TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30007937
Length (bp)1123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30007937) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30007937) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30007937) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30007937) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 49.6766 bits (117), Expect = 6.220e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  333 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 417          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 49.6766 bits (117), Expect = 6.719e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  416 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 500          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 49.6766 bits (117), Expect = 6.719e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  416 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 500          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 49.6766 bits (117), Expect = 7.190e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  391 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 475          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 49.6766 bits (117), Expect = 7.190e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  391 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 475          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 49.6766 bits (117), Expect = 3.895e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDKWI------YSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G L W+I    + +++  +      YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L+WPFK ++ + L++
Sbjct:  421 GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMD 505          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 48.521 bits (114), Expect = 4.740e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+  W+I   S+  +D        ++S  FY+   GYKMCL + + GD  G              RG    + ++F +MRG  DA L+WPF  ++ + L++
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTG--------------RG--THLSLFFVVMRGHSDALLKWPFNQKVTLMLLD 210          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 48.521 bits (114), Expect = 4.740e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+  W+I   S+  +D        ++S  FY+   GYKMCL + + GD  G              RG    + ++F +MRG  DA L+WPF  ++ + L++
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTG--------------RG--THLSLFFVVMRGHSDALLKWPFNQKVTLMLLD 210          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 49.6766 bits (117), Expect = 4.564e-6
Identity = 33/109 (30.28%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDKW------IYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYD 836
            G+  W+I  L+    D        +YS  FY+   GYK+CL + + GD  GA              G    + ++F +M+G+ DA L WPFK+++   L+   D N+ D
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGD--GA--------------GKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLV---DHNNRD 319          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 49.6766 bits (117), Expect = 5.012e-6
Identity = 31/118 (26.27%), Postives = 58/118 (49.15%), Query Frame = 3
Query:  480 IQSIQTKFGNAEFINF-GILDWQIDKLSQLERD------KWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            +  ++T+   +E   + G+  W+I +  +  +D        ++S PFY+   GYKMCL + + GD  G  R   +S              ++F +M+G+ DA L WPF  ++ + L++
Sbjct:  288 VAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTG--RNTHLS--------------LFFVVMKGNNDALLRWPFNQKVTLMLLD 389          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 49.6766 bits (117), Expect = 5.230e-6
Identity = 31/118 (26.27%), Postives = 58/118 (49.15%), Query Frame = 3
Query:  480 IQSIQTKFGNAEFINF-GILDWQIDKLSQLERD------KWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            +  ++T+   +E   + G+  W+I +  +  +D        ++S PFY+   GYKMCL + + GD  G  R   +S              ++F +M+G+ DA L WPF  ++ + L++
Sbjct:  315 VAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTG--RNTHLS--------------LFFVVMKGNNDALLRWPFNQKVTLMLLD 416          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 49.6766 bits (117), Expect = 6.005e-6
Identity = 32/101 (31.68%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++++ L++
Sbjct:  409 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMD 493          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 49.6766 bits (117), Expect = 6.365e-6
Identity = 32/101 (31.68%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++++ L++
Sbjct:  384 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMD 468          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 49.2914 bits (116), Expect = 5.167e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  415 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 499          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 49.2914 bits (116), Expect = 5.385e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  390 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 474          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 49.2914 bits (116), Expect = 5.385e-6
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G+L W+I    + +++        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  390 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 474          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 48.1358 bits (113), Expect = 5.933e-6
Identity = 26/108 (24.07%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  531 ILDWQIDKLSQLE-RDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMK 851
            + D+++ K   +E     ++S+PFY+   GY++C    + GD  G              +G    + +YF +MRG+ D+ L+WPF+  + + L++ +   ++  ++ K
Sbjct:  102 VTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSG--------------KGTH--LSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK 193          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 48.1358 bits (113), Expect = 5.933e-6
Identity = 26/108 (24.07%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  531 ILDWQIDKLSQLE-RDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMK 851
            + D+++ K   +E     ++S+PFY+   GY++C    + GD  G              +G    + +YF +MRG+ D+ L+WPF+  + + L++ +   ++  ++ K
Sbjct:  102 VTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSG--------------KGTH--LSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK 193          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7U807 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 GN=105313828 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.357e-7
Identity = 35/107 (32.71%), Postives = 59/107 (55.14%), Query Frame = 3
Query:  543 QIDKLSQLERDKWI-YSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYD 860
            ++D+ ++ + +K + YS  FYS PGGYKMCL+V   G+ G A                   I  + HL+ GD D  LEWPFK E+++ L+N  +   ++K+ +++ +
Sbjct:  265 KLDEYTKHKEEKTVWYSPAFYSSPGGYKMCLSVFCNGNGGAANHY----------------ISCFVHLLSGDYDDTLEWPFKGEVSLELLNQMEDKCHEKELLRFSE 355          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M7SHF5 (TNF receptor-associated factor 4-like OS=Brachionus plicatilis OX=10195 GN=BpHYR1_034858 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.661e-7
Identity = 54/210 (25.71%), Postives = 100/210 (47.62%), Query Frame = 3
Query:  303 SNPNNKLTTLRNRSGRVEQNPNGKLMHLNKTLNSSRI*K*FIEMIEFVIQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKL------SQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQ---SMKYYDCSDDAR-LGRPAREK 902
            ++ N +  +LR+   R  +   G  +HLN    +  I K  +E++  +I+ + E    +I S+ +K  + E I+   + W+ID        S+  + + I+S PF +   GYK+ L+  + GD  G  + +F+S  L + +G+F              D+ L WPF +++ I L++  D     +    S+K   C ++   LGRP  E+
Sbjct:  250 ADSNCEFKSLRSEMPRHLKESPG--IHLNLMAKTISIQKKQLELLSEIIEKQKE----QIFSLGSKVDSIEKISGSQIIWKIDHFNEKFNDSKSGKKQTIFSPPFLTSRHGYKLALSATLFGD--GKAKGKFMSLFLCICKGEF--------------DSLLSWPFSHKITITLLDQCDDIQERRHVSYSIKPNTCKENTPFLGRPTGER 437          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7UYD4 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 GN=105312681 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.202e-7
Identity = 41/125 (32.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  573 DKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREKYSDLL*I*FYRFIRH 947
            +KW YS PFY+ PGGYKM L+V   G+       R   G           +  Y HL+RG+ D  LEWPF+ E+ I L+N  + N++    +K+ + + D    R   +   +     F+RF+ H
Sbjct:  264 EKW-YSSPFYTSPGGYKMILSVCANGN-------RNAKGT---------HVSCYIHLVRGENDDYLEWPFQGEVTIELLNQLEDNNHKAYILKFNESTPDNSKNRVVEQ--GNGCGWGFHRFVSH 369          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0M3K796 (Uncharacterized protein OS=Anisakis simplex OX=6269 GN=ASIM_LOCUS16244 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 7.603e-7
Identity = 38/135 (28.15%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  426 IEMIEFVIQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERD------KWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            ++M+   ++  ME     ++++Q K    E +    + W+ID + Q + +        I+S PF S   GYKM L+V + GD  G +R  ++S  +++ RG+F              DA LEWPF  ++ I L++
Sbjct:  167 LKMLLANMELSMETMGTNLETLQKKCATLEKLYGSQMIWRIDNVKQKQNEARSGTRSIIFSPPFASARHGYKMVLSVSLYGD--GQVRGEYMSAFISIMRGEF--------------DALLEWPFTNQIKITLLD 285          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: C3ZH16 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_85024 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.432e-6
Identity = 55/186 (29.57%), Postives = 84/186 (45.16%), Query Frame = 3
Query:  297 KISNPNNKLTTLRNRSGRVEQNPNGKLMHLN-KTLNSSRI*K*FIEMIEFVIQNEMEKCAYEIQSIQTKFGNAEFINF-GILDWQIDKLSQLERDKW------IYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGND 830
            +I N N  LT+   R     ++ NGKL  L  K  N S       E IE  +Q E+ +    I     K    E  ++ G L W+I+  SQ  ++        IYS PFY+   GYKMC+ V   G  GG  R   +S              +YFH+++   D+ L+WPF + +   L++ +D ++
Sbjct:  257 RIQNQNALLTSQHQRV----KSQNGKLESLTVKVCNQS-------EKIEL-LQTELLRKEAIIAEQMKKIKELEVTSYDGSLLWRINNFSQRHQEAASKQVPSIYSPPFYTSRFGYKMCIQVFANG--GGETRGTHMS--------------IYFHILKHRYDSVLQWPFPHNITFTLLDQSDDSN 414          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.736e-6
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  582 IYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:   28 LYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMD 88          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 8.026e-8
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  570 RDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            R   +YS+PFY+ P GYKMC    + GD               V RG    + ++F +MRG+ DA LEWPF+  + + L++
Sbjct:  288 RTLSLYSQPFYTSPFGYKMCARAYLNGD--------------GVGRGTH--LSLFFVVMRGEYDALLEWPFRRRVTLSLLD 352          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.019e-7
Identity = 31/101 (30.69%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G L W+I   ++ ++D        +YS+PFY+ P GY+MC    + GD               V RG    + ++F +MRG+ DA L WPF+  + + L++
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGD--------------GVGRGTH--LSLFFVVMRGEYDALLPWPFRQRVTLTLLD 409          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 46.9802 bits (110), Expect = 4.963e-6
Identity = 33/144 (22.92%), Postives = 64/144 (44.44%), Query Frame = 3
Query:  480 IQSIQTKFGNAEF-INFGILDWQIDKLSQL----------------ERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYD 860
            ++S++ +   +E  +  GI  W++++ S+L                +    ++S  FY+G  GY++CL + +             S LLA   G    + ++ HL++GD D  L WPFK  + I +++  + +      M   D
Sbjct:  376 VRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLA---GRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD 516          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 47.3654 bits (111), Expect = 3.068e-7
Identity = 32/109 (29.36%), Postives = 50/109 (45.87%), Query Frame = 3
Query:  528 GILDWQI-------DKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDY 833
            GI  W+I       D+      +  I+S PFY+   GYK+ L   + G                  RG    + +Y  +M+GD DA LEWPFK ++  YLI+ ++  ++
Sbjct:    2 GIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRD----------------RGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNH 94          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 49.2914 bits (116), Expect = 1.437e-6
Identity = 37/151 (24.50%), Postives = 71/151 (47.02%), Query Frame = 3
Query:  480 IQSIQTKFGNAEFINFGILDWQIDKLSQLERD------KWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQ---SMKYYDCSDDAR-LGRPAREK 902
            ++ + ++ G+ E I    + W+I+  ++  ++      + ++S  F +   GY++C +V + GD  G  +   +S  ++V +G F              DA L+WPF Y +  +L+N  +  +  K    S+K     D+   LGRP  EK
Sbjct:  290 MKQVDSRVGDLEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKG--KGTHMSVFVSVLKGAF--------------DALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEK 424          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 49.2914 bits (116), Expect = 1.442e-6
Identity = 39/151 (25.83%), Postives = 68/151 (45.03%), Query Frame = 3
Query:  480 IQSIQTKFGNAEFINFGILDWQIDKLSQLERDK------WIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQ---SMKYYDCSDDAR-LGRPAREK 902
            I+  + +  + E I    L W+I+  ++  ++        ++S  F +   GY++C +V + GD  G  +   +S  ++V +G F              DA L+WPF Y +   L++  D     K    S+K   C+D+   LGRP  EK
Sbjct:  286 IEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKG--KGTHMSVFISVLKGAF--------------DALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEK 420          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 48.521 bits (114), Expect = 2.939e-6
Identity = 33/105 (31.43%), Postives = 51/105 (48.57%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERD------KWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADG 824
            G   W+IDK ++   +        IYS PFY+   GYK+C  +   GD  G+ R  ++S              ++  LMRG+ D+ L WPF+  + I LI+  +G
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGD--GSARDNYLS--------------IFIALMRGEYDSILPWPFQETITITLIDQDNG 468          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO36181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJA2])

HSP 1 Score: 45.0542 bits (105), Expect = 3.850e-6
Identity = 33/105 (31.43%), Postives = 50/105 (47.62%), Query Frame = 3
Query:  540 WQIDKLS-QLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYV--YFHLMRGDCDAGLEWPFKYELNIYLINPADGND--YDK 839
            W+I   + Q E+ + I S  FY+   GYKM L   + G+                  GD  G ++  +  + +G+ DA LEWPFK ++ +YLI+  D     YDK
Sbjct:   19 WRIRNYNDQYEKKQTISSRLFYTSRYGYKMRLKSHLNGN------------------GDGKGTHLSLFVQITKGEYDALLEWPFKRKITLYLIDQIDQQRHMYDK 105          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 50.8322 bits (120), Expect = 1.239e-6
Identity = 33/101 (32.67%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  528 GILDWQIDKLSQLERDKW------IYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLIN 812
            G L W+I    + ++D        +YS+PFY+G  GYKMC  V + GD           G+     G    + ++F +MRG+ DA L WPFK ++ + L++
Sbjct:  298 GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGD-----------GM-----GKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMD 382          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000000514.1 (SMESG000000514.1)

HSP 1 Score: 182.57 bits (462), Expect = 4.374e-92
Identity = 91/149 (61.07%), Postives = 103/149 (69.13%), Query Frame = 3
Query:  456 EMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREK 902
            EMEKC  EI+ IQTKFGNAEFINFGILDWQIDKLSQLER+KWIYSEPFYSGPGGYK+CL+VGI                      D GGIYV F L+ GDCDAGLEWPFKY + + +INPA+   Y  QS+K  D    A  GRPA ++
Sbjct:  294 EMEKCTNEIRQIQTKFGNAEFINFGILDWQIDKLSQLEREKWIYSEPFYSGPGGYKLCLSVGI--------------------SDDIGGIYVSFCLLHGDCDAGLEWPFKYSVTVNVINPANRKVYLSQSLKCPDSPAAAGWGRPASDR 422          

HSP 2 Score: 160.229 bits (404), Expect = 4.374e-92
Identity = 88/122 (72.13%), Postives = 101/122 (82.79%), Query Frame = 2
Query:   35 ININKKKMESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRMCHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSRTKSERQIDAFKQNFE 400
            IN  + +MESMTS+ DQL QRM  ME+KDR  +GE ERLKGENDKL Q+LNA+KLRMCHASLK ND IQLCRIDNSLLS+++ KL  E  QSKQQ ++IEKQI TS+TKSERQIDAFKQN E
Sbjct:  160 INKFENQMESMTSKNDQLTQRMCRMEEKDRENRGEIERLKGENDKLNQQLNAMKLRMCHASLKANDNIQLCRIDNSLLSDEMAKLNAEISQSKQQIESIEKQIETSQTKSERQIDAFKQNCE 281          

HSP 3 Score: 36.1946 bits (82), Expect = 4.374e-92
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:  880 WGG-QLERNIPIYCKYDFTDLSDIKNDKLLLKCRIEKL 990
            WG    +RN PIY   ++  LSDIKNDKLLLKC I+KL
Sbjct:  415 WGRPASDRNDPIY-YNNYIILSDIKNDKLLLKCGIKKL 451          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000029692.1 (SMESG000029692.1)

HSP 1 Score: 173.711 bits (439), Expect = 7.867e-92
Identity = 91/152 (59.87%), Postives = 102/152 (67.11%), Query Frame = 3
Query:  447 IQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREK 902
            IQNEMEKC  +I  IQTKFGNA FINFGILDWQIDKLSQLER+K IYSEPFYSGPGGYKMCLAV I GD                     G I V F LMRGDCDA L WPF+Y + I++INPA+GN Y +QS+K        R  RPA ++
Sbjct:  291 IQNEMEKCVNKIPPIQTKFGNA-FINFGILDWQIDKLSQLEREKLIYSEPFYSGPGGYKMCLAVDISGD---------------------GAILVRFCLMRGDCDAELVWPFRYSVTIHMINPANGNVYFRQSLKCPITFAAVRWVRPASDR 420          

HSP 2 Score: 171.014 bits (432), Expect = 7.867e-92
Identity = 93/125 (74.40%), Postives = 106/125 (84.80%), Query Frame = 2
Query:   35 ININKKKMESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRMCHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSRTKSERQIDAFKQNFEQQQ 409
            IN  + +MESMTS+ DQL QRM LME+KDR  +GE ERLKGENDKL QKLNA+KLRMCHASLK ND IQLCRIDNSLLS+++ KL TE  QSK+Q ++IEKQI TS+TKSERQIDAFKQN EQQQ
Sbjct:  160 INKFENQMESMTSKNDQLTQRMCLMEEKDRENRGEIERLKGENDKLNQKLNAMKLRMCHASLKANDNIQLCRIDNSLLSDEMAKLNTEISQSKRQIESIEKQIETSQTKSERQIDAFKQNCEQQQ 284          

HSP 3 Score: 33.8834 bits (76), Expect = 7.867e-92
Identity = 16/21 (76.19%), Postives = 19/21 (90.48%), Query Frame = 1
Query:  925 DFTDLSDIKNDKLLLKCRIEK 987
            D+ +LSDIKNDKLLLKC I+K
Sbjct:  430 DYINLSDIKNDKLLLKCIIKK 450          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000029692.1 (SMESG000029692.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.685e-91
Identity = 91/152 (59.87%), Postives = 102/152 (67.11%), Query Frame = 3
Query:  447 IQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREK 902
            IQNEMEKC  +I  IQTKFGNA FINFGILDWQIDKLSQLER+K IYSEPFYSGPGGYKMCLAV I GD                     G I V F LMRGDCDA L WPF+Y + I++INPA+GN Y +QS+K        R  RPA ++
Sbjct:  291 IQNEMEKCVNKIPPIQTKFGNA-FINFGILDWQIDKLSQLEREKLIYSEPFYSGPGGYKMCLAVDISGD---------------------GAILVRFCLMRGDCDAELVWPFRYSVTIHMINPANGNVYFRQSLKCPITFAAVRWVRPASDR 420          

HSP 2 Score: 170.629 bits (431), Expect = 1.685e-91
Identity = 93/125 (74.40%), Postives = 106/125 (84.80%), Query Frame = 2
Query:   35 ININKKKMESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRMCHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSRTKSERQIDAFKQNFEQQQ 409
            IN  + +MESMTS+ DQL QRM LME+KDR  +GE ERLKGENDKL QKLNA+KLRMCHASLK ND IQLCRIDNSLLS+++ KL TE  QSK+Q ++IEKQI TS+TKSERQIDAFKQN EQQQ
Sbjct:  160 INKFENQMESMTSKNDQLTQRMCLMEEKDRENRGEIERLKGENDKLNQKLNAMKLRMCHASLKANDNIQLCRIDNSLLSDEMAKLNTEISQSKRQIESIEKQIETSQTKSERQIDAFKQNCEQQQ 284          

HSP 3 Score: 33.4982 bits (75), Expect = 1.685e-91
Identity = 16/21 (76.19%), Postives = 19/21 (90.48%), Query Frame = 1
Query:  925 DFTDLSDIKNDKLLLKCRIEK 987
            D+ +LSDIKNDKLLLKC I+K
Sbjct:  430 DYINLSDIKNDKLLLKCIIKK 450          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000000502.1 (SMESG000000502.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.237e-90
Identity = 94/132 (71.21%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   35 ININKKKMESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRMCHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSRTKSERQIDAFKQNFEQ---QQNIKV 421
            IN  + +MESMTS+ DQL QRM LME+KDR  +GE ERL GENDKL Q+LNA+KLRMCHASLK ND IQLCRIDNSLLS+++ KL TE  QSK+Q ++IEKQI TS+TKSERQIDAFKQN EQ   QQNIK+
Sbjct:  153 INKFENQMESMTSKNDQLTQRMCLMEEKDRENRGEIERLNGENDKLNQQLNAMKLRMCHASLKANDNIQLCRIDNSLLSDEMAKLNTEISQSKRQIESIEKQIETSQTKSERQIDAFKQNCEQQKLQQNIKI 284          

HSP 2 Score: 158.303 bits (399), Expect = 1.237e-90
Identity = 83/152 (54.61%), Postives = 99/152 (65.13%), Query Frame = 3
Query:  447 IQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREK 902
            IQNEMEKCA EI+ IQTKFGNAEFINFG  +WQI KLSQ ER+K IYS+PF+SGP GYKMCL+V I+                     D G I VYFHLMRGD D  L+WPFKY + I  INP +GN Y   S++Y     D R  +P+R++
Sbjct:  284 IQNEMEKCANEIRLIQTKFGNAEFINFGFFEWQIYKLSQQERNKSIYSKPFFSGPIGYKMCLSVYIKC-------------------AD-GDICVYFHLMRGDSDEKLKWPFKYSVTIDAINPENGNVYRSHSVEYSKSPADDRWDKPSRDR 415          

HSP 3 Score: 47.3654 bits (111), Expect = 1.237e-90
Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 1
Query:  895 ERNIPIYCKYDFTDLSDIKNDKLLLKCRIEKL 990
            +RN PIY    FT+LSDIKNDKLLLKCRI+KL
Sbjct:  414 DRNAPIYYAGYFTNLSDIKNDKLLLKCRIKKL 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000000502.1 (SMESG000000502.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.300e-90
Identity = 94/132 (71.21%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   35 ININKKKMESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRMCHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSRTKSERQIDAFKQNFEQ---QQNIKV 421
            IN  + +MESMTS+ DQL QRM LME+KDR  +GE ERL GENDKL Q+LNA+KLRMCHASLK ND IQLCRIDNSLLS+++ KL TE  QSK+Q ++IEKQI TS+TKSERQIDAFKQN EQ   QQNIK+
Sbjct:  160 INKFENQMESMTSKNDQLTQRMCLMEEKDRENRGEIERLNGENDKLNQQLNAMKLRMCHASLKANDNIQLCRIDNSLLSDEMAKLNTEISQSKRQIESIEKQIETSQTKSERQIDAFKQNCEQQKLQQNIKI 291          

HSP 2 Score: 158.303 bits (399), Expect = 1.300e-90
Identity = 83/152 (54.61%), Postives = 99/152 (65.13%), Query Frame = 3
Query:  447 IQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKWIYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYVYFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARLGRPAREK 902
            IQNEMEKCA EI+ IQTKFGNAEFINFG  +WQI KLSQ ER+K IYS+PF+SGP GYKMCL+V I+                     D G I VYFHLMRGD D  L+WPFKY + I  INP +GN Y   S++Y     D R  +P+R++
Sbjct:  291 IQNEMEKCANEIRLIQTKFGNAEFINFGFFEWQIYKLSQQERNKSIYSKPFFSGPIGYKMCLSVYIKC-------------------AD-GDICVYFHLMRGDSDEKLKWPFKYSVTIDAINPENGNVYRSHSVEYSKSPADDRWDKPSRDR 422          

HSP 3 Score: 47.3654 bits (111), Expect = 1.300e-90
Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 1
Query:  895 ERNIPIYCKYDFTDLSDIKNDKLLLKCRIEKL 990
            +RN PIY    FT+LSDIKNDKLLLKCRI+KL
Sbjct:  421 DRNAPIYYAGYFTNLSDIKNDKLLLKCRIKKL 452          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF36.220e-631.68TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF36.719e-631.68TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF36.719e-631.68TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF37.190e-631.68TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF37.190e-631.68TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
traf33.895e-631.68TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.14.740e-629.70pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.14.740e-629.70pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspb64.564e-630.28heat shock protein family B (small) member 6 [Sour... [more]
TRAF25.012e-626.27TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF25.230e-626.27TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh26.005e-631.68slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh26.365e-631.68slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf35.167e-631.68TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf35.385e-631.68TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf35.385e-631.68TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf55.933e-624.07TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf55.933e-624.07TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7U8071.357e-732.71Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A3M7SHF52.661e-725.71TNF receptor-associated factor 4-like OS=Brachionu... [more]
A0A1X7UYD43.202e-732.80Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A0M3K7967.603e-728.15Uncharacterized protein OS=Anisakis simplex OX=626... [more]
C3ZH161.432e-629.57Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000035169.11.736e-636.36pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.18.026e-835.80pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.13.019e-730.69pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf64.963e-622.92TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO291453.068e-729.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328491.437e-624.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.442e-625.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.939e-631.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361813.850e-631.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf31.239e-632.67TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000514.14.374e-9261.07SMESG000000514.1[more]
SMESG000029692.17.867e-9259.87SMESG000029692.1[more]
SMESG000029692.11.685e-9159.87SMESG000029692.1[more]
SMESG000000502.11.237e-9071.21SMESG000000502.1[more]
SMESG000000502.11.300e-9071.21SMESG000000502.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007937 ID=SMED30007937|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1123bp
ATAATCTTTCATATTTGGATAATTTACAAAAGATATAAATATAAATAAAA
AAAAGATGGAATCAATGACGAGTGAAATTGATCAATTGAAGCAGAGAATG
CGCCTGATGGAAGACAAAGATCGGGGAAAACAGGGAGAAAATGAGAGATT
GAAGGGAGAAAACGATAAACTCATTCAGAAATTAAATGCAATAAAGCTGA
GAATGTGCCACGCGTCACTGAAAGGGAATGACATCATCCAACTTTGCCGC
ATTGATAATTCTTTGTTGAGTAATCAAATTACCAAATTAAAGACGGAAAA
TATCCAATCCAAACAACAAACTGACAACATTGAGAAACAGATCGGGACGA
GTCGAACAAAATCCGAACGGCAAATTGATGCATTTAAACAAAACTTTGAA
CAGCAGCAGAATATAAAAGTGATTTATAGAAATGATTGAATTTGTGATTC
AGAATGAAATGGAGAAATGCGCCTATGAAATCCAGTCGATTCAAACAAAA
TTTGGAAATGCAGAATTTATAAATTTCGGAATTTTGGATTGGCAAATCGA
TAAATTATCGCAACTGGAGAGAGATAAATGGATTTACAGCGAGCCATTTT
ATTCCGGGCCGGGCGGATACAAAATGTGCTTGGCGGTGGGTATTAGGGGT
GATTTTGGTGGTGCAATTCGTGTTCGTTTCATTAGTGGTTTATTAGCGGT
GTTTAGGGGTGATTTTGGTGGAATTTATGTTTATTTCCATTTGATGCGTG
GCGATTGCGATGCCGGATTGGAATGGCCATTCAAATATGAACTGAACATA
TATTTGATAAACCCGGCAGATGGAAATGATTATGATAAACAATCGATGAA
ATATTATGACTGCTCTGATGATGCCAGATTGGGGAGGCCAGCTAGAGAGA
AATATTCCGATTTATTGTAAATATGATTTTACCGATTTATCAGACATTAA
AAACGACAAATTGCTGCTCAAATGCAGAATAGAAAAATTGTGAAAAACTT
TATCAAATATTTCAATAAAAATTTTGATTTATTTTCTCACTTTTCCTCAG
CTCAGCTGATAAATTTATGCAAATTGTCGGTTTTGATAGGCGCGCGATAT
CGGCCAATCAAATCACTGATCAG
back to top

protein sequence of SMED30007937-orf-1

>SMED30007937-orf-1 ID=SMED30007937-orf-1|Name=SMED30007937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
MESMTSEIDQLKQRMRLMEDKDRGKQGENERLKGENDKLIQKLNAIKLRM
CHASLKGNDIIQLCRIDNSLLSNQITKLKTENIQSKQQTDNIEKQIGTSR
TKSERQIDAFKQNFEQQQNIKVIYRND*
back to top

protein sequence of SMED30007937-orf-2

>SMED30007937-orf-2 ID=SMED30007937-orf-2|Name=SMED30007937-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MIEFVIQNEMEKCAYEIQSIQTKFGNAEFINFGILDWQIDKLSQLERDKW
IYSEPFYSGPGGYKMCLAVGIRGDFGGAIRVRFISGLLAVFRGDFGGIYV
YFHLMRGDCDAGLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARL
GRPAREKYSDLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0006470protein dephosphorylation
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008974TRAF-like