHMAPDFLRLIAKKFSTENELVKLEALKLAVKLWLVKRDDSEKIVQYVFQLARFDLSY-DVRDRCRFLRNLMFNTEILSQHMEEIFMSKKP 561          
BLAST of AP complex subunit beta vs. Ensembl Celegans
Match: apb-1 (AP complex subunit beta [Source:UniProtKB/TrEMBL;Acc:Q7YZG8])

HSP 1 Score: 153.68 bits (387), Expect = 6.724e-42
Identity = 90/117 (76.92%), Postives = 98/117 (83.76%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDC--DDPNPLIRALAVRTMGCIRVD 463
            TDSKYFTTTKKGEIFELK ELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDN+ELKKLVYLYLMNYAK+QPD AI+AVNTFV+    +D N    A  V  +   R D
Sbjct:    2 TDSKYFTTTKKGEIFELKNELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKVAIKNDINAFYFATTVPLLAYFRED 118          

HSP 2 Score: 104.76 bits (260), Expect = 5.297e-25
Identity = 51/120 (42.50%), Postives = 76/120 (63.33%), Query Frame = 2
Query: 2543 TAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIR-LSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSR 2899
            T ++VA++ +I+  YF   VPL     ++G+MEKR FL  WK IP   E Q+ L     ++A+    +L++NN+ T+A+R VD Q +LY S+K  NN+ VL+ELK+   T   TLSLKS+
Sbjct:   90 TFVKVAIKNDINAFYFATTVPLLAYFREDGQMEKREFLEEWKSIPEQNEQQFTLQNTHNMNADAICTKLQQNNIHTVARRQVDNQQLLYHSVKYTNNLNVLSELKVNSQTTSITLSLKSK 209          
BLAST of AP complex subunit beta vs. Ensembl Fly
Match: AP-1-2beta (gene:FBgn0010380 transcript:FBtr0074789)

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 659/940 (70.11%), Postives = 766/940 (81.49%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHF-VRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELK+ELN+++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+D NPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKLYDI AT+VED GFL+ LKDLLSDSNPMVVANAVAA+SEI E +QS     ++  +   +NKLLTALNECTEWGQVFILD++ANY PKD+ EAQ ICER+ PRL+HANAAVVLSAVKV+MKLLEML+   DF  T+ KKLAPPLVT LS+EPE+QYVALRNINLIVQKR +ILK+E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVL+ELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYESII+TLCENLDTLDEPEA+ASM+WIIGEYAERIDNA+ELL+SFLEGFQDEN QVQLQLLTA+VKLFLKRP+ TQELVQ+VLSLATQ+SDNPDLRDRG+IYWRLLSTDPAAAKEVVLA+KPLISEETDLLEP+LLDELICH+++LASVYH+PP +FV+G+   VR+ L +R  G  A +      A     VIP+Q++LIGDL+ +D+N          + N            DLLG GLD LL   P++    A G +   L DIFG  GA L  G            PK  WL A KGKGLEIQGTFSR+ G ++ MD+T  N+A Q +T+FAIQ NKNSFG+ PA PM    PL PNQ+I  S+ L  NGP+ ++E L  +QVA++ NID+ YF C+V  N+L  ++G+++KRVFL+TWK+IP A E QY L+G+  + +  + ++  NN+FTIAKRNV+GQDMLYQSLKL NNIWVL ELK++PG  E TLSLKSR +EV   +  AY
Sbjct:    2 TDSKYFTTTKKGEIFELKSELNNDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDISATMVEDQGFLDQLKDLLSDSNPMVVANAVAALSEINEASQS--GQPLVEMNSVTINKLLTALNECTEWGQVFILDSLANYSPKDEREAQSICERITPRLAHANAAVVLSAVKVLMKLLEMLSSDSDFCATLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLANQSNIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEPSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIISTLCENLDTLDEPEARASMVWIIGEYAERIDNADELLDSFLEGFQDENAQVQLQLLTAVVKLFLKRPSDTQELVQHVLSLATQDSDNPDLRDRGFIYWRLLSTDPAAAKEVVLADKPLISEETDLLEPTLLDELICHISSLASVYHKPPTAFVEGRGAGVRKSLPNRAAGSAAGAEQAENAAGSEAMVIPNQESLIGDLLSMDINAPAMPSAPAATSN-----------VDLLGGGLDILLGGPPAEA---APGGATSLLGDIFGLGGATLSVGVQ---------IPKVTWLPAEKGKGLEIQGTFSRRNG-EVFMDMTLTNKAMQPMTNFAIQLNKNSFGLVPASPMQA-APLPPNQSIEVSMALGTNGPIQRMEPLNNLQVAVKNNIDIFYFACLVHGNVLFAEDGQLDKRVFLNTWKEIPAANELQYTLSGVIGTTDGIASKMTTNNIFTIAKRNVEGQDMLYQSLKLTNNIWVLLELKLQPGNPEATLSLKSRSVEVANIIFAAY 914          
BLAST of AP complex subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0070702)

HSP 1 Score: 161.384 bits (407), Expect = 7.961e-40
Identity = 101/309 (32.69%), Postives = 168/309 (54.37%), Query Frame = 2
Query:  860 PRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERID-NAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLL-------STDPAAAKEVVLAEKP 1762
            P L   NA+VV++    + +L   + P ++     ++ +A  L+  L +  E+Q V L  I  +  KR  I +  +K FFV+ +DP ++KL KLDI+  L +  +I  +L E + Y    D  FV  +++AIGRCA  ++   E C++ L+ L+     +VV E++VVIK + +    ++  II  + + +D ++ P A+A++IW+IGEY E++   A ++L    + F DE   V+LQ+L   VKL+L  P  T  L Q V +LA  +  N D+RDR     +++       S     A++V LA KP
Sbjct:  342 PLLQSRNASVVMA----VAQLYHHVAPKNE-----VQLIAKALIRLLRSHKEVQSVVLNCIASMSTKRKAIFEPHLKSFFVRTSDPTHIKLLKLDILTNLASAGSISLILREFQTYISSSDRSFVAATIQAIGRCASSIKEVTETCLSGLVHLLSNHDEHVVAESVVVIKRLLQTKAAEHFEIITQMAKLIDYINVPAARAAIIWLIGEYNEKVPLIAPDVLRKMAKSFVDEQDVVKLQVLNLGVKLYLTNPEQTSLLCQYVFTLARYDP-NYDVRDRARFLRQIIFPASGTSSVLSQHARQVFLASKP 640          

HSP 2 Score: 133.65 bits (335), Expect = 2.517e-31
Identity = 86/217 (39.63%), Postives = 126/217 (58.06%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANY 811
            +LK  L+S +   K EA+K++I  +  G+D S LFP VV  + + N+E+KKLVY+YL+ YA+ Q D A+L+++TF R   DPN LIRA A+R +  IRV  I   +   +R    D  PYVRKTAA  + KLY +DA   + +  + +++ LLSD   +VV +AV A  E+  C +  D  H+          KL   L +  EWGQV I++ +  Y
Sbjct:   47 DLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVVSKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLYSLDAD--QKDELVMVIEKLLSDRTTLVVGSAVMAFDEV--CPERVDLIHKNY-------RKLCNFLLDVDEWGQVIIINMLTRY 252          
BLAST of AP complex subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0332290)

HSP 1 Score: 161.384 bits (407), Expect = 7.961e-40
Identity = 101/309 (32.69%), Postives = 168/309 (54.37%), Query Frame = 2
Query:  860 PRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERID-NAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLL-------STDPAAAKEVVLAEKP 1762
            P L   NA+VV++    + +L   + P ++     ++ +A  L+  L +  E+Q V L  I  +  KR  I +  +K FFV+ +DP ++KL KLDI+  L +  +I  +L E + Y    D  FV  +++AIGRCA  ++   E C++ L+ L+     +VV E++VVIK + +    ++  II  + + +D ++ P A+A++IW+IGEY E++   A ++L    + F DE   V+LQ+L   VKL+L  P  T  L Q V +LA  +  N D+RDR     +++       S     A++V LA KP
Sbjct:  342 PLLQSRNASVVMA----VAQLYHHVAPKNE-----VQLIAKALIRLLRSHKEVQSVVLNCIASMSTKRKAIFEPHLKSFFVRTSDPTHIKLLKLDILTNLASAGSISLILREFQTYISSSDRSFVAATIQAIGRCASSIKEVTETCLSGLVHLLSNHDEHVVAESVVVIKRLLQTKAAEHFEIITQMAKLIDYINVPAARAAIIWLIGEYNEKVPLIAPDVLRKMAKSFVDEQDVVKLQVLNLGVKLYLTNPEQTSLLCQYVFTLARYDP-NYDVRDRARFLRQIIFPASGTSSVLSQHARQVFLASKP 640          

HSP 2 Score: 133.65 bits (335), Expect = 2.517e-31
Identity = 86/217 (39.63%), Postives = 126/217 (58.06%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANY 811
            +LK  L+S +   K EA+K++I  +  G+D S LFP VV  + + N+E+KKLVY+YL+ YA+ Q D A+L+++TF R   DPN LIRA A+R +  IRV  I   +   +R    D  PYVRKTAA  + KLY +DA   + +  + +++ LLSD   +VV +AV A  E+  C +  D  H+          KL   L +  EWGQV I++ +  Y
Sbjct:   47 DLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVVSKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLYSLDAD--QKDELVMVIEKLLSDRTTLVVGSAVMAFDEV--CPERVDLIHKNY-------RKLCNFLLDVDEWGQVIIINMLTRY 252          
BLAST of AP complex subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0343568)

HSP 1 Score: 161.384 bits (407), Expect = 7.961e-40
Identity = 101/309 (32.69%), Postives = 168/309 (54.37%), Query Frame = 2
Query:  860 PRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERID-NAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLL-------STDPAAAKEVVLAEKP 1762
            P L   NA+VV++    + +L   + P ++     ++ +A  L+  L +  E+Q V L  I  +  KR  I +  +K FFV+ +DP ++KL KLDI+  L +  +I  +L E + Y    D  FV  +++AIGRCA  ++   E C++ L+ L+     +VV E++VVIK + +    ++  II  + + +D ++ P A+A++IW+IGEY E++   A ++L    + F DE   V+LQ+L   VKL+L  P  T  L Q V +LA  +  N D+RDR     +++       S     A++V LA KP
Sbjct:  342 PLLQSRNASVVMA----VAQLYHHVAPKNE-----VQLIAKALIRLLRSHKEVQSVVLNCIASMSTKRKAIFEPHLKSFFVRTSDPTHIKLLKLDILTNLASAGSISLILREFQTYISSSDRSFVAATIQAIGRCASSIKEVTETCLSGLVHLLSNHDEHVVAESVVVIKRLLQTKAAEHFEIITQMAKLIDYINVPAARAAIIWLIGEYNEKVPLIAPDVLRKMAKSFVDEQDVVKLQVLNLGVKLYLTNPEQTSLLCQYVFTLARYDP-NYDVRDRARFLRQIIFPASGTSSVLSQHARQVFLASKP 640          

HSP 2 Score: 133.65 bits (335), Expect = 2.517e-31
Identity = 86/217 (39.63%), Postives = 126/217 (58.06%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANY 811
            +LK  L+S +   K EA+K++I  +  G+D S LFP VV  + + N+E+KKLVY+YL+ YA+ Q D A+L+++TF R   DPN LIRA A+R +  IRV  I   +   +R    D  PYVRKTAA  + KLY +DA   + +  + +++ LLSD   +VV +AV A  E+  C +  D  H+          KL   L +  EWGQV I++ +  Y
Sbjct:   47 DLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVVSKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLYSLDAD--QKDELVMVIEKLLSDRTTLVVGSAVMAFDEV--CPERVDLIHKNY-------RKLCNFLLDVDEWGQVIIINMLTRY 252          
BLAST of AP complex subunit beta vs. Ensembl Fly
Match: betaCOP (gene:FBgn0008635 transcript:FBtr0074576)

HSP 1 Score: 67.3958 bits (163), Expect = 6.664e-11
Identity = 92/430 (21.40%), Postives = 168/430 (39.07%), Query Frame = 2
Query:  299 NLELKKLVYLYLMNYAKTQPDTA-----ILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQ-----TMIKKLAPPLVTQLSAEPEIQYVALR---NINLIVQKRSEILKNE-----------VKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQ-VLAELKEYAKEVDVD------FVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAE 1495
            N  +KKL+ ++     KT  D       IL  + + +D   PN  +R   +R +  ++  ++   L   +R CL     YVR+ A + +  +Y     +V D    EL+   L     M              C ++     + A  +  +N L + +++   +G +                 Q +   ++ ++ HAN A     ++ I  LL   N S + V+     T+I     P   + +A   I+ V      N+ LIV  R   +K             + V  V     I V+ + L + + L   +NI + VL   KE AK  +V+      + +  VR +  C+IK    A   +  L++ +         + ++ I++  +K+P     II  L E    +   +   + +WI+GEY E
Sbjct:   69 NHTIKKLLLIFWEIVPKTSADGKLLQEMILVCDAYRKDLQHPNEFLRGSTLRFLCKLKEPELLEPLMPAIRACLDHRHSYVRRNAVLAIFTIYKNFDWLVPDGP--ELIASFLDTQQDM-------------SCKRNAFLMLLHADQERALNYLASCIDQVHTFGDIL----------------QLVIVELIYKVCHANPAERSRFIRCIYNLL---NSSSNAVRYESAGTLITLSLAPTAIKAAASCYIELVVKESDNNVKLIVLDRLVAMKEHEGMEKVMQDLVMDVLRVLAAPDIEVRRKTLALALDLVYSRNIGEMVLVLKKEVAKTHNVEHEDTGKYRQLLVRTLHTCSIKFPDVAANVIPVLVEFLSDTNELAAADVLIFIREAIQKFPALRALIIEHLIEAFPQIKSSKIHRAAVWILGEYVE 464          
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 1256.89 bits (3251), Expect = 0.000e+0
Identity = 655/960 (68.23%), Postives = 766/960 (79.79%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGD-ADSVDI----VKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQ-PMXXXXXXXXXXXXXXXXXXPSQ--------------TSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G+ A+S ++      EA P   VIPSQ  L+GDL++LDL P            QPS Q   M      L   L   +  +PS               ++A A G  +  L D+ G  G P G           YVAPK ++L A K KGLEI GTF+R+ G  + MDL+  N+A   +TDFAIQFN+NSFG+APA P+ +LTPL PNQTI  SLPL   GPVMK+E L  +QVA++ NIDV YF C  PL++L +++G+ME++VFL+TWKDIP   E Q+++  + L+++  S +L+ +N+FTIAKR VD QDMLYQS+KL N IWVLAE++++ G   YTLS+K R  EV   V + Y
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESAESPEVGQSGTSEAPP--AVIPSQGDLLGDLLNLDLAPATTTV----PSVQPSMQMGAMDLLGGGLDSLLGGDIGGSPSMGAALGAPAAMPAALSNAPAVGGGLGDLFDLGGGVGMPTG----------FYVAPKTLFLPAMKAKGLEISGTFARR-GGIIQMDLSLTNKAMSVMTDFAIQFNRNSFGLAPAGPLQVLTPLTPNQTIDVSLPLGTTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPLSLLFVEDGKMERQVFLATWKDIPNDNEAQFQIKDVHLNSDAASNKLQGSNIFTIAKRTVDAQDMLYQSIKLTNGIWVLAEMRVQTGNPNYTLSIKCRAPEVSQFVYQCY 941          
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 1255.35 bits (3247), Expect = 0.000e+0
Identity = 647/983 (65.82%), Postives = 766/983 (77.92%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGD-ADSVDIVKEA------------------------APTQTVIPS-QDTLIGDLMDL---DLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQ--------------TSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G+ A+S ++ +                          AP  T +PS Q ++    MDL    L+ + G++      +  ++ Q    S D     L   +  +PS               ++A A G  +  L D+ G  G P G           YVAPK ++L A K KGLEI GTF+R+ G  + MDL+  N+A   +TDFAIQFN+NSFG+APA P+ +LTPL PNQTI  SLPL   GPVMK+E L  +QVA++ NIDV YF C  PL++L +++G+ME++VFL+TWKDIP   E Q+++  + L+++  S +L+ +N+FTIAKR VD QDMLYQS+KL N IWVLAE++++ G   YTLS+K R  EV   V + Y
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESAESPEVGQSGTSEAPPAVIPSQGDLLGDLLNLDLAPATTTVPSVQPSMQMGAMDLLGGGLDSLMGDESDTPGVSHRTEMQSPQPSSDYSERELGGDIGGSPSMGAALGAPAAMPAALSNAPAVGGGLGDLFDLGGGVGMPTG----------FYVAPKTLFLPAMKAKGLEISGTFARR-GGIIQMDLSLTNKAMSVMTDFAIQFNRNSFGLAPAGPLQVLTPLTPNQTIDVSLPLGTTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPLSLLFVEDGKMERQVFLATWKDIPNDNEAQFQIKDVHLNSDAASNKLQGSNIFTIAKRTVDAQDMLYQSIKLTNGIWVLAEMRVQTGNPNYTLSIKCRAPEVSQFVYQCY 970          
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6564])

HSP 1 Score: 1252.27 bits (3239), Expect = 0.000e+0
Identity = 639/955 (66.91%), Postives = 756/955 (79.16%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQT-----VIPSQDTLIGDLMDLDLNP-----------IQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+  T++KKL+PPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +H NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+ +   + G  D+ +      P  +     VIPSQ  L+GDL++LDL P           I    + GG  +    Q                     PS T A A  S ++ L ++        GG          YVA K +WL A K KGLEI GTFSR+ G+ M MD+TF N+A Q +TDFAIQFNKNSFG+ P  P+ + TPL+P+Q+I  SLPLN  GPVMK++ L  +QVA++ NIDV YF  ++PLN+  +++G+ME++VFL+TWKDIP   E QY++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLLKKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRK-HLPIQHGSIDTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQIAAVDLLGGGLDSLVGQN---------FIPSSVPNTFAPSPTPA-ALSSGLNDLFELSTGMATATGG----------YVAAKTVWLPAVKAKGLEISGTFSRRQGH-MYMDMTFTNKALQHMTDFAIQFNKNSFGVIPTTPLPVHTPLMPSQSIDISLPLNTIGPVMKMDPLNNLQVAVKNNIDVFYFSTLIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKDCHLNADTVSGKLQSNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYVYQMY 931          
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 1238.4 bits (3203), Expect = 0.000e+0
Identity = 649/960 (67.60%), Postives = 760/960 (79.17%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGD-ADSVDI----VKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTL-----ADIFGN------FGAP------------LGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLS 2887
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G+ A+S ++      EA P   VIPSQ  L+GDL++LDL P         +   PS Q  M      L  G    L     +T  Q+   S D        DI G+       GAP            +GGG  +              YVAPK ++L A K KGLEI GTF+R+ G  + MDL+  N+A   +TDFAIQFN+NSFG+APA P+ +LTPL PNQTI  SLPL   GPVMK+E L  +QVA++ NIDV YF C  PL++L +++G+ME++VFL+TWKDIP   E Q+++  + L+++  S +L+ +N+FTIAKR VD QDMLYQS+KL N IWVLAE++++ G   YT++
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESAESPEVGQSGTSEAPP--AVIPSQGDLLGDLLNLDLAP--------ATTTVPSVQPSMQMGAMDLLGGGLDSLPGVSHRTEMQSPQPSSDYSERELGGDIGGSPSMGAALGAPAAMPAALSNAPAVGGGLGDLFDLGGGVGMPTGFYVAPKTLFLPAMKAKGLEISGTFARR-GGIIQMDLSLTNKAMSVMTDFAIQFNRNSFGLAPAGPLQVLTPLTPNQTIDVSLPLGTTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPLSLLFVEDGKMERQVFLATWKDIPNDNEAQFQIKDVHLNSDAASNKLQGSNIFTIAKRTVDAQDMLYQSIKLTNGIWVLAEMRVQTGNPNYTVN 947          
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6564])

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 478/593 (80.61%), Postives = 542/593 (91.40%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ 1897
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+  T++KKL+PPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +H NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLLKKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRK 591          
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:394814])

HSP 1 Score: 1244.57 bits (3219), Expect = 0.000e+0
Identity = 633/958 (66.08%), Postives = 751/958 (78.39%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKE-AAPTQT-------VIPSQDTLI-----------GDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H V R+      G    S+DI      PT +       VIPSQ  L+           G++  +    +    + GG  +    Q                     PS T A    S ++ L ++    G   GG          YV+ K +WL A K KGLEI GTFS +  + + MD++F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PL++L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGVHRKHLPIQHG----SIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLDLGPPGNVPQVSTMQMGAVDLLGGGLDSLVGQ---------TFIPSSVPATFAPSPTPA-VVSSGLNDLFELSSGIGMAPGG----------YVSQKAVWLPAVKAKGLEISGTFSHRQAH-IYMDMSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVCNYVYQVY 931          
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:394814])

HSP 1 Score: 1239.56 bits (3206), Expect = 0.000e+0
Identity = 634/969 (65.43%), Postives = 753/969 (77.71%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKE-AAPTQT-------VIPSQDTLI-----------GDLMDLDLNPIQGNQMFGGSYNQ---PSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQ--------ATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H V R+      G    S+DI      PT +       VIPSQ  L+           G++  +    +    + GG  +       Q   S     +G          PS   A            S ++ L ++    G   GG          YV+ K +WL A K KGLEI GTFS +  + + MD++F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PL++L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGVHRKHLPIQHG----SIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLDLGPPGNVPQVSTMQMGAVDLLGGGLDSLMGEDTQWLGSDLGGGIGGSPAVGQTFIPSSVPATFAPSPTPAVVSSGLNDLFELSSGIGMAPGG----------YVSQKAVWLPAVKAKGLEISGTFSHRQAH-IYMDMSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVCNYVYQVY 952          
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:394814])

HSP 1 Score: 1235.71 bits (3196), Expect = 0.000e+0
Identity = 635/947 (67.05%), Postives = 750/947 (79.20%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKE-AAPTQT-------VIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H V R+      G    S+DI      PT +       VIPSQ  L+GDL++LDL P        G+  Q S  Q                        +    G  +D+L      F  PL          +  +A   +WL A K KGLEI GTFS +  + + MD++F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PL++L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGVHRKHLPIQHG----SIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLDLGP-------PGNVPQVSTMQ----------------------MGAVDLLGGGLDSLVSKL--FSKPLSLNKLKLVETEENIA--YVWLPAVKAKGLEISGTFSHRQAH-IYMDMSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVCNYVYQVY 907          
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:394814])

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 622/922 (67.46%), Postives = 735/922 (79.72%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTL 2884
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H V R+      G             P   VIPSQ  L+GDL++LDL P        G+  Q S  Q                        +    G  +D+L      F  PL          +  +A   +WL A K KGLEI GTFS +  + + MD++F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PL++L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YT+
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGVHRKHLPIQHGSPVGPTPSAGLEQP--QVIPSQGDLLGDLLNLDLGP-------PGNVPQVSTMQ----------------------MGAVDLLGGGLDSLVSKL--FSKPLSLNKLKLVETEENIA--YVWLPAVKAKGLEISGTFSHRQAH-IYMDMSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTV 884          
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:394814])

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 626/930 (67.31%), Postives = 741/930 (79.68%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKE-AAPTQT-------VIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTL 2884
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+ +MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H V R+      G    S+DI      PT +       VIPSQ  L+GDL++LDL P        G+  Q S  Q                        +    G  +D+L      F  PL          +  +A   +WL A K KGLEI GTFS +  + + MD++F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PL++L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YT+
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGVHRKHLPIQHG----SIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLDLGP-------PGNVPQVSTMQ----------------------MGAVDLLGGGLDSLVSKL--FSKPLSLNKLKLVETEENIA--YVWLPAVKAKGLEISGTFSHRQAH-IYMDMSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTV 890          
BLAST of AP complex subunit beta vs. Ensembl Mouse
Match: Ap2b1 (adaptor-related protein complex 2, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1919020])

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. Ensembl Mouse
Match: Ap1b1 (adaptor protein complex AP-1, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1096368])

HSP 1 Score: 1249.96 bits (3233), Expect = 0.000e+0
Identity = 649/967 (67.11%), Postives = 760/967 (78.59%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGDA-DSVDIVKEAAPTQ---TVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLA--DIFG-------------NFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PPN+FV+ G+  V + L  RT   ++ +S +     AP      VIP+Q  L+GDL++LDL P         S  Q                             +    G  +D+L     FG               GAP+  G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPLN  G V+K+E L  +QVA++ NIDV YF  + PL++L +++G+M++++FL+TWKDI    E Q+++    L+ E  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG   +TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLLNLDLGPPVSGPPLAASSVQ---------------------------MGAVDLLGGGLDSLIGDSNFGAPSASVAAAPAPARLGAPISSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQVAVKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCPLNTEAASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHVYQAY 937          
BLAST of AP complex subunit beta vs. Ensembl Mouse
Match: Ap1b1 (adaptor protein complex AP-1, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1096368])

HSP 1 Score: 1216.06 bits (3145), Expect = 0.000e+0
Identity = 636/967 (65.77%), Postives = 745/967 (77.04%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGDA-DSVDIVKEAAPTQ---TVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLA--DIFG-------------NFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPM +                              NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PPN+FV+ G+  V + L  RT   ++ +S +     AP      VIP+Q  L+GDL++LDL P             P    P++ S                   +    G  +D+L     FG               GAP+  G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPLN  G V+K+E L  +QVA++ NIDV YF  + PL++L +++G+M++++FL+TWKDI    E Q+++    L+ E  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG   +TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMSI------------------------------NKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLLNLDLGP-------------PVSGPPLAASSV--------------QMGAVDLLGGGLDSLIGDSNFGAPSASVAAAPAPARLGAPISSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQVAVKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCPLNTEAASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHVYQAY 910          
BLAST of AP complex subunit beta vs. Ensembl Mouse
Match: Ap1b1 (adaptor protein complex AP-1, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1096368])

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 637/974 (65.40%), Postives = 748/974 (76.80%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGDA-DSVDIVKEAAPTQ---TVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTL----ADIFG--NFG----------------APLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPM                               +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PPN+FV+ G+  V + L  RT   ++ +S +     AP      VIP+Q  L+GDL++LDL P             P    P++ S                   +    G  +D+L    ++  G  NFG                AP+  G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPLN  G V+K+E L  +QVA++ NIDV YF  + PL++L +++G+M++++FL+TWKDI    E Q+++    L+ E  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG   +TLSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPM------------------------------SINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLLNLDLGP-------------PVSGPPLAASSV--------------QMGAVDLLGGGLDSLMGDESEGIGDSNFGAPSASVAAAPAPARLGAPISSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQVAVKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCPLNTEAASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHVYQAY 917          
BLAST of AP complex subunit beta vs. Ensembl Mouse
Match: Ap2b1 (adaptor-related protein complex 2, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1919020])

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 453/626 (72.36%), Postives = 515/626 (82.27%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQ 1984
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV                                      KDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFV--------------------------------------KDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTTTNLEQPQVIPSQ 586          

HSP 2 Score: 294.278 bits (752), Expect = 1.810e-84
Identity = 140/265 (52.83%), Postives = 187/265 (70.57%), Query Frame = 2
Query: 2141 PSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:  655 PSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 907          
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Match: sp|P62944|AP2B1_RAT (AP-2 complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Match: sp|Q9DBG3|AP2B1_MOUSE (AP-2 complex subunit beta OS=Mus musculus OX=10090 GN=Ap2b1 PE=1 SV=1)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Match: sp|P63010|AP2B1_HUMAN (AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Match: sp|P63009|AP2B1_BOVIN (AP-2 complex subunit beta OS=Bos taurus OX=9913 GN=AP2B1 PE=1 SV=2)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 640/954 (67.09%), Postives = 757/954 (79.35%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQ----LNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKLAPPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+     +  T+ GD+              VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A    S ++ L ++    G   GG          YVAPK +WL A K KGLEI GTF+ + G+ + M++ F N+A Q +TDFAIQFNKNSFG+ P+ P++I TPL+PNQ+I  SLPLN  GPVMK+E L  +QVA++ NIDV YF C++PLN+L +++G+ME++VFL+TWKDIP   E Q+++    L+A+  S +L+ NNV+TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   + + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKESDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQS---------FIPSSVPATFAPSPTPA-VVSSGLNDLFELSTGIGMAPGG----------YVAPKAVWLPAVKAKGLEISGTFTHRQGH-IYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVY 931          
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Match: sp|Q10567|AP1B1_HUMAN (AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1 PE=1 SV=2)

HSP 1 Score: 1252.65 bits (3240), Expect = 0.000e+0
Identity = 652/968 (67.36%), Postives = 763/968 (78.82%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD-GKHFVRRQLNSRTEGGD-ADSVDIVKEAAPTQT---VIPSQDTLIGDLMDLDLNP-------------IQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNF--------SSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYT---LSLKSRVMEVYPSVQKAY 2935
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S  +  +L  +   +NKLLTALNECTEWGQ+FILD +ANY PKDD EAQ ICERV PRLSHAN+AVVLSAVKV+MK +EML+   D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LLDELIC++ TLASVYH+PP++FV+ G+  V + L  RT   + A+S +     AP      VIP+Q  L+GDL++LDL P             +    + GG  +     +P                           T       A +  N GAP+G G S+         + +  YVAPK +WL A K KGLEI GTF+R+ G+ +SMDL   N+A Q +TDFAIQFN+NSFG+APA P+ +  PL PNQT+  SLPL+  G VMK+E L  +QVA++ NIDV YF  + PL+IL +++G+M++++FL+TWKDIP   E Q+++    L+AE  S +L+ +N+FT+AKRNV+GQDMLYQSLKL N IWVLAEL+I+PG    T   LSLK R  EV   V +AY
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEP----------------------EGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGS-ISMDLQLTNKALQVMTDFAIQFNRNSFGLAPATPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAY 943          
BLAST of AP complex subunit beta vs. TrEMBL
Match: A0A4Z2D8U3 (AP complex subunit beta OS=Schistosoma japonicum OX=6182 GN=EWB00_003290 PE=3 SV=1)

HSP 1 Score: 1410.59 bits (3650), Expect = 0.000e+0
Identity = 712/988 (72.06%), Postives = 815/988 (82.49%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEG---------GDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDL--NPIQGNQMF---------GGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPG-NQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MQGVAASVTDTLGNIKPWLQKVT Q+K TD++YFTTTKKGEIFELKAELNSER+EKKKEAVKKVIASMTVGKDVSALFPDV+NCMQTDNLELKKLVYLYLMNYAKTQPDTAI+AVNTFV+DCDDPNPLIRALAVRTMGCIRV+KIT YLCDPLRKCL DEDPYVRKTAAVCVAKL+DI+A +VED GFLELLKDLL DSNPMVVANAVA+I+EILE T SDSA  +L+F+  V+NKLLTALNECTEWGQVFILDAIA+Y P DD E+Q I ERV PRL+HANAAVVLS VKVIMK+LEM++P+ +F  T+++KLAPPLVT LSAEPEIQYVALRNINLIVQKR +IL  E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYAKEVDVDFVRK+VRAIGRCAIK+E+AAERC+ TLIDLIQTKVNYVVQEA+VVIKDIFRKYPNKYESII+ LCENLDTLDEPEA+ SMIWIIGEYAERIDNA+ELLESFL+GFQDENTQVQLQLLTAIVKLFLKRP+ TQELVQ VL LATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETD+LEP+LLDELICHL++LASVYHRPP+SFV+G+H  RRQL +R  G         GD+   D+     P  TVIP+Q+TLIGDL+D+DL   P   + M             Y   +      G  DLL     + +N      S  A+ S+ D LADIFG  G  + G S +      +V P  I L AA+GKGLEI+GTF+RK    Q+SM+LTF N A  A++ FAIQFNKNSFG+ P Q +++ TPLLP Q+++ SLPL   GPVMK++ L  +Q+A++ NIDV YF  +VP++IL +++GEM+KRVFL+TWKDIP   E Q+ L+ I L+A+ CS +L++NNVFTIAKRNVDGQDMLYQS+KL N IWVLAELKI+P    + LSLKSR M+VY  VQ A+
Sbjct:    1 MQGVAASVTDTLGNIKPWLQKVTAQSKPTDARYFTTTKKGEIFELKAELNSERREKKKEAVKKVIASMTVGKDVSALFPDVINCMQTDNLELKKLVYLYLMNYAKTQPDTAIMAVNTFVKDCDDPNPLIRALAVRTMGCIRVEKITEYLCDPLRKCLSDEDPYVRKTAAVCVAKLHDINAQLVEDRGFLELLKDLLCDSNPMVVANAVASITEILEITTSDSAKSLLSFNGPVINKLLTALNECTEWGQVFILDAIADYTPADDRESQSIIERVSPRLAHANAAVVLSTVKVIMKMLEMVDPASEFASTVVRKLAPPLVTLLSAEPEIQYVALRNINLIVQKRRDILHQEIKVFFVKYNDPIYVKLEKLDIMIRLINQNNIAQVLAELKEYAKEVDVDFVRKAVRAIGRCAIKIESAAERCVATLIDLIQTKVNYVVQEAVVVIKDIFRKYPNKYESIISILCENLDTLDEPEARGSMIWIIGEYAERIDNADELLESFLDGFQDENTQVQLQLLTAIVKLFLKRPSDTQELVQTVLGLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDMLEPTLLDELICHLSSLASVYHRPPSSFVEGRHVARRQLPARVNGVSSTPGANYGDSQQSDV-----PAPTVIPTQETLIGDLLDIDLGSGPSTYDPMIHQFSRPPVPNTGYTSTTPDLLGDGLDDLLPGITTTHVNEEQKTQSGGASSSAADVLADIFG--GIKMTGHSDDLDG---FVPPATILLEAARGKGLEIRGTFARKTSIAQVSMELTFTNNALTAMSGFAIQFNKNSFGLVPTQALNVPTPLLPRQSVNVSLPLATTGPVMKMDPLMNLQIAVKNNIDVFYFATLVPMHILFVEDGEMDKRVFLATWKDIPSQNEQQFTLSPINLTADACSNKLRQNNVFTIAKRNVDGQDMLYQSMKLTNGIWVLAELKIQPDNPSFILSLKSRTMDVYSGVQLAF 978          
BLAST of AP complex subunit beta vs. TrEMBL
Match: C1LGR1 (AP complex subunit beta OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 1409.43 bits (3647), Expect = 0.000e+0
Identity = 711/988 (71.96%), Postives = 815/988 (82.49%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEG---------GDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDL--NPIQGNQMF---------GGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPG-NQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MQGVAASVTDTLGNIKPWLQKVT Q+K TD++YFTTTKKGEIFELKAELNSER+EKKKEAVKKVIASMTVGKDVSALFPDV+NCMQTDNLELKKLVYLYLMNYAKTQPDTAI+AVNTFV+DCDDPNPLIRALAVRTMGCIRV+KIT YLCDPLRKCL DEDPYVRKTAAVCVAKL+DI+A +VED GFLELLKDLL DSNPMVVANAVA+I+EILE T SDSA  +L+F+  V+NKLLTALNECTEWGQVFILDAIA+Y P DD E+Q I ERV PRL+HANAAVVLS VKVIMK+LEM++P+ +F  T+++KLAPPLVT LSAEPEIQYVALRNINLIVQKR +IL  E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYAKEVDVDFVRK+VRAIGRCAIK+E+AAERC+ TLIDLIQTKVNYVVQEA+VVIK+IFRKYPNKYESII+ LCENLDTLDEPEA+ SMIWIIGEYAERIDNA+ELLESFL+GFQDENTQVQLQLLTAIVKLFLKRP+ TQELVQ VL LATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETD+LEP+LLDELICHL++LASVYHRPP+SFV+G+H  RRQL +R  G         GD+   D+     P  TVIP+Q+TLIGDL+D+DL   P   + M             Y   +      G  DLL     + +N      S  A+ S+ D LADIFG  G  + G S +      +V P  I L AA+GKGLEI+GTF+RK    Q+SM+LTF N A  A++ FAIQFNKNSFG+ P Q +++ TPLLP Q+++ SLPL   GPVMK++ L  +Q+A++ NIDV YF  +VP++IL +++GEM+KRVFL+TWKDIP   E Q+ L+ I L+A+ CS +L++NNVFTIAKRNVDGQDMLYQS+KL N IWVLAELKI+P    + LSLKSR M+VY  VQ A+
Sbjct:    1 MQGVAASVTDTLGNIKPWLQKVTAQSKPTDARYFTTTKKGEIFELKAELNSERREKKKEAVKKVIASMTVGKDVSALFPDVINCMQTDNLELKKLVYLYLMNYAKTQPDTAIMAVNTFVKDCDDPNPLIRALAVRTMGCIRVEKITEYLCDPLRKCLSDEDPYVRKTAAVCVAKLHDINAQLVEDRGFLELLKDLLCDSNPMVVANAVASITEILEITTSDSAKSLLSFNGPVINKLLTALNECTEWGQVFILDAIADYTPADDRESQSIIERVSPRLAHANAAVVLSTVKVIMKMLEMVDPASEFASTVVRKLAPPLVTLLSAEPEIQYVALRNINLIVQKRRDILHQEIKVFFVKYNDPIYVKLEKLDIMIRLINQNNIAQVLAELKEYAKEVDVDFVRKAVRAIGRCAIKIESAAERCVATLIDLIQTKVNYVVQEAVVVIKNIFRKYPNKYESIISILCENLDTLDEPEARGSMIWIIGEYAERIDNADELLESFLDGFQDENTQVQLQLLTAIVKLFLKRPSDTQELVQTVLGLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDMLEPTLLDELICHLSSLASVYHRPPSSFVEGRHVARRQLPARVNGVSSTPGANYGDSQQSDV-----PAPTVIPTQETLIGDLLDIDLGSGPSTYDPMIHQFSRPPVPNTGYTSTTPDLLGDGLDDLLPGITTTHVNEEQKTQSGGASSSAADVLADIFG--GIKMTGHSDDLDG---FVPPATILLEAARGKGLEIRGTFARKTSIAQVSMELTFTNNALTAMSGFAIQFNKNSFGLVPTQALNVPTPLLPRQSVNVSLPLATTGPVMKMDPLMNLQIAVKNNIDVFYFATLVPMHILFVEDGEMDKRVFLATWKDIPSQNEQQFTLSPINLTADACSNKLRQNNVFTIAKRNVDGQDMLYQSMKLTNGIWVLAELKIQPDNPSFILSLKSRTMDVYSGVQLAF 978          
BLAST of AP complex subunit beta vs. TrEMBL
Match: C1LGR0 (AP complex subunit beta OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 1409.05 bits (3646), Expect = 0.000e+0
Identity = 711/988 (71.96%), Postives = 815/988 (82.49%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEG---------GDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDL--NPIQGNQMF---------GGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPG-NQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MQGVAASVTDTLGNIKPWLQKVT Q+K TD++YFTTTKKGEIFELKAELNSER+EKKKEAVKKVIASMTVGKDVSALFPDV+NCMQTDNLELKKLVYLYLMNYAKTQPDTAI+AVNTFV+DCDDPNPLIRALAVRTMGCIRV+KIT YLCDPLRKCL DEDPYVRKTAAVCVA+L+DI+A +VED GFLELLKDLL DSNPMVVANAVA+I+EILE T SDSA  +L+F+  V+NKLLTALNECTEWGQVFILDAIA+Y P DD E+Q I ERV PRL+HANAAVVLS VKVIMK+LEM++P+ +F  T+++KLAPPLVT LSAEPEIQYVALRNINLIVQKR +IL  E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYAKEVDVDFVRK+VRAIGRCAIK+E+AAERC+ TLIDLIQTKVNYVVQEA+VVIKDIFRKYPNKYESII+ LCENLDTLDEPEA+ SMIWIIGEYAERIDNA+ELLESFL+GFQDENTQVQLQLLTAIVKLFLKRP+ TQELVQ VL LATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETD+LEP+LLDELICHL++LASVYHRPP+SFV+G+H  RRQL +R  G         GD+   D+     P  TVIP+Q+TLIGDL+D+DL   P   + M             Y   +      G  DLL     + +N      S  A+ S+ D LADIFG  G  + G S +      +V P  I L AA+GKGLEI+GTF+RK    Q+SM+LTF N A  A++ FAIQFNKNSFG+ P Q +++ TPLLP Q+++ SLPL   GPVMK++ L  +Q+A++ NIDV YF  +VP++IL +++GEM+KRVFL+TWKDIP   E Q+ L+ I L+A+ CS +L++NNVFTIAKRNVDGQDMLYQS+KL N IWVLAELKI+P    + LSLKSR M+VY  VQ A+
Sbjct:    1 MQGVAASVTDTLGNIKPWLQKVTAQSKPTDARYFTTTKKGEIFELKAELNSERREKKKEAVKKVIASMTVGKDVSALFPDVINCMQTDNLELKKLVYLYLMNYAKTQPDTAIMAVNTFVKDCDDPNPLIRALAVRTMGCIRVEKITEYLCDPLRKCLSDEDPYVRKTAAVCVAQLHDINAQLVEDRGFLELLKDLLCDSNPMVVANAVASITEILEITTSDSAKSLLSFNGPVINKLLTALNECTEWGQVFILDAIADYTPADDRESQSIIERVSPRLAHANAAVVLSTVKVIMKMLEMVDPASEFASTVVRKLAPPLVTLLSAEPEIQYVALRNINLIVQKRRDILHQEIKVFFVKYNDPIYVKLEKLDIMIRLINQNNIAQVLAELKEYAKEVDVDFVRKAVRAIGRCAIKIESAAERCVATLIDLIQTKVNYVVQEAVVVIKDIFRKYPNKYESIISILCENLDTLDEPEARGSMIWIIGEYAERIDNADELLESFLDGFQDENTQVQLQLLTAIVKLFLKRPSDTQELVQTVLGLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDMLEPTLLDELICHLSSLASVYHRPPSSFVEGRHVARRQLPARVNGVSSTPGANYGDSQQSDV-----PAPTVIPTQETLIGDLLDIDLGSGPSTYDPMIHQFSRPPVPNTGYTSTTPDLLGDGLDDLLPGITTTHVNEEQKTQSGGASSSAADVLADIFG--GIKMTGHSDDLDG---FVPPATILLEAARGKGLEIRGTFARKTSIAQVSMELTFTNNALTAMSGFAIQFNKNSFGLVPTQALNVPTPLLPRQSVNVSLPLATTGPVMKMDPLMNLQIAVKNNIDVFYFATLVPMHILFVEDGEMDKRVFLATWKDIPSQNEQQFTLSPINLTADACSNKLRQNNVFTIAKRNVDGQDMLYQSMKLTNGIWVLAELKIQPDNPSFILSLKSRTMDVYSGVQLAF 978          
BLAST of AP complex subunit beta vs. TrEMBL
Match: A0A3Q0KED0 (AP complex subunit beta OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 710/989 (71.79%), Postives = 818/989 (82.71%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEG---------GDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQ---------QQPMXXXXXXXXXXXXXXXXXXPSQ----TSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MQGVAASVTDTLGN+KPWLQKVT Q+K TD++YFTTTKKGEIFELKAELNSER+EKKKEAVKKVIASMTVGKDVSALFPDV+NCMQTDNLELKKLVYLYLMNYAKTQPDTAI+AVNTFV+DCDDPNPLIRALAVRTMGCIRV+KITAYLCDPLRKCLKDEDPYVRKTAAVCVAKL+DIDA +VED+GFLELL+DLL DSNPMVVANAVA+I+EILE T SDSA  +LAF   V+NKLLTALNECTEWGQVFILDAIA+Y P DD EAQ I ERV PRL+HANAAVVLS VKVIMK+LEM++P+ +   T+I+KLAPPLVT LSAEPEIQYVALRNINLIVQKR +ILK E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYAKEVDVDFVRK+VRAIGRCAIK+E+AAERC++ LIDLIQTKVNYVVQEA+VVIKDIFRKYPNKYESII+ LCENLDTLDEPEA+ SMIWIIGEYAERIDNA+ELLESFL+GFQDENTQVQLQLLTAIVKLFLKRP+ TQELVQ VL LATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETD+LEP+LLDELICHLA+LASVYHRPP+SFV+G+H  RRQL +R  G         GD+   D+     P  TVIP+Q+TLIGDL+D+DL    G   +  + +Q S+                 D L D L  +   +PS+     S  A+ S+ D LADIFG  G  +   S + S+   +V P  + L AA+GKGLEI+GTF+RK   Q+ M+LT  N A   ++ FAIQFNKNSFG+ P Q +++ TPL+P Q+++ SLPL   GPVMK+  L  +Q+A++ NIDV YF  +VP++IL +++GEM+KRVFL+TWKDIP   E Q+ L+   L+A+ CS +L++NNVFTIAKRN+DGQDMLYQS+KL N IWVLAELKI+P    + LSLKSR M+V+P VQ A+
Sbjct:    1 MQGVAASVTDTLGNLKPWLQKVTAQSKPTDARYFTTTKKGEIFELKAELNSERREKKKEAVKKVIASMTVGKDVSALFPDVINCMQTDNLELKKLVYLYLMNYAKTQPDTAIMAVNTFVKDCDDPNPLIRALAVRTMGCIRVEKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLHDIDAQLVEDSGFLELLRDLLCDSNPMVVANAVASITEILEMTNSDSARSLLAFDGPVINKLLTALNECTEWGQVFILDAIADYTPGDDREAQSIIERVSPRLAHANAAVVLSTVKVIMKMLEMVDPASETASTVIRKLAPPLVTLLSAEPEIQYVALRNINLIVQKRRDILKQEIKVFFVKYNDPIYVKLEKLDIMIRLINQSNIGQVLAELKEYAKEVDVDFVRKAVRAIGRCAIKIESAAERCVSALIDLIQTKVNYVVQEAVVVIKDIFRKYPNKYESIISILCENLDTLDEPEARGSMIWIIGEYAERIDNADELLESFLDGFQDENTQVQLQLLTAIVKLFLKRPSDTQELVQTVLGLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDMLEPTLLDELICHLASLASVYHRPPSSFVEGRHVARRQLPARVNGVSSVSGANYGDSQQADV-----PAPTVIPTQETLIGDLLDIDLG--SGPSTYDSTMHQFSRPPVPNTGYSSATPDLLGDGLDDLLPGVTKTHPSEEQKTQSGGASSSAADVLADIFG--GIKMSDPSGDASA---FVPPATVLLEAARGKGLEIRGTFARKAA-QIFMELTLTNNALTPMSGFAIQFNKNSFGLVPTQALNVPTPLMPRQSVNVSLPLATTGPVMKMVPLMNLQIAVKNNIDVFYFATLVPMHILFVEDGEMDKRVFLATWKDIPSQNEQQFTLSPKNLTADACSNKLRQNNVFTIAKRNLDGQDMLYQSMKLTNGIWVLAELKIQPDNPSFILSLKSRTMDVHPGVQLAF 976          
BLAST of AP complex subunit beta vs. TrEMBL
Match: A0A074ZY07 (AP complex subunit beta OS=Opisthorchis viverrini OX=6198 GN=T265_13093 PE=3 SV=1)

HSP 1 Score: 1399.8 bits (3622), Expect = 0.000e+0
Identity = 698/979 (71.30%), Postives = 813/979 (83.04%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRT--EGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQMFGGSYNQPSQQ--QPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRK--PGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MQGVAASVTDTLGNIKPWLQKVT Q+K TD+KYFTTTKKGEIFELKAELNSER++KKKEAVKKVIASMTVGKDVSALFPDV+NCMQTDNLELKKLVYLYLMNYAKTQPDTAI+AVNTFV+DCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKL+DIDA +VED+GFLELL+DLL DSNPMVVANAVA+ISEILE T SD A  +L F   V+NKLLTALNECTEWGQVFILDAIA+Y P DD EAQ I ERV PRL+HANAAVVLS VKV+MK++E+++P  + V T+ +KLAPPLVT LSAEPEIQYVALRNINLIVQKR ++LK E+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYAKEVDVDFVRK+VRAIGRCAIK+E+AAERC++TLI+LIQTKVNYVVQEAI+VIKDIFRKYPNKYESII+ LCENLDTLDEPEA+ SMIWIIGEYAERIDNA+ELL SFL+GFQDEN QVQLQLLTAIVKLFLKRP+ TQELVQ VL LATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETD+LEP+LLDELICHLA+LASVYHRPP+SFV+G+H  RRQL +R+   G +  + D  +  +P  TVIP+Q+TLIGDL+D+D+           +Q  G   N+P +     + G                 +  +A A  S+VDTLADIFG      G  +++ +++  Y  P  +WL A +GKGLEIQGTF R+  PG  ++M L F N +   ++ FAIQFNKNSFG+ PAQP+SI +PL P Q+I+ +LPL+  G + K+E L  +Q+A++ N+DVLYF   VP+++L ++EG+MEKRVFL+TWKDIP   E Q+ L  I L+A+ CS +L++NN+FT+AKRNVDGQDMLY ++K  NNIWVLAELKI+PG   +TLSLKSR+++VYP V  A+
Sbjct:    1 MQGVAASVTDTLGNIKPWLQKVTAQSKPTDAKYFTTTKKGEIFELKAELNSERRDKKKEAVKKVIASMTVGKDVSALFPDVINCMQTDNLELKKLVYLYLMNYAKTQPDTAIMAVNTFVKDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLHDIDAELVEDSGFLELLRDLLCDSNPMVVANAVASISEILESTVSDQARSLLTFDGPVINKLLTALNECTEWGQVFILDAIADYTPVDDREAQSIVERVTPRLAHANAAVVLSTVKVVMKMIELIDPEAELVSTVTRKLAPPLVTLLSAEPEIQYVALRNINLIVQKRKDVLKQEMKVFFVKYNDPIYVKLEKLDIMIRLINQSNIGQVLAELKEYAKEVDVDFVRKAVRAIGRCAIKIESAAERCVSTLIELIQTKVNYVVQEAIIVIKDIFRKYPNKYESIISILCENLDTLDEPEARGSMIWIIGEYAERIDNADELLASFLDGFQDENAQVQLQLLTAIVKLFLKRPSDTQELVQTVLGLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDMLEPTLLDELICHLASLASVYHRPPSSFVEGRHTTRRQLPARSGQTGVEGAARDGGQTVSP--TVIPTQETLIGDLLDMDIGAKPSAYDTPASQFAGAMLNEPGRTGISDLLGDGLDDLLPSVGSTAHGSAPFAAPAGSSAVDTLADIFG------GLETTSATNSFGYEPPMAMWLEAGRGKGLEIQGTFVRQTNPG-LINMKLMFTNHSLSPMSGFAIQFNKNSFGLKPAQPLSINSPLAPRQSITVTLPLSTAGVMAKMEPLMMLQIAVKNNVDVLYFATSVPMHVLFVEEGDMEKRVFLATWKDIPSDSERQFTLNQINLNADACSRKLQQNNIFTVAKRNVDGQDMLYLTMKTTNNIWVLAELKIQPGNPTFTLSLKSRIVDVYPHVHAAF 970          
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Match: ap2b1 (adaptor related protein complex 2 subunit beta 1 [Source:NCBI gene;Acc:103025660])

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 630/939 (67.09%), Postives = 750/939 (79.87%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQ-----TVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLS 2887
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+  T++KKL+PPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PPN+FV+G H + R+ +   + G  D+ +    + P        VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A  + S ++ L ++  +     GG          YV PK +WL A K KGLEI GTFSR+ G+ M MD+TF N+A Q +TDFAIQFNKNSFG+ P  P+ I TPL+PNQ+I  SLPLN  GPVMK++ L  +QVA++ +IDV YF  ++PLN+  +++G+ME++VFL+TWKDIP   E QY++    L+A+  S +L+ NN++TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YT++
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLLKKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRK-HLPIQHGSIDTGESPISSGPAAPIDQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQN---------FIPSSVPNTFAPSPTPATLS-SGLNDLFELSTSMAITTGG----------YVTPKAVWLPAVKAKGLEISGTFSRRQGH-MYMDMTFTNKALQHMTDFAIQFNKNSFGVIPTTPLPIHTPLMPNQSIDISLPLNTIGPVMKMDPLNNLQVAVKNSIDVFYFSILIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKECHLNADTVSGKLQNNNIYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTVN 915          
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 596/962 (61.95%), Postives = 709/962 (73.70%), Query Frame = 2
Query:  152 GEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGDA-------DSVDIVKEAAPTQTVIPSQDTLIG--------------------------DLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            GEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVS                               QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G++        SV  V +A P   VIPSQ  L+G                          DL+   L+ + G          P+                           +A A G  +  L D+ G  G   G           Y  P+ +WL A K KGLEI GTF+R+ G  + MD++  N+A   ++DFA+QFNKNSFG+APA P+ +LTPL PNQT+  SLPL++ GPVMK+E L  +QVA++ NIDV YF C  P+++L +++G+M+++VFL+TWKDIP   E Q+++    L+A   S +L+ +N+FT+AKR V+ QDMLYQS+KL N IWVLAEL+I+ G   YTLS+K R  EV   V + Y
Sbjct:   13 GEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVS-------------------------------QPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESTESPDVGQSVSGVSDAPP--AVIPSQGDLLGDLLNLDLAPPTTTVPPVPSSMQMGAMDLLGGGLDSLVGFHTCPAPVGMPA------------------------GLGAAPAVGGGLGDLFDLGGGVGMTSGS----------YSPPRVVWLQAMKAKGLEISGTFARR-GGVIQMDVSLTNKAMSVMSDFAVQFNKNSFGMAPAGPLQVLTPLGPNQTVEVSLPLSSTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPISLLFVEDGKMDRQVFLATWKDIPSDNEAQFQIKDCHLNA--ASNKLQGSNIFTVAKRTVEAQDMLYQSIKLTNGIWVLAELRIQTGNPNYTLSVKCRAPEVSQYVSQCY 901          
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 1130.55 bits (2923), Expect = 0.000e+0
Identity = 569/904 (62.94%), Postives = 689/904 (76.22%), Query Frame = 2
Query:  335 MNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGDA-------DSVDIVKEAAPTQTVIPSQDTLIG--------------------------DLMDLDLNPIQGN--QMFGGSY-NQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            MNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G++        SV  V +A P   VIPSQ  L+G                          DL+   L+ + G+  +  GG     P+    +     +      + + +     +A A G  +  L D+ G  G   G           Y  P+ +WL A K KGLEI GTF+R+ G  + MD++  N+A   ++DFA+QFNKNSFG+APA P+ +LTPL PNQT+  SLPL++ GPVMK+E L  +QVA++ NIDV YF C  P+++L +++G+M+++VFL+TWKDIP   E Q+++    LS++  S +L+ +N+FT+AKR V+ QDMLYQS+KL N IWVLAEL+I+ G   YTLS+K R  EV   V + Y
Sbjct:    1 MNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESTESPDVGQSVSGVSDAPP--AVIPSQGDLLGDLLNLDLAPPTTTVPPVPSSMQMGAMDLLGGGLDSLMGDEPETLGGDLGGSPAMGVGVGVGVGVGVGLGPAPVGMPAGLGAAPAVGGGLGDLFDLGGGVGMTSGS----------YSPPRVVWLQAMKAKGLEISGTFARR-GGVIQMDVSLTNKAMSVMSDFAVQFNKNSFGMAPAGPLQVLTPLGPNQTVEVSLPLSSTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPISLLFVEDGKMDRQVFLATWKDIPSDNEAQFQIKDCHLSSDAASNKLQGSNIFTVAKRTVEAQDMLYQSIKLTNGIWVLAELRIQTGNPNYTLSVKCRAPEVSQYVSQCY 888          
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 433/558 (77.60%), Postives = 490/558 (87.81%), Query Frame = 2
Query:  335 MNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGDA-------DSVDIVKEAAPTQTVIPSQ 1984
            MNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G++        SV  V +A P   VIPSQ
Sbjct:    1 MNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESTESPDVGQSVSGVSDAPP--AVIPSQ 553          

HSP 2 Score: 271.552 bits (693), Expect = 1.521e-76
Identity = 127/261 (48.66%), Postives = 178/261 (68.20%), Query Frame = 2
Query: 2153 SAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            +A A G  +  L D+ G  G   G           Y  P+ +WL A K KGLEI GTF+R+ G  + MD++  N+A   ++DFA+QFNKNSFG+APA P+ +LTPL PNQT+  SLPL++ GPVMK+E L  +QVA++ NIDV YF C  P+++L +++G+M+++VFL+TWKDIP   E Q+++    LS++  S +L+ +N+FT+AKR V+ QDMLYQS+KL N IWVLAEL+I+ G   YTLS+K R  EV   V + Y
Sbjct:  653 AAPAVGGGLGDLFDLGGGVGMTSGS----------YSPPRVVWLQAMKAKGLEISGTFARR-GGVIQMDVSLTNKAMSVMSDFAVQFNKNSFGMAPAGPLQVLTPLGPNQTVEVSLPLSSTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPISLLFVEDGKMDRQVFLATWKDIPSDNEAQFQIKDCHLSSDAASNKLQGSNIFTVAKRTVEAQDMLYQSIKLTNGIWVLAELRIQTGNPNYTLSVKCRAPEVSQYVSQCY 902          
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 433/558 (77.60%), Postives = 490/558 (87.81%), Query Frame = 2
Query:  335 MNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR-RQLNSRTEGGDA-------DSVDIVKEAAPTQTVIPSQ 1984
            MNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR EILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ ++L +R   G++        SV  V +A P   VIPSQ
Sbjct:    1 MNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHKRLPARAGSGESTESPDVGQSVSGVSDAPP--AVIPSQ 553          

HSP 2 Score: 271.552 bits (693), Expect = 1.527e-76
Identity = 127/261 (48.66%), Postives = 178/261 (68.20%), Query Frame = 2
Query: 2153 SAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            +A A G  +  L D+ G  G   G           Y  P+ +WL A K KGLEI GTF+R+ G  + MD++  N+A   ++DFA+QFNKNSFG+APA P+ +LTPL PNQT+  SLPL++ GPVMK+E L  +QVA++ NIDV YF C  P+++L +++G+M+++VFL+TWKDIP   E Q+++    LS++  S +L+ +N+FT+AKR V+ QDMLYQS+KL N IWVLAEL+I+ G   YTLS+K R  EV   V + Y
Sbjct:  660 AAPAVGGGLGDLFDLGGGVGMTSGS----------YSPPRVVWLQAMKAKGLEISGTFARR-GGVIQMDVSLTNKAMSVMSDFAVQFNKNSFGMAPAGPLQVLTPLGPNQTVEVSLPLSSTGPVMKMEPLNNLQVAVKNNIDVFYFSCQYPISLLFVEDGKMDRQVFLATWKDIPSDNEAQFQIKDCHLSSDAASNKLQGSNIFTVAKRTVEAQDMLYQSIKLTNGIWVLAELRIQTGNPNYTLSVKCRAPEVSQYVSQCY 909          
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061025-1])

HSP 1 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 489/616 (79.38%), Postives = 557/616 (90.42%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFV--RRQLNSRTEGGDA-DSVDIVKEAA 1957
            TDSKYFTTTKKGEIFELKA+LNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI   ++S    Q+L  +   +NKL+TALNECTEWGQ+FILD++ANY PKD+ EAQ +CERV PRLSHAN+ VVLSAVKV+MK +E+L    ++  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQKR +ILK+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEA+VVIKDIFRKYPNKYESIIATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDLLEP+LL+ELICH+++LASVYH+PP++FV+G      RR L +R+   ++ +S ++  +AA
Sbjct:    2 TDSKYFTTTKKGEIFELKADLNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKNQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEI---SESHPNSQLLDLNPQTINKLMTALNECTEWGQIFILDSLANYMPKDEREAQSVCERVTPRLSHANSGVVLSAVKVLMKFMEVLPKDSEYHSTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPDILKHEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEPSAERCVSTLLDLIQTKVNYVVQEAVVVIKDIFRKYPNKYESIIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLSLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLLEPTLLEELICHISSLASVYHKPPSAFVEGSRGTQARRLLPARSASSESVESPELSAQAA 614          

HSP 2 Score: 286.96 bits (733), Expect = 2.141e-82
Identity = 133/243 (54.73%), Postives = 175/243 (72.02%), Query Frame = 2
Query: 2156 AQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTL 2884
            A   G  +  L D+ G  G P G           YV PK +WL A K KGLEIQGTFSR+  +Q+ M+L+F N+A QA+TDFAIQ NKNSFG+ PA P+ +  PL+PNQ+I  SLPLN  GPVMK++ L  +QVA++ NIDV YF C+VPL++L +++G+M+++VFL+TWKDIP   E Q+++   +L A+  S +L+ NNVFTIAKRNV+GQDMLYQSLKL N IWVLAEL+I+PG   YT+
Sbjct:  701 AAPVGGGLGDLFDLAGGIGMPTG----------TYVPPKTMWLPAVKAKGLEIQGTFSRR-QSQIYMELSFTNKALQAMTDFAIQLNKNSFGVVPASPLQVHAPLMPNQSIDVSLPLNTLGPVMKMDPLNNLQVAVKNNIDVFYFSCLVPLSVLFVEDGKMDRQVFLATWKDIPNENELQFQIKDCQLGADSVSSKLQNNNVFTIAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPNYTV 932          
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Match: AP3B2 (adaptor related protein complex 3 subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:567])

HSP 1 Score: 254.218 bits (648), Expect = 1.691e-70
Identity = 193/613 (31.48%), Postives = 307/613 (50.08%), Query Frame = 2
Query:  104 TQAKTTDSKYFTTTKKGEIF--------ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQ---------------------------------------PKD-----DSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDN-AEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRG-YIYWRLLSTDPAA-----AKEVVLAEKP 1762
            + + T + +Y      G IF        +LK  L+S +   K EA+K+++A +  GK+ S LFP VV  +   NLE+KKLVY+YL+ YA+ Q D A+L+++TF R   DPN LIRA A+R +  IRV  I   +   +++   D  PYVRKTAA  + KLY +D    + +  +E+++ LL+D   +V  + V A  E+  C +  D  H+          KL   L +  EWGQV I++ +  Y                                        P+      D + + +     P L   N AVV++    + +L   L+P  +     +  +A PLV  L +  E+QYV L+NI  +  KR  + +  +K F+++  DP  +K  KL+I+  L +  +I  +L E + Y K  D  FV  ++ AIGRCA  +    + C+  L+ L+  +   VV E++VVIK + +  P+K+  II  + + LD +  P A+AS++W+IGEY E +   A ++L    + F  E   V+LQ+L    KL+L     T+ L Q VL+LA  +  N D+RDR  +I   ++ T+        AK++ LA+KP
Sbjct:   11 SSSSTGEPEYGHDPASGGIFTADYKKHDDLKEMLDSNKDSLKLEAMKRIVAMVARGKNASELFPAVVKNVACKNLEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVPIIVPIMMLSIKEAASDMSPYVRKTAAHAIPKLYSLDPD--QKDQLIEVIERLLADKTTLVAGSVVMAFEEV--CPERIDLIHKNY-------RKLCNLLVDVEEWGQVVIINMLTRYARTQFLNPNQNESLLEENSEKAFYGSDDEAAEEKASGEPLPRSRPYMMDPDHRLLLRNTKPLLQSRNTAVVMA----VAQLYFHLSPKAE-----LGVIAKPLVRLLRSHREVQYVVLQNIATMTIKRRGMFEPYLKNFYIRSTDPTQIKTLKLEILTNLASETSISIILREFQTYVKSQDKAFVAATIHAIGRCATNISEVTDTCLNGLVGLLSNRDESVVAESVVVIKKLLQLQPSKHTEIIKHMAKLLDIITVPMARASILWLIGEYCEHVPKIAPDVLRKVAKSFIGEEDIVKLQVLNLAAKLYLTNSKQTKLLTQYVLNLAKYD-QNYDIRDRARFIRQLIVPTEKTGALSKYAKKIFLAQKP 602          
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Match: ap4b1 (adaptor related protein complex 4 subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1284])

HSP 1 Score: 200.29 bits (508), Expect = 1.545e-54
Identity = 133/487 (27.31%), Postives = 243/487 (49.90%), Query Frame = 2
Query:  455 RVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLY-------DIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANA-AVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEP-EIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATL--CENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQ-VQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLL------EPSL-LDELICHLATLASVYHRPP 1858
            R+  +  Y+  P+   L+D   YVR+TA +  AKL+       DIDAT+V +      L  LL D +P+V+ N + A+ EIL   Q +     +  ++ + + L+  L EC EWGQ  +L  +  YQP+ + E   +  R+   L  A +  V L+A K+ +     L   +   + ++ ++  PL++    +  E++Y AL ++  ++     +     K FF ++ DP YVK  K++++  L N   + ++L EL+ Y  +V  +  + ++ AIG+        +E+C+  LI L+     ++    +  ++++   +P+   S+   L  CE + T  + E K +++W++G+    +  A  +LE +++G   E    V+++LL A V+LFL RPA  Q+++  +L    +E  N  +RDR  IY+RLL   P   + VVL       ++  +        PSL L  ++    TLA ++  PP
Sbjct:   17 RLPDLGEYVQGPVASGLRDRAAYVRRTAVLGCAKLHRLQQPDADIDATLVNE------LYGLLRDKDPVVMVNCLHALEEIL---QREGG---VVINRPIAHHLVNRLPECDEWGQAAVLSFLLRYQPRSEGETLDVLNRLDGLLEPARSPGVSLAAGKLFIAYTGGLG--EAVRRDVLARVGAPLLSACGDQSIEMRYAALCHVRELLGCNPGMFSGHYKRFFCRHEDPAYVKHVKVELLSHLANDHTVAEILEELRGYCTDVCANLAQATILAIGQIG---RTYSEQCLKILIALVGLSQEHITSAVLQALRELVWHWPSCAPSVCRVLPGCEEIVT--DSEGKRALVWLLGQLGSEVPEAPYILEEYIDGLSVETVALVRMELLVATVRLFLSRPAECQDMLGRLLQYCIEEDTNMVVRDRALIYYRLLQAGPEWTRHVVLGPGGASGDDGGVACALPQEPPSLPLSAVLPRFNTLAPLFTPPP 484          
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Match: copb1 (coatomer protein complex, subunit beta 1 [Source:NCBI gene;Acc:338138])

HSP 1 Score: 56.6102 bits (135), Expect = 2.884e-8
Identity = 79/423 (18.68%), Postives = 170/423 (40.19%), Query Frame = 2
Query:  308 LKKLVYLYLMNYAKTQPDTA-----ILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDF--VQTMIKKLAPPLVTQLSAEPEIQYV---ALRNINLIVQKRSEILKNE-----------VKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKE-------YAKEVDVDFVRK-SVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEY 1489
            LKKL+ ++     KT PD       IL  + + +D   PN  IR   +R +  ++  ++   L   +R CL+    YVR+ A + +  +Y I         F  L+ D     +  +V    A+      C ++     + A     ++ L T +++   +G +                 Q +   ++ ++ HAN       ++ I  LL+  +P+  +    T++   + P   + +A+  I  +   +  N+ LIV  R   LK+            + +  V     + V+ + L + + L + +N+ +++  LK+         +  D D  R+  VR +  C+++    A   +  L++ +         + +V +++  + +      II  + E   ++   + +   +WI+GEY
Sbjct:   74 LKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRTCLEHRHNYVRRNAVLAIYTIYRI-------RNFEHLIPDAPELIHDFLVNEKDAS------CKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDIL----------------QLVIVELIYKVCHANPTERARFIRCIYNLLQSSSPAVRYEAAGTLVTLSSAPTAVKAAAQCYIDLIIKESDNNVKLIVLDRLIELKDHPSHERVLQDLVMDILRVLGTPDLEVRRKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKFRQLLVRTLHSCSVRFPDVAASIIPVLMEFLSDTNELAAGDVLVFVREAVQLFEGLRPLIIEKMLEVFHSIKAVKIQRGALWILGEY 467          
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000025.1 (pep scaffold:Pmarinus_7.0:GL482217:474:17538:-1 gene:ENSPMAG00000000021.1 transcript:ENSPMAT00000000025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 4.501e-8
Identity = 94/471 (19.96%), Postives = 189/471 (40.13%), Query Frame = 2
Query:  242 VGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPY--VRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQM-LAFSQ--SVVNKLLTALNECT------EWGQVFILDAIANYQPKDDSEAQGICERVV-------------PRLSHANA--AVVLSAVKVIMK-------LLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLI---------VQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEA------IVVIKDIFRKYPNK--YESIIATLC-ENLDTLDEPEAKASMIWIIGEYAERI 1501
            +G D+     + VN + ++    K++ YL++     +  +   L  N    D    NP+   LA+  +  +   ++   L   + K L   D    V+++AA+C+ +LY     ++    +   +  LL+D +  VV  A + I+ + +    +    + LA S+   +V    T L + T       W  V +L  +  Y P +D   +G     +              ++ H+NA  AV+  A+ +I+        L+   N    F+Q                E  ++Y+AL ++ L+         V+K  E + N +K         + V+   +D++  + +  N  ++ +E+  Y +  D     + V  +   A +        + T+++LI+   +YV +E       IV  +D  + Y  K  +E++ A  C EN+  +          +I+GE+   I
Sbjct:   67 LGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLISNAIRNDLSSRNPIFINLALHCIANVGSREMAEALASEVPKLLIASDTMDSVKQSAALCLLRLYRTSPDVIPVGDWTSRVIHLLNDQHMGVVTAATSLITALAQKNPEEYKGSVSLAVSRLSRIVTSSYTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDPAVRGRLSECLENILNKAQEPPKSKKVQHSNAKNAVLFEAINLIIHHDSEPNLLVRACNQLGQFLQ--------------HRETNLRYLALESMCLLASSEFSHEAVKKHQETVINALKT-----ERDVSVRQRAVDLLYAMCDRSNAQEITSEMLNYLETADYSIREEMVLKVAILAERYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVTNRDDVQGYAAKTVFEALQAPACHENMVKVGG--------YILGEFGNLI 510          
BLAST of AP complex subunit beta vs. Ensembl Yeast
Match: APL2 (Beta-adaptin subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in clathrin-dependent Golgi protein sorting; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001618])

HSP 1 Score: 426.017 bits (1094), Expect = 3.395e-136
Identity = 237/597 (39.70%), Postives = 375/597 (62.81%), Query Frame = 2
Query:  143 TKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQ---VLAELKEYAKEVDVDFVRKSVRAIGRCAIKV--EAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPE-------AKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLS--TDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVR 1891
            + KGE+ EL+  L S+  + +K+A+KK I  MT+GKDVS+LFPDV+  + T ++E KKLVYLY+MNYA+T P+  ILAVNTF+ D  DPNPLIR +A+RTM  IRVDKI  Y+  PLR+ L D++ YVRKTA +CVAKL+ ++  +  + G +E L + L DSNP+V+ANA AA+ EI        A  + +  QS V++ L ALNECTEW ++ IL  ++ Y  KD  EAQ I +RV   L H N AVVL+ +KVI++ L  +  S + +  ++K+L+   V+ +S  PE+QYVAL+NI +I++K  E+L  E+++F+VK+NDP+YVKLEK+DI++RL +  N+ Q   +L ELKEYA E + +FV ++++A+ +  IK   E+   + +  L++L++ + + +  +  + + D+ R  P   + +   +C   +T   PE       AK + +W++G++     + E  +  F+E F  E    Q+ LL  IV+L       T  ++Q+VL LATQ++   D+RD   +YWR LS   + +   ++   + P+IS   +   P +L++L+  L T++S+Y +P ++   GK +V+
Sbjct:   23 SGKGELSELRTGLVSQYPQTRKDAIKKTIQQMTLGKDVSSLFPDVLKNIATIDVEQKKLVYLYVMNYAETHPELCILAVNTFITDAQDPNPLIRCMAIRTMSMIRVDKILEYIETPLRRTLHDDNAYVRKTAVICVAKLFQLNKDLCVELGVVEDLVNALDDSNPLVIANATAALIEIHNMDM--DAVDLSSLIQSHVSQFLLALNECTEWARIIILGTLSEYSAKDSLEAQDIIDRVTAHLQHVNPAVVLATIKVIVRNLPQIEYSSNSL--IMKRLSSAFVSLMSTPPEMQYVALKNIRIILEKYPELLTKELRIFYVKFNDPLYVKLEKIDILVRLVDPSNLKQCTLLLTELKEYAMEYEPEFVSRAIQALSQLGIKYAQESFVSKVLDILLELLERQ-DTIKDDCCISLCDLLRHCPGN-DKMAKQVCAVFNTWSNPEVLLQSDIAKCNYVWLLGQHPNNFSDLESKINIFIENFVQEEALTQMSLLMTIVRL---HATLTGSMLQSVLELATQQTHELDVRDMAMMYWRCLSMPNNESLVNDLCQNKLPMISNTLEKFSPEVLEKLLMELGTISSIYFKPDSNRRKGKKYVQ 610          
BLAST of AP complex subunit beta vs. Ensembl Yeast
Match: APL1 (Beta-adaptin; large subunit of the clathrin associated protein complex (AP-2); involved in vesicle mediated transport; similar to mammalian beta-chain of the clathrin associated protein complex [Source:SGD;Acc:S000003765])

HSP 1 Score: 263.848 bits (673), Expect = 2.509e-76
Identity = 177/564 (31.38%), Postives = 311/564 (55.14%), Query Frame = 2
Query:  227 IASMTVGK--DVSALFPDVVNCMQT-DNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDP--YVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLS--DSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIA-NYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRN-INLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKV-EAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPA-HTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAA----------KEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRP 1855
            IA++ +G   ++S LF +++   Q  D+LE+K++ + Y+      +P  A  A+   + D    +  ++ +A+RT+  + V +++    D +   +  + P   V +TA   +  L +ID   V   G   +L D++    S+P V+   VAA+  +    + ++  +       +   +L  L E  EW +  +L+ +  +  P+   +   + E  +P L   N  VVL+++K IM LL   N  D   +T+ +KL+  ++  L   PE+Q++ LRN I L++ + S +L+ ++  FF++YNDPIY+K  KL+ +  L N + +P++L EL++YA ++D+   RKSVRAIG  A+K+ E +   C+  L+DL++  V+YVVQE I V ++I RKYPN +++ +  L ++ + + EPE+K +MIWII +Y++ I N  EL   F      E  +VQ  +L + +K F++ P   T+EL  ++L       +NPDLRD+  +YWRLLS    +           K V+  E PLI   T  L+P++L+EL  ++ T+ S+Y +P
Sbjct:   42 IANLVLGNYGEMSVLFSELLKFWQIEDDLEVKRICHEYIRVIGALKPQQAREALPFIMDDFKSRDEKLQIMALRTLVLVPVKELSDQAFDCIISLVNHKSPPEQVTRTAIYALLDLDEIDHERVL--GLSSILHDIVKAQSSSPEVI---VAALHTLYSIHEKNANMEPFRIPLELAFDMLELLPELNEWNKATVLEVLTTSVVPQHYLDTHEMIELALPYLQQVNTYVVLNSLKFIMYLL---NYVDVIKETLAEKLSNSVIALLDKPPELQFLVLRNVILLLLSRESSLLRLDISYFFIEYNDPIYIKDTKLECLYLLANKETLPRILEELEQYATDIDIQMSRKSVRAIGNLAVKLDEDSVHDCVAVLLDLLEFGVDYVVQEIISVFRNILRKYPNNFKANVTELVKHTEVVQEPESKNAMIWIITQYSDVIPNYLELFRVFSSNMFSETLEVQFSILNSAIKFFIRSPTKETEELCMDLLKGCIDHENNPDLRDKTLMYWRLLSLTKTSRISNAITFESLKSVLDGELPLIEMNTK-LDPTVLEELELNIGTIVSIYLKP 596          
BLAST of AP complex subunit beta vs. Ensembl Yeast
Match: APL6 (Beta3-like subunit of the yeast AP-3 complex; functions in transport of alkaline phosphatase to the vacuole via the alternate pathway; exists in both cytosolic and peripherally associated membrane-bound pools [Source:SGD;Acc:S000003493])

HSP 1 Score: 117.857 bits (294), Expect = 2.298e-27
Identity = 112/490 (22.86%), Postives = 227/490 (46.33%), Query Frame = 2
Query:  251 DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEI----LECTQSDSAH------QMLAFSQSVVNKLLTALNECTEW-GQVFILDAIANYQPK-------------------DDSEAQGICERVVPRLSHANAAVVLSAVKVIMKL---LEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDV--DFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTK-VNYVVQEAIV-VIKDIFRKYPNKYESIIATLCE--NLDTLDEPEAKASMIWIIGEYAE-RIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLF 1600
            DV   F DVV  + T++ ++K+L++LYL+ +A+  P+  +L++N+  +   D N  +R  A+  +  +++  +   +   ++K + D    VR   A+ + KLY        +   L++LK+L++D++P V++ AV A  E     LE              Q+ ++SQS + +LL  +  C ++  +  ++D  +   P+                   +D +     + +   +  +N  V+LS    + +L   L+M N    F++ +++ +    +T+     E+   A+  ++++ Q    +     K F+V   DPI   + K+ I+  L N  N+ ++  ELK Y        + V  +V+++ RC     +     M  LID +++  ++  V +A V VI+ + +K P K+  II  L +   + T     A+A ++W+ GE A        ++L   ++ F +E  + + Q+L    KL 
Sbjct:   78 DVQLYFADVVKNITTNDTKVKRLIHLYLLRFAENDPNLTLLSINSLQKSLSDSNSELRCFALSALSDMKMSSLAPIILHTVKKLVTDPSAMVRGEVALAIIKLYRAGKNDYHEE-LLDILKELMADTDPKVISCAVLAYKECYADHLELLHGHFRRYCRIIKQLDSWSQSYLIELL--IKYCKQYLPKPTVVDKSSEGSPRSCPLPDKYNEIEYPSYEVVNDPDLDLFLQSLNCLIYSSNPTVILSCCNALYQLASPLQMKNTK--FIEALVRTVT---MTENQGNKEMLLQAIHFLSILDQT---LFLPYTKKFYVFPKDPIVASIWKIQILSTLINESNVKEIFKELKYYVASAHFPENVVIMAVKSLSRCGQLSTSWESHVMKWLIDHMESHNLSASVLDAYVNVIRMLVQKNPTKHLRIIFKLADLLTVQTSLADNARAGIVWLFGEIASIEFKICPDVLRRLIQNFSNEGPETRCQILVLSAKLL 556          
BLAST of AP complex subunit beta vs. Ensembl Yeast
Match: SEC26 (Essential beta-coat protein of the COPI coatomer; involved in ER-to-Golgi protein trafficking and maintenance of normal ER morphology; shares 43% sequence identity with mammalian beta-coat protein (beta-COP) [Source:SGD;Acc:S000002646])

HSP 1 Score: 69.707 bits (169), Expect = 2.019e-12
Identity = 99/463 (21.38%), Postives = 182/463 (39.31%), Query Frame = 2
Query:  227 IASMTVGKDVSALFPDVVN-CMQTDNLELKKLVYLYLMNYAKTQPDTA-----ILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVED-----NGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALR------------NINLIVQKR-SEILKNEV--------KVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVL----AELKEYAKEVDVD----FVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAE 1495
            + +M  G  +  L   ++   M + N ELKKL+Y Y     K   D       IL  N    D   PN  IR   +R +  +R  ++   +   +  CL+    YVRK A + V  ++ +   ++ D     N F+      +++++P+   NA   ++E+      D  + +     ++ +                    I N  P      Q +  + + + ++   A+    ++++M+LL      +   +T +       +T LSA P +   A+             NI LIV  R  +I  N V         +  V   + + V+ + LDI + L   +N   V+     EL+      D D    + +  ++ I   A+     A   ++ L+D I    +      I  IK++  KYP    +I+  + + LD +   +A    +WI+GEYAE
Sbjct:   48 LVTMLEGNPMPELLMHIIRFVMPSKNKELKKLLYFYWEIVPKLAEDGKLRHEMILVCNAIQHDLQHPNEYIRGNTLRFLTKLREAELLEQMVPSVLACLEYRHAYVRKYAILAVFSIFKVSEHLLPDAKEIINSFI------VAETDPICKRNAFIGLAEL------DRENALHYLENNIAD--------------------IENLDPL----LQAVFVQFIRQDANRTPALKAQYIELLMELLSTTTSDEVIFETALA------LTVLSANPNVLVPAVNKLIDLAVKVSDNNIKLIVLDRIQDINANNVGALEELTLDILRVLNAEDLDVRSKALDISMDLATSRNAEDVVQLLKKELQTTVNNPDQDKAMQYRQLLIKTIRTVAVNFVEMAASVVSLLLDFIGDLNSVAASGIIAFIKEVIEKYPQLRANILENMVQTLDKVRSAKAYRGALWIMGEYAE 468          
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Match: EDO36135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK8])

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 603/912 (66.12%), Postives = 708/912 (77.63%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRR-QLNSRTEGGDADSVDIVKEAAPT---------------QTVIPSQDTLIGDLMD---------------------LDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAP-LGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSE 2740
            TDSKYFTTTKKGEIFELKAELNS++K++KKEAVKKVIASMTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LK+LLSDSNPMVVANA+AA+SEI +   S +A  M+  +   +NKLLTALNECTEWGQ+FILD++A Y PKD+ EAQ ICERV PRLSHANAAVVLSA+KV+MK +EM+ PS  FVQ ++KKLAPPLVT LS+EPE+QYVALRNINLIVQKR EILKNE+KVFFVKYNDPIYVKLEKLDIMIRL N  NI QVLAELKEYA EVDVDFVRKSVRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYESII+TLCENLD+LDEPEA+ASMIWIIGEYAERIDNA ELLESFLEGFQDENTQVQLQLLT+IVKLFLKRP  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDLLEP+LLDELIC+++TLASVYH+PP+SFV+G+   RR  L  R E   +   +  +  +P+                  +   + L+GDL+                      +DL    G  + G     P+QQ                         SA A G     + D+F    AP   GG         Y APK++WL A+KGKGLE+ GTF+++ G Q+ MDLT  NRA QA++ FAIQFNKNSFG+APA  +++ TPL PNQ+   SLPLN  GPV +++ LT +QVA++ ++D+ YF  +VP+N+L+ + G M+++VFL+TWKDIP   E Q ++  + +++    E
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKDRKKEAVKKVIASMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDSLKELLSDSNPMVVANAMAALSEINDA--SPTAAAMMEMNSQTINKLLTALNECTEWGQIFILDSLAQYTPKDEREAQSICERVTPRLSHANAAVVLSAIKVLMKYMEMMTPSTGFVQNILKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPEILKNEMKVFFVKYNDPIYVKLEKLDIMIRLANELNIAQVLAELKEYATEVDVDFVRKSVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIISTLCENLDSLDEPEARASMIWIIGEYAERIDNAAELLESFLEGFQDENTQVQLQLLTSIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLLEPTLLDELICNISTLASVYHKPPSSFVEGRTAARRFTLPPRAE--PSPGAETAEPISPSVQAAVHAAAPTPAAAPPAMAPANDLLGDLLSDIPAAQPAAPPVAAAPVGGGVMDL---LGEDLSGLHLGGPAQQ-------------------------SAPAPGG----MGDLFSLAAAPEFSGG--------MYSAPKQVWLPASKGKGLEVHGTFAQRQG-QIYMDLTVYNRAMQAMSGFAIQFNKNSFGLAPASQLNLPTPLPPNQSAETSLPLNTTGPVQRMDPLTNLQVAMKNHLDIFYFSTMVPVNVLVSNAGNMDRKVFLATWKDIPVENERQTQINDVNMNSAAVGE 868          
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Match: EDO32097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW11])

HSP 1 Score: 120.553 bits (301), Expect = 2.464e-29
Identity = 107/374 (28.61%), Postives = 177/374 (47.33%), Query Frame = 2
Query:  164 ELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANY---------------------------------------QPKD--------DSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKL 1141
            +LKA L+  +   K +A+K++I++M  G+D+S LFP VV  + + N+E+KKLVY+YL+ YA+ Q D A+L+++TF +   DPN LIRA A+R +  IRV  I   L   +++ + D  P+VRKTAA  + KL+    +       +++ + L   S+ +V  +AV A  E+  C +  D  H+          KL   L +  EWGQV ++  +  Y                                       +PK         D + + +     P L   NA+VV++    + +L     P+++     +  +A  LV  L    E+Q V L NI  +   R    +  +K FFV  +DP +++L K+
Sbjct:   24 DLKAMLDGPKDNHKLDAMKRIISNMATGRDMSELFPAVVKNVVSKNVEVKKLVYVYLVRYAEEQQDLALLSISTFQKALKDPNQLIRASALRVLSSIRVHVIAPILMLSIKEGVVDMSPFVRKTAAHAIPKLHRYQTSFATLQ--IQIFEKLCIHSSFLVAGSAVMAFEEV--CPERIDLIHKNY-------RKLCQLLVDIDEWGQVTVIHMLTRYARTQFLDPNQQVHTVQTEWEEFYAKSDSSEADDNDNDEDKPKPEKKHPYIMDPDHRLLLRTCKPLLQSRNASVVMA----VARLYHHCAPANE-----VTIVARALVKLLRGHREVQTVVLSNIATMSSTRKGTFEPYLKSFFVHSSDPTHIRLLKV 377          
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Match: EDO29149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G3])

HSP 1 Score: 79.337 bits (194), Expect = 5.421e-18
Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 2
Query:  305 ELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLY 562
            ++KKLVY+YL+ YA+ Q D A+L+++TF +   DPN LIRA A+R +  IRV  I   L   +++ + D  P+VRKTAA  + KL+
Sbjct:    8 QVKKLVYVYLVRYAEEQQDLALLSISTFQKALKDPNQLIRASALRVLSSIRVHVIAPILMLSIKEGVVDMSPFVRKTAAHAIPKLH 93          
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Match: EDO34974 (Coatomer subunit beta [Source:UniProtKB/TrEMBL;Acc:A7SMS0])

HSP 1 Score: 64.3142 bits (155), Expect = 2.371e-10
Identity = 88/449 (19.60%), Postives = 183/449 (40.76%), Query Frame = 2
Query:  308 LKKLVYLYLMNYAKTQPDTA-----ILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVED-----NGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDF--VQTMIKKLAPPLVTQLSAEPEIQYVALR---NINLIVQKRSEILK---NEVKVF---------FVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEY-------AKEVDVDFVRKS-VRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQD 1549
            +KKL+ ++     KT  D       IL  + + +D   PN  IR   +R +  ++  ++   L   +R CL+    YVR+ A + +  +Y     ++ D     + FLE  +D     N  ++         ++   Q           +  +  L T +++   +G +                 Q +   ++ ++ HAN A     ++ I  LL   +P+  +    T++   + P   + +A   I+ +      N+ LIV  R   LK   +  KV           +   DP  V+ + L +++ L   +NI +V+A LK+        +++V++   R+  VR +  C++K    A   +  L++ +         + +V +++  +++      I+  L EN   +   +     +WI+GEYA+  ++   ++E   +G  D
Sbjct:   75 IKKLLLIFWEIVPKTGADGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRTCLEHRHSYVRRNAVMAIYTIYRNFDFLIPDAPELVHTFLEQEQDASCKRNAFMM---------LIHVDQ-----------ERALEYLSTCMDQVNTFGDIL----------------QLVIVELIYKVCHANPAERARFIRCIYNLLNSSSPAVRYEAAGTLVTLSSAPTAVKSAASCYIELIVKESDNNVKLIVLDRLIKLKENPSHEKVLQELVMDILRVLASPDP-EVRKKTLQLVLDLVTSRNIHEVVAVLKKEVSKTHFESEQVEIGSYRQMLVRTLHTCSVKFPDVANSIVPLLMEFLGDSNEQAALDVLVFVREAIQRFEQLKPVIMEKLMENFHMIKSVKIHRHALWILGEYADSKEDIMTVMEEIRKGLGD 486          
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Match: EDO49151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH33])

HSP 1 Score: 58.151 bits (139), Expect = 1.556e-8
Identity = 110/579 (19.00%), Postives = 231/579 (39.90%), Query Frame = 2
Query:  242 VGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCL--KDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTA----LNECT------EWGQVFILDAIANYQPKDDSEAQGICERVV-------------PRLSHANA--AVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSA-EPEIQYVALRNINLI---------VQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEA------IVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMI----WIIGEYAERIDNAE--------ELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDEL 1813
            +G D+     + VN + ++    K++ YL++        +   L V +   D    N +   LA++ +  I   ++   L   + K L   D    V++ AA+CV KL+ ++  ++    +   +  LL+D +  VV +A + I  +++    D     +  + S +++++T+    L + T       W  + ++  +  Y P DD          +              ++ H+NA  AV+  A+ +I+ +        D  Q+++ +    L   L+  E  ++Y+AL  + L+         V+K  E +   +K         + V+   +D++  + +  N  ++++E+ EY +  D     + V  +   + K        + T++ LI+   +YV +E       IV+ +D  + Y  K            + L  P    +M+    +I+GE+   I            +LL S           + L      + LF +   + QE++++  +L   ++   +++ R   Y +L +         VL E P   E     E S+L +L
Sbjct:   67 LGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVSANSELIKLIVQSIKNDLSSRNAIFVCLALQCIANIGNQEMVDQLGSEVPKLLVSPDTSDSVKQCAALCVLKLFRLNENLLPPGEWTSRIVQLLNDKHLGVVTSATSLIQGLVQ-KSPDEYKGCIQLAVSRLSRIVTSSYTDLQDYTYYFVPAPWLCIKLIKLLQMYPPPDDPAISARLHECLDTILNKAQEPPKSKKVQHSNARNAVLFEAINLIIHM--------DSDQSLLIRGCNQLGQFLTHRETNLRYLALEGLCLMSNSEFSVDAVRKHQETVMGALKT-----ERDVSVRQRAVDLLYAMCDKNNAEEIVSEMLEYLETADYSIKEEMVLKVAILSEKYATDYSWYVDTILTLIRIAGDYVSEEVWYRVIQIVINRDDIQGYAAK---------TVFEALQHPACHENMVKVGGYILGEFGNLIAGDPRSSPMVQFQLLHSKFPLCASSTRGLLLSTYIKFINLFPEIKPYIQEILRSDSNLRNSDA---EIQQRALEYLKLSTVASPDVLATVLEEMPPFPER----ESSILAKL 615          
BLAST of AP complex subunit beta vs. Ensembl Medaka
Match: ap2b1 (AP-1 complex subunit beta-1 [Source:NCBI gene;Acc:101171688])

HSP 1 Score: 1249.57 bits (3232), Expect = 0.000e+0
Identity = 641/955 (67.12%), Postives = 755/955 (79.06%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQL----NSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNP------IQGNQM-----FGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSA-QATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            TDSKYFTT KKGEIFELKAELN+E+KEK+KEAVKKVIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVN+FV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ L+DL++DSNPMVVANAVAA+SEI   ++S     +L  +   +NKLLTALNECTEWGQ+FILD ++NY PKD+ EAQ ICERV PRLSHAN+AVVLSAVKV+MK LE+L    D+   ++KKL+PPLVT LS EPE+QYVALRNINLIVQKR EILK E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVI+DIFRKYPNKYESIIATLCENLD+LDEP+A+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQL LLTAIVKLFLK+P+ TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP  AKEVVL+EKPLISEETDL+EP+LLDELICH+ +LASVYH+PP++FV+G H V R+     +S  E G++        A     VIPSQ  L+GDL++LDL P      +   QM      GG  +    Q                     PS T A QA  S ++ L ++        GG          Y APK +WL A K KGLEI GTFSR+ G+ M MD+TF N+A Q + DFAIQFNKNSFG+ P  P+ I TPL+PNQ+I  SLPLN  GPVMK++ L  +QVA++ +IDV YF  ++PLNI  +++G+ME++VFL+TWKDIP   E QY++    L+A+  S +L+ NN++TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:    2 TDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI---SESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPSAFVEGSHGVHRKHLPVQHSSIETGESPVSGGPAAAMDQPHVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQN---------FIPSSVPSTFAPSPTPAPQAASSGLNDLFELSTGMAITTGG----------YAAPKAVWLPAVKAKGLEISGTFSRRQGH-MYMDMTFTNKALQHMADFAIQFNKNSFGVIPTSPLPIHTPLMPNQSIDISLPLNTIGPVMKMDPLNNLQVAVKNSIDVFYFSVLIPLNIFFVEDGKMERQVFLATWKDIPNENELQYQIKDCHLNADAVSGKLQNNNIYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYVYQMY 933          
BLAST of AP complex subunit beta vs. Ensembl Medaka
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:NCBI gene;Acc:101163497])

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 500/630 (79.37%), Postives = 558/630 (88.57%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDI--------VKEAAPTQTVIPSQ 1984
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQ+R EI+K+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ +       G  +SVD         V +A P   VIPSQ
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQRRPEIMKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHK-RLPCSAGSGESVDSPETSSTAGVSDAPP--AVIPSQ 625          

HSP 2 Score: 199.134 bits (505), Expect = 3.164e-52
Identity = 90/195 (46.15%), Postives = 132/195 (67.69%), Query Frame = 2
Query: 2141 PSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSA 2725
            P+   A  +G  +D L D+    G P+G           Y  PK +WL A K KGLEI GTF+R+ G  + M++T  N+A   +TDFAIQFN+NSFG++PA P+ +LTPL PNQ+I  +LPLN +GPVMK++ L  +QVA++ NIDV YF C  P+++L +++G+ME+++FL+TWKDIP   E+Q+++    LS+
Sbjct:  681 PASFGAPGSGG-LDDLFDLGSGVGMPMGA----------YSPPKSVWLQAMKAKGLEISGTFARRAG-VIQMEMTLTNKAMSVMTDFAIQFNRNSFGLSPAGPLQVLTPLSPNQSIEVALPLNTSGPVMKMDPLNNLQVAVKNNIDVFYFSCQYPISMLFVEDGKMERQIFLATWKDIPNENESQFQIKDCHLSS 863          
BLAST of AP complex subunit beta vs. Ensembl Medaka
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:NCBI gene;Acc:101163497])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 500/630 (79.37%), Postives = 558/630 (88.57%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDI--------VKEAAPTQTVIPSQ 1984
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQ+R EI+K+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ +       G  +SVD         V +A P   VIPSQ
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQRRPEIMKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHK-RLPCSAGSGESVDSPETSSTAGVSDAPP--AVIPSQ 625          

HSP 2 Score: 276.944 bits (707), Expect = 3.964e-78
Identity = 130/265 (49.06%), Postives = 183/265 (69.06%), Query Frame = 2
Query: 2141 PSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            P+   A  +G  +D L D+    G P+G           Y  PK +WL A K KGLEI GTF+R+ G  + M++T  N+A   +TDFAIQFN+NSFG++PA P+ +LTPL PNQ+I  +LPLN +GPVMK++ L  +QVA++ NIDV YF C  P+++L +++G+ME+++FL+TWKDIP   E+Q+++    LS++  S +L+ +N+FTIAKR VDGQDMLY S+KL N IWVLAEL+I+ G   YT+SLK R  EV   V ++Y
Sbjct:  720 PASFGAPGSGG-LDDLFDLGSGVGMPMGA----------YSPPKSVWLQAMKAKGLEISGTFARRAG-VIQMEMTLTNKAMSVMTDFAIQFNRNSFGLSPAGPLQVLTPLSPNQSIEVALPLNTSGPVMKMDPLNNLQVAVKNNIDVFYFSCQYPISMLFVEDGKMERQIFLATWKDIPNENESQFQIKDCHLSSDAVSNKLQGSNIFTIAKRTVDGQDMLYLSVKLTNGIWVLAELRIQAGNPNYTISLKCRAPEVSQCVFQSY 972          
BLAST of AP complex subunit beta vs. Ensembl Medaka
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:NCBI gene;Acc:101163497])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 500/630 (79.37%), Postives = 558/630 (88.57%), Query Frame = 2
Query:  119 TDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDI--------VKEAAPTQTVIPSQ 1984
            TDSKYFTTTKKGEIFELKAELNS++KEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAK+QPD AI+AVNTFV+DC+DPNPLIRALAVRTMGCIRVDKIT YLC+PLRKCLKDEDPYVRKTAAVCVAKL+DI+A +VED GFL+ LKDL+SDSNPMVVANAVAA+SEI E   S     +L  +   +NKLLTALNECTEWGQ+FILD +ANY P+DD E+Q ICERV PRLSHAN+AVVLSAVKV+MK +EML    D+  T++KKLAPPLVT LSAEPE+QYVALRNINLIVQ+R EI+K+E+KVFFVKYNDPIYVKLEKLDIMIRL +  NI QVLAELKEYA EVDVDFVRK+VRAIGRCAIKVE +AERC++TL+DLIQTKVNYVVQEAIVVIKDIFRKYPNKYES+IATLCENLD+LDEPEA+A+MIWI+GEYAERIDNA+ELLESFLEGF DE+TQVQLQLLTAIVKLFLK+P  TQELVQ VLSLATQ+SDNPDLRDRGYIYWRLLSTDP AAKEVVLAEKPLISEETDL+EP+LL+ELICH+ TLASVYH+PP++FV+G   V+ +       G  +SVD         V +A P   VIPSQ
Sbjct:    2 TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAE---SHPNSNLLDLNPQTINKLLTALNECTEWGQIFILDCLANYTPRDDRESQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLPKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQRRPEIMKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLEELICHIGTLASVYHKPPSAFVEGSRGVQHK-RLPCSAGSGESVDSPETSSTAGVSDAPP--AVIPSQ 625          

HSP 2 Score: 277.715 bits (709), Expect = 1.684e-78
Identity = 130/265 (49.06%), Postives = 183/265 (69.06%), Query Frame = 2
Query: 2141 PSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            P+   A  +G  +D L D+    G P+G           Y  PK +WL A K KGLEI GTF+R+ G  + M++T  N+A   +TDFAIQFN+NSFG++PA P+ +LTPL PNQ+I  +LPLN +GPVMK++ L  +QVA++ NIDV YF C  P+++L +++G+ME+++FL+TWKDIP   E+Q+++    LS++  S +L+ +N+FTIAKR VDGQDMLY S+KL N IWVLAEL+I+ G   YT+SLK R  EV   V ++Y
Sbjct:  691 PASFGAPGSGG-LDDLFDLGSGVGMPMGA----------YSPPKSVWLQAMKAKGLEISGTFARRAG-VIQMEMTLTNKAMSVMTDFAIQFNRNSFGLSPAGPLQVLTPLSPNQSIEVALPLNTSGPVMKMDPLNNLQVAVKNNIDVFYFSCQYPISMLFVEDGKMERQIFLATWKDIPNENESQFQIKDCHLSSDAVSNKLQGSNIFTIAKRTVDGQDMLYLSVKLTNGIWVLAELRIQAGNPNYTISLKCRAPEVSQCVFQSY 943          
BLAST of AP complex subunit beta vs. Ensembl Medaka
Match: ap2b1 (AP-1 complex subunit beta-1 [Source:NCBI gene;Acc:101171688])

HSP 1 Score: 292.738 bits (748), Expect = 1.046e-83
Identity = 142/266 (53.38%), Postives = 184/266 (69.17%), Query Frame = 2
Query: 2141 PSQTSA-QATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAY 2935
            PS T A QA  S ++ L ++        GG          Y APK +WL A K KGLEI GTFSR+ G+ M MD+TF N+A Q + DFAIQFNKNSFG+ P  P+ I TPL+PNQ+I  SLPLN  GPVMK++ L  +QVA++ +IDV YF  ++PLNI  +++G+ME++VFL+TWKDIP   E QY++    L+A+  S +L+ NN++TIAKRNV+GQDMLYQSLKL N IW+LAEL+I+PG   YTLSLK R  EV   V + Y
Sbjct:  693 PSPTPAPQAASSGLNDLFELSTGMAITTGG----------YAAPKAVWLPAVKAKGLEISGTFSRRQGH-MYMDMTFTNKALQHMADFAIQFNKNSFGVIPTSPLPIHTPLMPNQSIDISLPLNTIGPVMKMDPLNNLQVAVKNSIDVFYFSVLIPLNIFFVEDGKMERQVFLATWKDIPNENELQYQIKDCHLNADAVSGKLQNNNIYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYVYQMY 947          
BLAST of AP complex subunit beta vs. Planmine SMEST
Match: SMESG000029126.1 (SMESG000029126.1)

HSP 1 Score: 1925.6 bits (4987), Expect = 0.000e+0
Identity = 968/968 (100.00%), Postives = 968/968 (100.00%), Query Frame = 2
Query:   35 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM 2938
            MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMSGSFDLLGDGLDSLLNLNPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM
Sbjct:    1 MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMSGSFDLLGDGLDSLLNLNPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM 968          
BLAST of AP complex subunit beta vs. Planmine SMEST
Match: SMESG000029143.1 (SMESG000029143.1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 310/311 (99.68%), Query Frame = 2
Query: 2006 MDLDLNPIQGNQMFGGSYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM 2938
            MDLDLNPIQGNQMFGGSYNQPSQQQPMSGSFDLLGDGLDSLLNLNPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVL ELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM
Sbjct:    1 MDLDLNPIQGNQMFGGSYNQPSQQQPMSGSFDLLGDGLDSLLNLNPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWLSAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGIAPAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVLYFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEECSERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLGELKIKPGTGEYTLSLKSRVMEVYPSVQKAYM 311          
BLAST of AP complex subunit beta vs. Planmine SMEST
Match: SMESG000041850.1 (SMESG000041850.1)

HSP 1 Score: 268.085 bits (684), Expect = 2.827e-74
Identity = 206/666 (30.93%), Postives = 321/666 (48.20%), Query Frame = 2
Query:   65 TLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELNSERXXXXXXXXXXXIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQS-DSAHQMLAFSQSVVNKLLTALNECTEWGQVFILDAIANYQPKD------------------------------------------DSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDN-AEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLRDRGYIYWRLL-------------STDPAAA------KEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVD 1873
            T  NI P    + +      + + +  KK E  +LK  L S +   K +A+K++I  +  GKD + LFP VV  + + N E+KKLVY YL  YA+ + D A+L+++TF R   DPN LIR  A+R +  IRV  I   +   +++ + D  PYVRK AA  + K+Y +DA   E    +E+++ LL+D   +V  +A+ A  E+  C +  D  H+          KL + L +  EWGQV I++ +  Y                                              DS+ + +     P L   N+AVV+S V+    L     P  +    ++      LV  L    E+QYV L NI  +   + E+ +  +K F+V  ++P  VKL KL+I+  L N  NI  +L EL+ Y    D +FV  +++AIGRCA  +   ++ C++ L+ LI  K   +V EAIVVI+ + +   + +  II ++   LDT++ P AKAS+IW+IGEY +R+   A ++L    + F DE   V+LQ +    KLF+  P  ++ L Q VL+LA  +  N D+RDRG     LL             +T  +A+      K++ LA KP       LL  +  D     L TL+ + +   N + D
Sbjct:   15 TNSNINPSDVDIGSDVIKAGNLFMSDPKKHE--DLKVLLESNKDSAKLDAMKRIITMVAKGKDCADLFPSVVKNVVSKNAEVKKLVYAYLTRYAEEKQDLALLSISTFQRALKDPNQLIRGSALRVLSSIRVPMIVPIMMLAIKESVNDMSPYVRKIAAHAIPKMYSLDAGSKEQ--LIEVIEKLLADKTTLVAGSAIQAFEEV--CPERLDLIHKHY-------RKLCSLLIDVEEWGQVVIINMLTRYARTQFVDPNLVEIIEVAKKFYSDEDNSSNSDSDGDKQQETSKAKLMDSDHRLLLHSARPLLHSRNSAVVMSVVQ----LFYHCAPKSEMNVVIMS-----LVRLLKCNKEVQYVVLNNIATMSITQPELFQGNLKSFYVYNSEPTQVKLLKLEILTNLANENNISVILRELQSYVGNTDQEFVTATIQAIGRCASNIADVSDNCLSGLVQLISRKDENIVAEAIVVIRKLLQMQTSDHRDIIVSMALLLDTINVPMAKASIIWLIGEYCDRVPKLAPDVLRKAAKSFIDEKDIVKLQTINLAAKLFITNPKQSRLLTQYVLNLAKYDM-NYDIRDRGRFIRALLFPQAQDNNKDDSQNTSLSASFLSKRIKKIFLATKP-----APLLHSNYKDRHQYQLGTLSHILNHRVNGYND 652          
BLAST of AP complex subunit beta vs. Planmine SMEST
Match: SMESG000036030.1 (SMESG000036030.1)

HSP 1 Score: 63.5438 bits (153), Expect = 8.928e-10
Identity = 161/789 (20.41%), Postives = 310/789 (39.29%), Query Frame = 2
Query:  242 VGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPY--VRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSD-SAHQMLAFSQ--SVVNKLLTALNECT------EWGQVFILDAIANYQPKDDSEAQG----ICERVVP---------RLSHANA--AVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQLSA-EPEIQYVALRNINLIVQKR--SEILKN--EVKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEA------IVVIKDIFRKYPNK--YESIIATLC-ENLDTLDEPEAKASMIWIIGEYAERI----DNAEELLESFLEGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQ-ESDNPDLRDRGYIYWRL--LSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATLASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQDTLIGDLMDLDLNPIQGNQMFGG--SYNQPSQQQPMXXXXXXXXXXXXXXXXXXPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAP-------------KEIWLSAA---KGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQF 2413
            +G D+     + VN + ++    K++ YL++        +   L V     D    NP+   LA++ +  I   ++T      + + L   D    V+++AA+C+ KL      +V  + +   +  LL+D +  VV  AV+ I  +++ +  +  A   LA S+   +V    T L + T       W  V +L  + NY P DD+  +       E ++          ++ H+NA  AV+  A+ +I+ +        D    ++ +    L   LS  E  ++Y+AL ++ L+       E +K   E  +  +K    + V+   +D++  + +  N  +++ E+  Y +  D     + V  +   + K        + T+++LI+   +YV +E       IV+ +   + Y  K  +E++ A  C EN+  +          +I+GE+   I     ++ ++    L       T    QLL +    F+      +E +Q++L   +   + + +++ R   Y  L  ++TD   A   VL E P  +E                 + LA +  + P +    +    RQ           +  I K +  TQ   P+           +   IQ   + GG  SY+QP+Q                       S++++Q T    D L DI GN      G  S+ + N+    P             K +W S+    +   ++I G  S   GN   + + + N++ + +TDF  + 
Sbjct:   67 LGHDIDFGHSEAVNLLCSNKYTEKQIGYLFISVLINESHNLMNLVVQRLKDDLSSRNPVFVTLALQCIANIGTREMTENFAKEIPRLLVSGDTIDSVKQSAALCLLKLIRAAPDLVHFDDWTSRVIHLLNDQHMGVVTAAVSLIESLVKRSPEEYKACVSLAVSRLSRIVTSSYTDLQDYTYYFVPAPWLSVKLLRLLQNYPPPDDAPVRSRLTECLESILSKAQEPPKSKKVQHSNAKNAVLFEAINLIIHM--------DCDPNLLIRACNQLGQFLSHRETNLRYLALESMCLLATSEFSHEAVKKHQETVISALKSERDVSVRQRAVDLLYAMCDRNNAEEIVGEMLSYLESADYSIREEMVLKVAILSEKYATDYSWYVDTILNLIRVAGDYVSEEVWHRVIQIVINRSDVQGYSAKTVFEALQAPACHENMVKVGG--------YILGEFGNLIAGDPRSSPQIQFQILHAKYHLCTPTTRQLLLSTYVKFINLFPEIKEEIQDILKNDSNLRNADVEIQQRTIEYLTLSKIATDDVMA--TVLEEMPSFTERES--------------SILAKLKQKKPAALEGQELIAPRQ---------HPTAKISKNSLDTQNDSPATK---------EEPAIQEVDLLGGLFSYSQPNQTN---------------------SKSTSQPTS---DLLLDILGN------GFDSDINENKSSTNPITLEQSESDENYLKLLWKSSGILFENDKIQI-GIKSEFRGNMGRLGIFYGNKSLKQMTDFGTEL 774          
BLAST of AP complex subunit beta vs. Planmine SMEST
Match: SMESG000031293.1 (SMESG000031293.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.649e-6
Identity = 88/435 (20.23%), Postives = 175/435 (40.23%), Query Frame = 2
Query:  272 DVVNCMQTDNLELKKLVYLYLMNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLCDPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSNPMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWG---------------QVFILDAIANYQPKDDSEAQGICERVVPRLS-------HANAAVVLSAVKVIMKLLEMLNPSDDFVQTMIKKLAPPLVTQ--LSAEPEIQYVALRNINLIVQKRSEILKNEVKVFFVKYNDP-IYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFVRKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIIATLCENL--DTLDEPEAKASMIWIIGEYAE 1495
            D +  + ++    K++ YL  M     + D  +L  N+   D +  N  I +LA+ T+G I   +++  L   + K +K  + Y+RK A +C  ++      ++E   F+   + LL++ N  V+  A   I+E+  C QS      L+F + +V  L+  L      G               QV +L  +     K D EA      ++ +++       +   A++   V  IM +           +  ++ LA  ++ +  L+ +  I+YVAL  +  +V    + ++           DP + ++   +++   L N  NI  +  EL  +    + +F   +  ++   A K          T++ L+ T  NY   + +  +  +  +    +   +  L   L  D   +P  + +  W IGEY E
Sbjct:   69 DCLKLIASNKFTDKRIGYLGAMLLLDERTDIHVLVTNSLKNDLNHTNQYIVSLALCTLGSICSTEMSRDLVTEVEKLIKSSNAYLRKKAILCAFRMIRKVPDLIE--LFIPATRSLLNEKNHGVLITAATLITEM--CQQSPDT---LSFFRRMVPNLVRILKNLIMSGYSPEHDVNGVSDPFLQVKVLK-LLRIVGKGDHEASDAMNDILAQVATNTDTSKNVGHAILYEIVLTIMGVES---------EAGLRVLAVNILGRFLLNNDKNIRYVALNTLQQVVHVDYKAVQRHRSTIVDCLLDPDVSIQRRAMELCFVLINTSNIRGMTKELLSFLHRCEPEFKADTCSSLVLAAEKYAPNKTWHFETMLQLLTTAGNYARDDVLSSLVALISQASAMHAYAVLRLYSALLYDMSQQPLIQIAS-WCIGEYGE 485          
The following BLAST results are available for this feature:
BLAST of AP complex subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP1B10.000e+067.91adaptor related protein complex 1 subunit beta 1 [... [more]
AP1B10.000e+067.91adaptor related protein complex 1 subunit beta 1 [... [more]
AP1B10.000e+067.91adaptor related protein complex 1 subunit beta 1 [... [more]
AP2B10.000e+067.09adaptor related protein complex 2 subunit beta 1 [... [more]
AP1B10.000e+067.36adaptor related protein complex 1 subunit beta 1 [... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apb-10.000e+074.43AP complex subunit beta [Source:UniProtKB/TrEMBL;... [more]
apb-10.000e+074.28AP complex subunit beta [Source:UniProtKB/TrEMBL;... [more]
apb-34.145e-5930.53AP-3 complex subunit beta [Source:UniProtKB/TrEMB... [more]
apb-31.333e-5629.98AP-3 complex subunit beta [Source:UniProtKB/TrEMB... [more]
apb-16.724e-4276.92AP complex subunit beta [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP-1-2beta0.000e+070.11gene:FBgn0010380 transcript:FBtr0074789[more]
rb7.961e-4032.69gene:FBgn0003210 transcript:FBtr0070702[more]
rb7.961e-4032.69gene:FBgn0003210 transcript:FBtr0332290[more]
rb7.961e-4032.69gene:FBgn0003210 transcript:FBtr0343568[more]
betaCOP6.664e-1121.40gene:FBgn0008635 transcript:FBtr0074576[more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap1b10.000e+068.23adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b10.000e+065.82adaptor related protein complex 1 subunit beta 1 [... [more]
ap2b10.000e+066.91adaptor related protein complex 2 subunit beta 1 [... [more]
ap1b10.000e+067.60adaptor related protein complex 1 subunit beta 1 [... [more]
ap2b10.000e+080.61adaptor related protein complex 2 subunit beta 1 [... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2b10.000e+066.08adaptor related protein complex 2 subunit beta 1 [... [more]
ap2b10.000e+065.43adaptor related protein complex 2 subunit beta 1 [... [more]
ap2b10.000e+067.05adaptor related protein complex 2 subunit beta 1 [... [more]
ap2b10.000e+067.46adaptor related protein complex 2 subunit beta 1 [... [more]
ap2b10.000e+067.31adaptor related protein complex 2 subunit beta 1 [... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ap2b10.000e+067.09adaptor-related protein complex 2, beta 1 subunit ... [more]
Ap1b10.000e+067.11adaptor protein complex AP-1, beta 1 subunit [Sour... [more]
Ap1b10.000e+065.77adaptor protein complex AP-1, beta 1 subunit [Sour... [more]
Ap1b10.000e+065.40adaptor protein complex AP-1, beta 1 subunit [Sour... [more]
Ap2b11.810e-8472.36adaptor-related protein complex 2, beta 1 subunit ... [more]
back to top
BLAST of AP complex subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62944|AP2B1_RAT0.000e+067.09AP-2 complex subunit beta OS=Rattus norvegicus OX=... [more]
sp|Q9DBG3|AP2B1_MOUSE0.000e+067.09AP-2 complex subunit beta OS=Mus musculus OX=10090... [more]
sp|P63010|AP2B1_HUMAN0.000e+067.09AP-2 complex subunit beta OS=Homo sapiens OX=9606 ... [more]
sp|P63009|AP2B1_BOVIN0.000e+067.09AP-2 complex subunit beta OS=Bos taurus OX=9913 GN... [more]
sp|Q10567|AP1B1_HUMAN0.000e+067.36AP-1 complex subunit beta-1 OS=Homo sapiens OX=960... [more]
back to top
BLAST of AP complex subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D8U30.000e+072.06AP complex subunit beta OS=Schistosoma japonicum O... [more]
C1LGR10.000e+071.96AP complex subunit beta OS=Schistosoma japonicum O... [more]
C1LGR00.000e+071.96AP complex subunit beta OS=Schistosoma japonicum O... [more]
A0A3Q0KED00.000e+071.79AP complex subunit beta OS=Schistosoma mansoni OX=... [more]
A0A074ZY070.000e+071.30AP complex subunit beta OS=Opisthorchis viverrini ... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2b10.000e+067.09adaptor related protein complex 2 subunit beta 1 [... [more]
ap1b10.000e+061.95adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b10.000e+062.94adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b11.521e-7677.60adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b11.527e-7677.60adaptor related protein complex 1 subunit beta 1 [... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap1b12.141e-8279.38adaptor related protein complex 1 subunit beta 1 [... [more]
AP3B21.691e-7031.48adaptor related protein complex 3 subunit beta 2 [... [more]
ap4b11.545e-5427.31adaptor related protein complex 4 subunit beta 1 [... [more]
copb12.884e-818.68coatomer protein complex, subunit beta 1 [Source:N... [more]
ENSPMAT00000000025.14.501e-819.96pep scaffold:Pmarinus_7.0:GL482217:474:17538:-1 ge... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
APL23.395e-13639.70Beta-adaptin subunit of the clathrin-associated pr... [more]
APL12.509e-7631.38Beta-adaptin; large subunit of the clathrin associ... [more]
APL62.298e-2722.86Beta3-like subunit of the yeast AP-3 complex; func... [more]
SEC262.019e-1221.38Essential beta-coat protein of the COPI coatomer; ... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361350.000e+066.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320972.464e-2928.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291495.421e-1845.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349742.371e-1019.60Coatomer subunit beta [Source:UniProtKB/TrEMBL;Ac... [more]
EDO491511.556e-819.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AP complex subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2b10.000e+067.12AP-1 complex subunit beta-1 [Source:NCBI gene;Acc:... [more]
ap1b13.164e-5279.37adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b13.964e-7879.37adaptor related protein complex 1 subunit beta 1 [... [more]
ap1b11.684e-7879.37adaptor related protein complex 1 subunit beta 1 [... [more]
ap2b11.046e-8353.38AP-1 complex subunit beta-1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of AP complex subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029126.10.000e+0100.00SMESG000029126.1[more]
SMESG000029143.10.000e+099.68SMESG000029143.1[more]
SMESG000041850.12.827e-7430.93SMESG000041850.1[more]
SMESG000036030.18.928e-1020.41SMESG000036030.1[more]
SMESG000031293.11.649e-620.23SMESG000031293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007943 ID=SMED30007943|Name=AP complex subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3112bp
GTTTATTTCCTTTAATAACAAATAATTTTGAAAAATGCAAGGTGTAGCTG
CATCTGTTACAGATACATTAGGCAATATTAAACCATGGCTACAAAAGGTT
ACAACACAAGCAAAGACTACTGACTCAAAATATTTCACCACAACAAAAAA
GGGTGAAATATTTGAGCTGAAAGCTGAATTAAATAGCGAACGTAAAGAAA
AGAAAAAGGAAGCAGTCAAAAAAGTTATAGCCAGTATGACTGTTGGAAAA
GATGTTAGTGCTTTGTTTCCGGATGTTGTCAATTGCATGCAAACGGATAA
TTTAGAATTAAAGAAATTAGTTTATCTTTATTTAATGAATTACGCAAAAA
CTCAACCAGATACTGCTATTTTGGCTGTTAACACATTTGTCCGAGATTGC
GATGATCCAAATCCTCTTATTCGAGCCCTTGCTGTAAGGACAATGGGTTG
TATTAGAGTGGATAAAATCACAGCATATTTATGTGATCCTTTACGCAAGT
GTTTGAAAGACGAGGATCCATATGTAAGGAAAACTGCTGCCGTTTGTGTT
GCTAAGCTTTATGACATTGATGCAACAATTGTTGAAGATAATGGATTTTT
GGAATTATTGAAAGACCTCTTGAGTGATAGTAATCCAATGGTTGTTGCTA
ATGCTGTTGCTGCAATTTCTGAGATATTAGAATGCACCCAATCTGATAGT
GCTCATCAAATGCTGGCATTCAGTCAAAGTGTGGTTAATAAGCTTTTAAC
TGCTCTAAACGAATGCACTGAATGGGGTCAAGTTTTCATTCTTGATGCAA
TTGCTAATTATCAACCGAAAGACGATTCCGAGGCTCAAGGAATTTGTGAA
AGAGTCGTTCCACGTTTGTCTCATGCCAATGCAGCAGTCGTGTTGTCAGC
AGTGAAAGTGATAATGAAGTTGCTAGAAATGCTTAATCCTAGTGATGATT
TCGTGCAAACGATGATCAAAAAGTTGGCACCGCCTCTCGTGACACAATTA
TCCGCAGAACCCGAAATTCAATATGTTGCTTTGAGGAACATCAATTTGAT
TGTCCAGAAACGGTCGGAAATTCTCAAAAATGAAGTGAAAGTGTTTTTTG
TCAAATACAACGATCCGATCTACGTGAAATTGGAGAAATTGGATATCATG
ATTCGATTGACAAATCATCAAAACATTCCTCAGGTTCTTGCAGAATTGAA
AGAATATGCCAAAGAAGTCGACGTGGATTTTGTTCGCAAATCAGTCCGCG
CTATAGGACGTTGCGCAATCAAGGTGGAGGCTGCCGCTGAACGCTGTATG
ACAACACTGATTGACCTGATTCAAACGAAGGTTAATTACGTCGTACAGGA
AGCTATTGTAGTTATCAAGGATATTTTCCGAAAGTATCCTAATAAATATG
AAAGCATAATTGCGACTTTGTGTGAAAATTTGGATACTCTCGATGAACCG
GAAGCTAAAGCATCAATGATTTGGATTATTGGTGAATATGCTGAACGTAT
TGATAACGCAGAGGAATTGCTTGAATCGTTTTTGGAAGGATTTCAAGATG
AAAATACTCAAGTTCAGTTACAACTTCTTACTGCTATAGTGAAACTGTTC
TTGAAACGACCTGCTCACACTCAAGAGTTGGTTCAAAATGTTCTTAGCCT
TGCTACGCAGGAATCGGATAATCCAGATCTTCGCGATCGAGGCTATATTT
ATTGGCGATTACTCTCTACTGATCCGGCTGCTGCAAAAGAAGTTGTATTG
GCAGAAAAGCCTTTGATTAGCGAAGAAACGGATCTACTTGAACCGAGTTT
ATTAGATGAACTTATTTGTCATTTGGCTACCCTTGCCAGTGTTTACCACA
GGCCTCCAAATTCATTTGTTGACGGCAAACATTTCGTCAGACGCCAATTA
AATTCTCGAACAGAAGGTGGCGATGCTGATTCTGTTGATATTGTTAAAGA
AGCCGCTCCAACTCAAACCGTCATTCCGTCTCAGGATACTCTAATAGGCG
ATCTGATGGATCTGGATTTGAATCCAATTCAAGGTAACCAAATGTTTGGT
GGCTCCTACAATCAACCTTCCCAACAGCAACCAATGTCTGGATCATTTGA
TTTATTAGGAGATGGTTTAGACAGTTTACTGAATTTGAATCCTTCTCAAA
CTTCAGCTCAAGCAACTGGTAGTTCTGTCGATACGCTTGCAGATATATTT
GGTAATTTTGGTGCTCCACTCGGTGGTGGTTCTTCAAATTTCTCCTCAAA
TCAATGCTATGTGGCTCCTAAAGAAATCTGGTTATCTGCTGCTAAAGGTA
AAGGACTTGAAATTCAAGGAACATTCTCCAGGAAACCTGGAAATCAAATG
TCTATGGATTTAACTTTCTTGAATCGAGCAGCTCAAGCTCTTACCGATTT
CGCAATTCAATTTAACAAGAACAGTTTCGGTATTGCTCCAGCCCAACCGA
TGTCGATACTGACTCCATTACTACCGAACCAGACAATAAGTTATTCGTTA
CCTCTCAATAACAATGGCCCAGTAATGAAACTCGAAAATCTTACTGCTAT
ACAAGTCGCTCTTCGAACAAATATTGATGTTTTGTATTTCCAATGCATTG
TTCCGTTGAACATTTTAATGATTGACGAAGGTGAAATGGAAAAACGGGTA
TTCTTATCGACCTGGAAAGACATTCCTGGAGCTTATGAGACCCAGTATCG
ATTGACTGGGATCCGACTGTCAGCAGAAGAGTGCAGTGAACGACTTAAAA
GAAATAATGTTTTTACTATTGCTAAGCGGAATGTTGATGGCCAAGATATG
CTCTATCAATCACTGAAACTTATCAATAACATCTGGGTGCTGGCGGAACT
GAAAATCAAGCCCGGTACTGGGGAATACACGTTGTCATTGAAATCTCGCG
TGATGGAAGTCTACCCGTCGGTCCAGAAGGCTTACATGGATATTTTGCAA
TGAATTTCTTTGAATTGAATCATTATAATAATAATAATGTGTGTGTGTGT
CATAGATTACATTATTATGATGTTGTTGTTTCATTGTTGTGATTTGTCAA
TTGCACGCATTATTAACTATTCTGCTCTCGTTTCATTTAATAATTCAATT
AGTTCAATTATC
back to top

protein sequence of SMED30007943-orf-1

>SMED30007943-orf-1 ID=SMED30007943-orf-1|Name=SMED30007943-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=973bp
MQGVAASVTDTLGNIKPWLQKVTTQAKTTDSKYFTTTKKGEIFELKAELN
SERKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYL
MNYAKTQPDTAILAVNTFVRDCDDPNPLIRALAVRTMGCIRVDKITAYLC
DPLRKCLKDEDPYVRKTAAVCVAKLYDIDATIVEDNGFLELLKDLLSDSN
PMVVANAVAAISEILECTQSDSAHQMLAFSQSVVNKLLTALNECTEWGQV
FILDAIANYQPKDDSEAQGICERVVPRLSHANAAVVLSAVKVIMKLLEML
NPSDDFVQTMIKKLAPPLVTQLSAEPEIQYVALRNINLIVQKRSEILKNE
VKVFFVKYNDPIYVKLEKLDIMIRLTNHQNIPQVLAELKEYAKEVDVDFV
RKSVRAIGRCAIKVEAAAERCMTTLIDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESIIATLCENLDTLDEPEAKASMIWIIGEYAERIDNAEELLESFL
EGFQDENTQVQLQLLTAIVKLFLKRPAHTQELVQNVLSLATQESDNPDLR
DRGYIYWRLLSTDPAAAKEVVLAEKPLISEETDLLEPSLLDELICHLATL
ASVYHRPPNSFVDGKHFVRRQLNSRTEGGDADSVDIVKEAAPTQTVIPSQ
DTLIGDLMDLDLNPIQGNQMFGGSYNQPSQQQPMSGSFDLLGDGLDSLLN
LNPSQTSAQATGSSVDTLADIFGNFGAPLGGGSSNFSSNQCYVAPKEIWL
SAAKGKGLEIQGTFSRKPGNQMSMDLTFLNRAAQALTDFAIQFNKNSFGI
APAQPMSILTPLLPNQTISYSLPLNNNGPVMKLENLTAIQVALRTNIDVL
YFQCIVPLNILMIDEGEMEKRVFLSTWKDIPGAYETQYRLTGIRLSAEEC
SERLKRNNVFTIAKRNVDGQDMLYQSLKLINNIWVLAELKIKPGTGEYTL
SLKSRVMEVYPSVQKAYMDILQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0030276clathrin binding
GO:0005488binding
GO:0008565protein transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR016342AP_complex_bsu_1_2_4
IPR026739AP_beta
IPR015151B-adaptin_app_sub_C
IPR008152Clathrin_a/b/g-adaptin_app_Ig
IPR011989ARM-like
IPR013037Clathrin_b-adaptin_app_Ig-like
IPR012295TBP_dom_sf
IPR002553Clathrin/coatomer_adapt-like_N
IPR009028Coatomer/calthrin_app_sub_C
IPR013041Clathrin_app_Ig-like_sf
IPR016024ARM-type_fold
Vocabulary: cellular component
TermDefinition
GO:0030131clathrin adaptor complex
GO:0030117membrane coat
GO:0005737cytoplasm
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
GO:0006810transport
GO:0015031protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008152Clathrin adaptor, alpha/beta/gamma-adaptin, appendage, Ig-like subdomainSMARTSM00809alpha_adaptinc2coord: 742..853
e-value: 1.5E-11
score: 54.4
IPR008152Clathrin adaptor, alpha/beta/gamma-adaptin, appendage, Ig-like subdomainPFAMPF02883Alpha_adaptinC2coord: 752..834
e-value: 8.9E-10
score: 38.9
IPR015151Beta-adaptin appendage, C-terminal subdomainSMARTSM01020B2_adapt_app_C_2coord: 863..972
e-value: 7.5E-34
score: 128.4
IPR015151Beta-adaptin appendage, C-terminal subdomainPFAMPF09066B2-adapt-app_Ccoord: 865..971
e-value: 3.4E-28
score: 98.0
IPR002553Clathrin/coatomer adaptor, adaptin-like, N-terminalPFAMPF01602Adaptin_Ncoord: 41..562
e-value: 5.7E-155
score: 516.8
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 28..621
e-value: 4.3E-259
score: 862.8
IPR016342AP-1/2/4 complex subunit betaPIRSFPIRSF002291Beta_adaptincoord: 23..804
e-value: 1.1E-302
score: 1003.6
IPR013037Clathrin adaptor, beta-adaptin, appendage, Ig-like subdomainGENE3DG3DSA:2.60.40.1150coord: 740..857
e-value: 2.6E-44
score: 151.9
IPR012295TBP domain superfamilyGENE3DG3DSA:3.30.310.10coord: 858..972
e-value: 1.1E-38
score: 133.8
IPR026739AP complex subunit betaPANTHERPTHR11134ADAPTER-RELATED PROTEIN COMPLEX, BETA SUBUNITcoord: 29..971
NoneNo IPR availablePANTHERPTHR11134:SF31AP-1 COMPLEX SUBUNIT BETA-1coord: 29..971
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 33..611
IPR013041Clathrin adaptor, appendage, Ig-like subdomain superfamilySUPERFAMILYSSF49348Clathrin adaptor appendage domaincoord: 742..859
IPR009028Coatomer/calthrin adaptor appendage, C-terminal subdomainSUPERFAMILYSSF55711Subdomain of clathrin and coatomer appendage domaincoord: 862..971