eukaryotic translation initiation factor 3 subunit C

Overview
Nameeukaryotic translation initiation factor 3 subunit C (ADK78220.1)
Smed IDSMED30007934
Length (bp)2817
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of eukaryotic translation initiation factor 3 subunit C (SMED30007934) t-SNE clustered cells

Violin plots show distribution of expression levels for eukaryotic translation initiation factor 3 subunit C (SMED30007934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of eukaryotic translation initiation factor 3 subunit C (SMED30007934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for eukaryotic translation initiation factor 3 subunit C (SMED30007934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30007934SMESG000025491.1 SmedASXL_015777SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30007934SMESG000025491.1 SmedASXL_015777SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
ovarySMED30007934SMESG000025491.1 Contig3918_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30007934SMESG000025491.1 Contig3918_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30007934SMESG000025491.1 Contig3918_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30007934SMESG000025491.1 Contig3918_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30007934SMESG000025491.1 SmWIOct06_006962GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30007934SMESG000025491.1 SMED_03255_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30007934SMESG000025491.1 SMED_03255_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 476.863 bits (1226), Expect = 2.270e-153
Identity = 259/562 (46.09%), Postives = 370/562 (65.84%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YL ++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  306 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 865          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 476.863 bits (1226), Expect = 2.998e-153
Identity = 259/562 (46.09%), Postives = 370/562 (65.84%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YL ++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 875          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 476.863 bits (1226), Expect = 2.998e-153
Identity = 259/562 (46.09%), Postives = 370/562 (65.84%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YL ++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 875          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 476.863 bits (1226), Expect = 2.998e-153
Identity = 259/562 (46.09%), Postives = 370/562 (65.84%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YL ++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 875          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 476.863 bits (1226), Expect = 2.998e-153
Identity = 259/562 (46.09%), Postives = 370/562 (65.84%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YL ++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 875          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 427.557 bits (1098), Expect = 4.168e-135
Identity = 236/576 (40.97%), Postives = 359/576 (62.33%), Query Frame = 1
Query:  817 ESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPP--YRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKE----YSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRN 2526
            E D   WT V+     EK    F+  EE+T + ++KK+++++  R  +   R      L +L ++  ++  G G  +K+     S L + N K +  ++ E +   +  V++LLD+L+             EE ENL D    YR+ G I+   + +D E  KILQN D  + DYIEKL+ E  +  L  K  +Y+E++     +  +++C+ Y+ ++EH YY++           D    ++ + M  LC  I + D   RLR RAMLCH+YYLA+HD W+ ARD++ MS +Q  +D SD  TQILYNR   QLGLCAFR GFI+++HQ L+++Q + R KELLAQ +   ++E+T ++E  +++R +PYH HIN+ELMECVYL+ +ML ++ H  +   + RRRM+SR+FH+ LK SE+ +L G PE  R+HVVAASKA+  GDW+     IVN KMN KVW+LFH +  VK M++ +I+ E+LRT+LL +S++  ++SL  L   F+L  K +H IISKMI+ +EL A+L++PT+CLIMHR EPS+LQ +AL L++++  L E NE+++E R 
Sbjct:  275 EDDDADWTPVN----REKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDHMEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYA-EEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSNDYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKY----------QDQNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQVPYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQILEPRT 835          

HSP 2 Score: 98.5969 bits (244), Expect = 1.136e-20
Identity = 57/130 (43.85%), Postives = 89/130 (68.46%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGV--PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETD--IKLFRENPE 492
            +  EEDEKRVVR+ K K+++EL+ IIK  ++ K N+D+N +L  F+ L K +DK+K +   + V  P+FYIR++ E+ED++N LWD+   K  L+KNN K+L  LRQ+L+KY K+ +    +  +R NP+
Sbjct:   41 AGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 427.557 bits (1098), Expect = 4.168e-135
Identity = 236/576 (40.97%), Postives = 359/576 (62.33%), Query Frame = 1
Query:  817 ESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPP--YRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKE----YSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRN 2526
            E D   WT V+     EK    F+  EE+T + ++KK+++++  R  +   R      L +L ++  ++  G G  +K+     S L + N K +  ++ E +   +  V++LLD+L+             EE ENL D    YR+ G I+   + +D E  KILQN D  + DYIEKL+ E  +  L  K  +Y+E++     +  +++C+ Y+ ++EH YY++           D    ++ + M  LC  I + D   RLR RAMLCH+YYLA+HD W+ ARD++ MS +Q  +D SD  TQILYNR   QLGLCAFR GFI+++HQ L+++Q + R KELLAQ +   ++E+T ++E  +++R +PYH HIN+ELMECVYL+ +ML ++ H  +   + RRRM+SR+FH+ LK SE+ +L G PE  R+HVVAASKA+  GDW+     IVN KMN KVW+LFH +  VK M++ +I+ E+LRT+LL +S++  ++SL  L   F+L  K +H IISKMI+ +EL A+L++PT+CLIMHR EPS+LQ +AL L++++  L E NE+++E R 
Sbjct:  275 EDDDADWTPVN----REKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDHMEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYA-EEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSNDYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKY----------QDQNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQVPYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQILEPRT 835          

HSP 2 Score: 98.5969 bits (244), Expect = 1.136e-20
Identity = 57/130 (43.85%), Postives = 89/130 (68.46%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGV--PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETD--IKLFRENPE 492
            +  EEDEKRVVR+ K K+++EL+ IIK  ++ K N+D+N +L  F+ L K +DK+K +   + V  P+FYIR++ E+ED++N LWD+   K  L+KNN K+L  LRQ+L+KY K+ +    +  +R NP+
Sbjct:   41 AGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 427.557 bits (1098), Expect = 4.168e-135
Identity = 236/576 (40.97%), Postives = 359/576 (62.33%), Query Frame = 1
Query:  817 ESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPP--YRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKE----YSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRN 2526
            E D   WT V+     EK    F+  EE+T + ++KK+++++  R  +   R      L +L ++  ++  G G  +K+     S L + N K +  ++ E +   +  V++LLD+L+             EE ENL D    YR+ G I+   + +D E  KILQN D  + DYIEKL+ E  +  L  K  +Y+E++     +  +++C+ Y+ ++EH YY++           D    ++ + M  LC  I + D   RLR RAMLCH+YYLA+HD W+ ARD++ MS +Q  +D SD  TQILYNR   QLGLCAFR GFI+++HQ L+++Q + R KELLAQ +   ++E+T ++E  +++R +PYH HIN+ELMECVYL+ +ML ++ H  +   + RRRM+SR+FH+ LK SE+ +L G PE  R+HVVAASKA+  GDW+     IVN KMN KVW+LFH +  VK M++ +I+ E+LRT+LL +S++  ++SL  L   F+L  K +H IISKMI+ +EL A+L++PT+CLIMHR EPS+LQ +AL L++++  L E NE+++E R 
Sbjct:  275 EDDDADWTPVN----REKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDHMEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYA-EEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSNDYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKY----------QDQNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQVPYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQILEPRT 835          

HSP 2 Score: 98.5969 bits (244), Expect = 1.136e-20
Identity = 57/130 (43.85%), Postives = 89/130 (68.46%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGV--PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETD--IKLFRENPE 492
            +  EEDEKRVVR+ K K+++EL+ IIK  ++ K N+D+N +L  F+ L K +DK+K +   + V  P+FYIR++ E+ED++N LWD+   K  L+KNN K+L  LRQ+L+KY K+ +    +  +R NP+
Sbjct:   41 AGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Fly
Match: eIF3c (gene:FBgn0034258 transcript:FBtr0086836)

HSP 1 Score: 462.611 bits (1189), Expect = 3.410e-148
Identity = 250/573 (43.63%), Postives = 374/573 (65.27%), Query Frame = 1
Query:  814 GESDVDG-WTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
             E D DG W  V      EK  ++FEK+ EI    VL K+ +I+  R  KR  R++Q ++L +L  I    N G    +K+  +  S +  YN K +  +K+E W  ++  V   +  LL    ++ +  +V EE E     P+ + GC +   E +DDE+ K+L+  D  + DY+ +L+ E  V +    + +Y E +  ++N+ CR YLRK+EH+YY+FD    K          S S   M  LC++I +KD TDR+RTRA+L HIY+ A+HD+W++ARD++ MS LQ++ID +D +T+ILYNR    LGLCAFR+G +KD+H  L DL  +G+ KELLAQG+ P R +ER+ ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ F+  L+SSERQ+LVG PE++R+HVVAA+KA+  G+WQ     IVN KMN+KVWDLF+ES  V++ML + IK E+LRT+L  +S++  S+S+  L + ++L +  +H IISKMI+ +ELMASL+DP+  + MHRSEPS+LQA+A++  ++V  L ++NE++ +++
Sbjct:  274 AEDDEDGEWETVVKGHVVEK-PKMFEKDAEIDVPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHNLGTAVSVKIHFNIISAIYDYNQKISEPMKLEHW-ALLLEVMQSMMKLLLANADIIMSESVAEEHEEYATSPFYVRGCPLAAVERLDDEFVKLLKECDPHSNDYVSRLKDEVNVVKTIELVLQYFE-RSGTNNERCRIYLRKIEHLYYKFDPEVLKKKRGELPATTSTSVDVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQGNVKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESDRVREMLTKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPVPKVHSIISKMIINEELMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMK 843          

HSP 2 Score: 119.013 bits (297), Expect = 5.987e-27
Identity = 73/133 (54.89%), Postives = 97/133 (72.93%), Query Frame = 1
Query:  109 VFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIE--GV-PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
             F+ SD EE+ KRVVRS K KRYE L +IIK ++NHKK +DI N L  FE LT+ + KA  +I  E  G+ P+FYIR +AELEDFIN++W++   +K L+KNN KSL TLRQ++RKY K++E D+  FRE P+
Sbjct:   30 AFQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLSRFREAPD 162          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Fly
Match: eIF3c (gene:FBgn0034258 transcript:FBtr0340269)

HSP 1 Score: 462.611 bits (1189), Expect = 3.410e-148
Identity = 250/573 (43.63%), Postives = 374/573 (65.27%), Query Frame = 1
Query:  814 GESDVDG-WTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
             E D DG W  V      EK  ++FEK+ EI    VL K+ +I+  R  KR  R++Q ++L +L  I    N G    +K+  +  S +  YN K +  +K+E W  ++  V   +  LL    ++ +  +V EE E     P+ + GC +   E +DDE+ K+L+  D  + DY+ +L+ E  V +    + +Y E +  ++N+ CR YLRK+EH+YY+FD    K          S S   M  LC++I +KD TDR+RTRA+L HIY+ A+HD+W++ARD++ MS LQ++ID +D +T+ILYNR    LGLCAFR+G +KD+H  L DL  +G+ KELLAQG+ P R +ER+ ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ F+  L+SSERQ+LVG PE++R+HVVAA+KA+  G+WQ     IVN KMN+KVWDLF+ES  V++ML + IK E+LRT+L  +S++  S+S+  L + ++L +  +H IISKMI+ +ELMASL+DP+  + MHRSEPS+LQA+A++  ++V  L ++NE++ +++
Sbjct:  274 AEDDEDGEWETVVKGHVVEK-PKMFEKDAEIDVPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHNLGTAVSVKIHFNIISAIYDYNQKISEPMKLEHW-ALLLEVMQSMMKLLLANADIIMSESVAEEHEEYATSPFYVRGCPLAAVERLDDEFVKLLKECDPHSNDYVSRLKDEVNVVKTIELVLQYFE-RSGTNNERCRIYLRKIEHLYYKFDPEVLKKKRGELPATTSTSVDVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQGNVKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESDRVREMLTKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPVPKVHSIISKMIINEELMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMK 843          

HSP 2 Score: 119.013 bits (297), Expect = 5.987e-27
Identity = 73/133 (54.89%), Postives = 97/133 (72.93%), Query Frame = 1
Query:  109 VFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIE--GV-PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
             F+ SD EE+ KRVVRS K KRYE L +IIK ++NHKK +DI N L  FE LT+ + KA  +I  E  G+ P+FYIR +AELEDFIN++W++   +K L+KNN KSL TLRQ++RKY K++E D+  FRE P+
Sbjct:   30 AFQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLSRFREAPD 162          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Zebrafish
Match: eif3c (eukaryotic translation initiation factor 3, subunit C [Source:NCBI gene;Acc:334234])

HSP 1 Score: 490.345 bits (1261), Expect = 1.692e-158
Identity = 275/591 (46.53%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQE----------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+ +I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  +   L  +L N NN+ +  N+ E+SENL   D P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E +V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY   +    L     SE  QE          M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F+LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  301 WEKVKG-GVPLVKEKPKMFAKGTEINTGVVVKKLSEILQARGKKGTDRAAQIELLHALAGIAAENNLGEGILVKIKFNIIASLYDYNPNLAAFMKADMWKKCLDCID-ELLDILFNNNNIFIGENIAEDSENLAISDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVCGIIDRLLQYLETKG-STEEVCRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGDDSAIIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAKCVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFELELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 885          

HSP 2 Score: 119.013 bits (297), Expect = 8.628e-27
Identity = 72/126 (57.14%), Postives = 99/126 (78.57%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
            SD EED KRVVRS K KR+EEL N+IK ++N  K RDI+  L +FE L + F K+K I+D EGVPKFYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ET+I  ++ENPE
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAIKIRDISKCLEEFEQLCRAFVKSKTIVDKEGVPKFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETEIASYKENPE 164          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Xenopus
Match: tnip1 (TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-945173])

HSP 1 Score: 478.404 bits (1230), Expect = 8.166e-154
Identity = 264/577 (45.75%), Postives = 376/577 (65.16%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNF------KWDESLSDHALSESYQE-----MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            W  V G G P  ++  ++F K  EIT   V+KK+++I+Q R  K   R  Q ++L  L  I  + N G G  +K+  +  + L  YN    + +K + W K + ++   L  +L   +N+ +  ++ E+SENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E +V E+  +  +YL+ K  S+ ++CR YLR++ H YY+FDY           ES S+   +E+  E     M  LC+YI +KD+TDR+RT A+LCHIY+ ALH+ W++ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G I+D+H AL D+Q SGR KELL QG+      ER +++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ MLI KI+ E+LRT+L  +SS+ DS+ +  L   F LEI  +H IISKMI+ +ELMASL+ PT  ++MH +EPS LQ  AL+LAE++  L E NER+ +
Sbjct:  303 WEKVKG-GVPLVKEKPKMFAKGTEITPPIVVKKLNEILQARGKKGTDRAAQIDLLHLLAGIAEENNLGQGIAVKIKFNIVASLYDYNTNLATYMKADMWKKCLDSIH-DLLDILFANSNMFIGEHISEDSENLSNTDQPLRVRGCILTLIERMDEEFTKIMQNTDPHSQEYVDNLKDEARVCEVIERAQKYLQEKG-STEEVCRVYLRRIMHTYYKFDYKAHQRQLSTGQESKSEQDQAENEAEDSAILMDRLCKYIYAKDRTDRIRTCAILCHIYHHALHNRWFQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIRDAHNALLDIQSSGRAKELLGQGLLMRTMQERNQEQEKIEKRRQIPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCKNFIINEKMNGKVWDLFPEAERVRSMLIRKIQEESLRTYLFTYSSVYDSIRMGILGDMFQLEIPTVHSIISKMIINEELMASLDQPTQTVVMHGTEPSSLQNTALQLAEKLGNLVENNERIFD 876          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Xenopus
Match: tnip1 (TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-945173])

HSP 1 Score: 474.167 bits (1219), Expect = 1.352e-152
Identity = 263/591 (44.50%), Postives = 375/591 (63.45%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNF-------------KWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            W  V G G P  ++  ++F K  EIT   V+KK+++I+Q R  K   R  Q ++L  L  I  + N G G  +K+  +  + L  YN    + +K + W K + ++   L  +L   +N+ +  ++ E+SENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E +V E+  +  +YL+ K  S+ ++CR YLR++ H YY+FDY                +D    D  +S   Q+            M  LC+YI +KD+TDR+RT A+LCHIY+ ALH+ W++ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G I+D+H AL D+Q SGR KELL QG+      ER +++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ MLI KI+ E+LRT+L  +SS+ DS+ +  L   F LEI  +H IISKMI+ +ELMASL+ PT  ++MH +EPS LQ  AL+LAE++  L E NER+ +
Sbjct:  267 WEKVKG-GVPLVKEKPKMFAKGTEITPPIVVKKLNEILQARGKKGTDRAAQIDLLHLLAGIAEENNLGQGIAVKIKFNIVASLYDYNTNLATYMKADMWKKCLDSIH-DLLDILFANSNMFIGEHISEDSENLSNTDQPLRVRGCILTLIERMDEEFTKIMQNTDPHSQEYVDNLKDEARVCEVIERAQKYLQEKG-STEEVCRVYLRRIMHTYYKFDYKAHQRQLSTGQEGLSTYDGRKGDEIISRRKQDQAENEAEDSAILMDRLCKYIYAKDRTDRIRTCAILCHIYHHALHNRWFQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIRDAHNALLDIQSSGRAKELLGQGLLMRTMQERNQEQEKIEKRRQIPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCKNFIINEKMNGKVWDLFPEAERVRSMLIRKIQEESLRTYLFTYSSVYDSIRMGILGDMFQLEIPTVHSIISKMIINEELMASLDQPTQTVVMHGTEPSSLQNTALQLAEKLGNLVENNERIFD 854          

HSP 2 Score: 115.546 bits (288), Expect = 1.229e-25
Identity = 70/126 (55.56%), Postives = 97/126 (76.98%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L K F KAK I+D EGVP+FYIR +++LED++N+LW++ +  K +NKNN K+L+TLRQ+LRKYN+++E  I  +++NPE
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMTKCLEEFEQLGKAFIKAKNIVDKEGVPRFYIRLLSDLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKLRKYNRDFEAPIAAYKQNPE 164          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Mouse
Match: Eif3c (eukaryotic translation initiation factor 3, subunit C [Source:MGI Symbol;Acc:MGI:1926966])

HSP 1 Score: 476.863 bits (1226), Expect = 1.951e-153
Identity = 261/563 (46.36%), Postives = 370/563 (65.72%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMC-NVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W   MC +    L   L   +N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ +IC+ YLR++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  314 KMFAKGTEITHAVVIKKLNEILQVRGKKGTDRATQIELLQLLVQIAAENNLGVGVIVKIKFNIIASLYDYNPNLATYMKPEMWQ--MCLDCINELMDTLVAHSNIFVGENILEESENLHNFDQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEICQIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 873          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Mouse
Match: Eif3c (eukaryotic translation initiation factor 3, subunit C [Source:MGI Symbol;Acc:MGI:1926966])

HSP 1 Score: 114.005 bits (284), Expect = 1.150e-27
Identity = 67/126 (53.17%), Postives = 99/126 (78.57%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
            S+ EED KRVVRS K KR+EEL N+I+ ++N  K RD+   L +FE+L K + KAK I+D EGVP+FYIR +A+LED++N+LW++ +  K +NKNN K+L+TLRQ++RKYN+++E+ I  +++NPE
Sbjct:   39 SEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPE 164          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Match: sp|Q6PFQ2|EIF3C_DANRE (Eukaryotic translation initiation factor 3 subunit C OS=Danio rerio OX=7955 GN=eif3c PE=1 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 1.078e-157
Identity = 275/591 (46.53%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQE----------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+ +I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  +   L  +L N NN+ +  N+ E+SENL   D P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E +V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY   +    L     SE  QE          M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F+LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  301 WEKVKG-GVPLVKEKPKMFAKGTEINTGVVVKKLSEILQARGKKGTDRAAQIELLHALAGIAAENNLGEGILVKIKFNIIASLYDYNPNLAAFMKADMWKKCLDCID-ELLDILFNNNNIFIGENIAEDSENLAISDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVCGIIDRLLQYLETKG-STEEVCRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGDDSAIIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAKCVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFELELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 885          

HSP 2 Score: 116.701 bits (291), Expect = 3.553e-25
Identity = 71/126 (56.35%), Postives = 98/126 (77.78%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
            SD EED KRVVRS K KR+EEL N+IK ++N  K R I+  L +FE L + F K+K I+D EGVPKFYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ET+I  ++ENPE
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAIKIRGISKCLEEFEQLCRAFVKSKTIVDKEGVPKFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETEIASYKENPE 164          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Match: sp|Q17Q06|EIF3C_AEDAE (Eukaryotic translation initiation factor 3 subunit C OS=Aedes aegypti OX=7159 GN=eIF3-S8 PE=3 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 1.410e-157
Identity = 258/574 (44.95%), Postives = 387/574 (67.42%), Query Frame = 1
Query:  814 GESDVDGWTAVDGS-GKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNF--KWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
             E D +GW  V+G+     +  ++F K+ EI    V+ K+++++  R  KR  R++Q E L +L  I    N G     K+  +  S +  YN K +  +K+E W+K++  + AL+ +LL N + V  +  + EE+E     PY++ GCI+   E +DDE+TK+L+  D  + DY+++L+ E  V  +  ++ +Y+E +  +  + CR YLRK++H+YY+FD N   K  + L    L+ S  EM  LCR++ +KDQTDRLRTRA+L HI++ ALHD+W++ARD++ MS LQ +I  SD  TQILYNR    LGLCAFR G +KD+HQ L DL  +G+ KELLAQG+ P R  ER+ ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ F+  L+SSERQ+LVG PE++R+HVVAA+KA+  G+W      IVN KMN KVWDLF+E+  V++MLI+ IK E+LRT+L  +S++  S+S+ +L + F+L    +H +ISKMI+ +ELMASL+DPT  +++HRSEPS+LQA++++L+++V  L + NER+ E++
Sbjct:  275 AEDDDEGWEVVNGNRSTSAEQPKMFAKDAEIDVNVVINKLNEVMAARGKKRTDRKLQIEFLRELRTIADTHNLGDAVAAKIRFNIVSAIFDYNPKVSEPMKLEHWSKLLEEIQALIKLLLANDDIVLSETIL-EENEEYETAPYKIRGCILTAVERLDDEFTKLLKECDPHSNDYVDRLKDEVTVSSVIEQVVKYIE-RLGNDTETCRVYLRKIDHLYYKFDPNVLKKKKKELPASTLT-SVDEMDRLCRFVYAKDQTDRLRTRAILSHIFHHALHDNWFQARDLVLMSHLQETIHHSDPPTQILYNRTMANLGLCAFRHGNVKDAHQCLVDLMMTGKPKELLAQGLVPQRQNERSLEQEKVEKQRQMPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRHGNWNACSTFIVNKKMNVKVWDLFYEADRVREMLIKFIKEESLRTYLFTYSNVYASISVPYLAEMFELPKSKVHSLISKMIINEELMASLDDPTETVVLHRSEPSRLQALSMQLSDKVTNLVDSNERIFEMK 845          

HSP 2 Score: 112.079 bits (279), Expect = 8.337e-24
Identity = 73/131 (55.73%), Postives = 99/131 (75.57%), Query Frame = 1
Query:  112 FESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIID-IE-GV-PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            F  SD EED KRVVRS K KRYE+L NIIKN++N+KK +D++++L  FE LT+   KA  +I  +E GV P+F IR +AELEDFIN +W++   +K L+KNN KSL TLRQ+ RKY K++++D+K FRE+P
Sbjct:   31 FTFSDEEEDVKRVVRSTKEKRYEDLSNIIKNIRNYKKIKDMSSMLTSFEELTRAHTKALPVITKVENGVTPRFIIRALAELEDFINMVWEDKEGRKNLSKNNSKSLGTLRQKFRKYIKDFDSDLKKFRESP 161          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Match: sp|B0W0S3|EIF3C_CULQU (Eukaryotic translation initiation factor 3 subunit C OS=Culex quinquefasciatus OX=7176 GN=eIF3-S8 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 5.770e-157
Identity = 263/579 (45.42%), Postives = 388/579 (67.01%), Query Frame = 1
Query:  817 ESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLD-------PPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNF--KWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
            + D +GW +   S KP    ++F K+ EI    V+ K+++++  R  KR  R++Q E L +L  I  ++  G     K+  +  S +  YN K +  +K+E W+K++  + AL+ +LL N + V         SEN+LD        PY++ GC++   E +DDE+TK+L+  D  + +Y+++L+ E  V  +  ++ +Y+E +  +  + CR YLRK++H+YY+FD N   K    L   +L+ S  EM+ LCR+I +KDQTDRLRTRA+L HI++ ALHD+W++ARD++ MS LQ +I  SD  TQILYNR    LGLCAFR G IKD+HQ L DL  +G+ KELLAQG+ P R  ER+ ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ F+  L+SSERQ+LVG PE++R+HVVAA+KA+  GDWQ     IVN KMN KVWDLF+E+  V++ML + IK EALRT+L  +S++  S+S+ +L + FDL    +H +ISKMI+ +ELMASL+DPT  +++HRSEPS+LQA++++LA++V  L + NER+ E++
Sbjct:  276 DDDDEGWESSATSEKP----KMFAKDAEIDVALVVNKLNEVMAARGKKRTDRKLQIEFLRELRAISEEKKLGAAVAAKIRFNIVSAIFDYNPKVSEPMKLEHWSKLLEEIQALIKLLLANEDIVL--------SENILDENEEYDTAPYKIRGCMLTAVERLDDEFTKLLKECDPHSNEYVDRLKDEVTVTNVIEQVVQYVE-RLGNEMETCRIYLRKIDHLYYKFDPNVLKKRKAQLPASSLT-SVDEMERLCRFIYAKDQTDRLRTRAILSHIFHHALHDNWFQARDLVLMSHLQETIHHSDPPTQILYNRTMANLGLCAFRHGNIKDAHQCLVDLMMTGKPKELLAQGLVPQRQNERSLEQEKVEKQRQMPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRHGDWQACSNFIVNKKMNVKVWDLFYEADRVREMLAKFIKEEALRTYLFTYSNVYASISVPYLAEMFDLPKSKVHSLISKMIINEELMASLDDPTETVVLHRSEPSRLQALSMQLADKVTNLVDSNERVFEMK 840          

HSP 2 Score: 117.087 bits (292), Expect = 2.149e-25
Identity = 72/131 (54.96%), Postives = 99/131 (75.57%), Query Frame = 1
Query:  112 FESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIE--GV-PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            F  SD EED KRVVRS K KRYE+L NIIK+++N+KK +D++++L  FE LT+ + KA  +I  E  GV P+F IR +AELEDFIN++WD+   +K L+KNN KSL  LRQ+ RKY K++++D+K FRE+P
Sbjct:   30 FTFSDEEEDVKRVVRSTKEKRYEDLSNIIKSIRNYKKIKDMSSLLSSFEDLTRAYAKALPVITKEENGVCPRFIIRALAELEDFINEVWDDREGRKNLSKNNSKSLGALRQKFRKYIKDFDSDLKKFRESP 160          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Match: sp|Q7PMU8|EIF3C_ANOGA (Eukaryotic translation initiation factor 3 subunit C OS=Anopheles gambiae OX=7165 GN=eIF3-S8 PE=3 SV=3)

HSP 1 Score: 486.493 bits (1251), Expect = 9.664e-156
Identity = 258/576 (44.79%), Postives = 387/576 (67.19%), Query Frame = 1
Query:  832 GWTAVDG--SGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLD-------PPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNF--KWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
            GW  V+G  SG  E+  ++F K+ EI  + V+ K+++++  R  KR  R++Q E L +L  +    N GP   +K+  +  S +  YN K +  +K+E W+K++  +  LL +LL + +           SE++LD        P+++ GC++   E +DDE+TK+L+  D  + +Y+++L+ E  V  +  ++  Y+E +  +  +ICR YLRK++H+YY+FD +   K    L  + ++ S +EM  LCRYI +KDQTDRLRTRA+L HI++ ALHD+W++ARD++ MS LQ +I  SD +TQILYNR    LGLCAFR G IKD+H  L DL  +G+ KELLAQG+ P R +ER+ ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ F+  L+SSERQ+LVG PE++R+HVVAA+KA+  GDW      IVN KMN KVWDLF+E++ V++M+I+ IK E+LRT+L  +S++  S+S+  L   F L    +H +ISKMI+ +ELMASL+DPT  ++MHRSEPS+LQA++++LA++V  L + NER+ E++
Sbjct:  298 GWKVVNGTRSGASEQ-PKMFAKDAEIDTKLVVNKLNEVMAARGKKRTDRKMQIEFLRELRTVAETNNLGPAVAVKIRFNIVSAIFDYNPKVSGAMKLEHWSKLLEEIQELLKLLLAHEDVHL--------SESILDEYEEYDTAPFKIRGCMLTAVERLDDEFTKLLKECDPHSNEYVDRLKDEVPVTNIIEQVVTYVE-RLGNEMEICRIYLRKIDHLYYKFDPDVLKKRKGQLPANTIT-SVEEMDKLCRYIYAKDQTDRLRTRAILSHIFHHALHDNWFQARDLVLMSHLQETIHHSDPATQILYNRMMANLGLCAFRHGNIKDAHLCLVDLMMTGKPKELLAQGLVPQRQHERSLEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRHGDWNACANFIVNKKMNVKVWDLFYEANRVREMMIKFIKEESLRTYLFTYSNVFASISVPHLADMFKLPKSKVHSLISKMIINEELMASLDDPTETIVMHRSEPSRLQALSMQLADKVTNLVDANERIFEMK 862          

HSP 2 Score: 107.842 bits (268), Expect = 1.913e-22
Identity = 68/131 (51.91%), Postives = 94/131 (71.76%), Query Frame = 1
Query:  112 FESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIE--GV-PKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            F  SD EED KRVVRS K KRYE+L NIIK+++NHKK +D+++VL  FE   + + KA  ++  E  GV P+  +R +AELEDF+N+ WD+   +K L+KNN K+L TLRQ+ RKY K++E+D+K FR  P
Sbjct:   30 FTFSDEEEDVKRVVRSKKEKRYEDLSNIIKSIRNHKKIKDMSSVLTSFEEFMRAYTKALPVVMKEENGVTPRIVVRALAELEDFVNESWDDKESRKNLSKNNNKALGTLRQKFRKYIKDFESDMKRFRAAP 160          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Match: sp|Q3SYW6|EIF3C_BOVIN (Eukaryotic translation initiation factor 3 subunit C OS=Bos taurus OX=9913 GN=EIF3C PE=2 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 3.763e-153
Identity = 260/562 (46.26%), Postives = 371/562 (66.01%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENL--LDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQE------------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRY-ERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            ++F K  EIT   V+KK+++I+Q R  K   R  Q E+L+ L +I  + N G G  +K+  +  + L  YN    + +K E W K +  ++  L  +L    N+ +  N+LEESENL   D P R+ GCI+ L E MD+E+TKI+QN D  + +Y+E L+ E +V  +  ++ RYLE K  ++ ++CR YLR++ H YY+FDY     +       S+S Q+            M+ LC+YI +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G  KD+H AL D+Q SGR KELL QG+      ER +++E  E+ R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMN KVWDLF E+  V+ ML+ KI+ E+LRT+L  +SS+ DS+S+  L   F+L++  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+  Q +AL+LAE++  L E NER+ +
Sbjct:  315 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIASENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWQKCLDCIN-ELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFD 874          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Match: E2F3W6 (Eukaryotic translation initiation factor 3 subunit C (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 1
Query: 1231 DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 2565
            DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT
Sbjct:    2 DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 446          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Match: A0A1S3IPT5 (Eukaryotic translation initiation factor 3 subunit C OS=Lingula unguis OX=7574 GN=LOC106166059 PE=3 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 370/832 (44.47%), Postives = 536/832 (64.42%), Query Frame = 1
Query:  106 RVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQ-----------------------EIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            + F  SD EED KRVVRS K KRYEE+ NIIK LKNHKK +D++NVL DFE L + +DKAKK+++ EG+P+FY+R + ELEDF+++ W++   +K L+KNN KSL TLRQ+L+KYN+++E  I  +RENP+   E+                          ++  +  ++     P++     D      E+S  ESDWGD S  SS    + ++ Y  N A +FLKKT E+   KK  +KKE ++ ++ K+  + Q    + D   W  V G G P   +  ++F K+ EI  + V  K+ +I+  R  K   R  Q  ML +L+ I  + N GP  + K++ +  + L  YN    +C++ E W + +  V   L  LL     +++  ++ EESE L   PY + GCI+ + E MD+E+TK+LQ  DA + +Y+E+L+ E KV ++  +L  YLE +  S+ ++CRAYL+K++H+YY++       E +S      S + M++LCR+I +KDQTDR+RT A+LC IY+ A+HD WY+ARD+M MS LQ++I  SD   QILYNRA VQLGLCAFR+G IKD+H  L D+Q  GR KELLAQG+   R +ERT ++E  EK R +PYH HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+NFHHV++ SER  LVG PE++R+H+VAASKA+ VGDW+      +N KMN KVWDLF  ++   +M++ KI+ E+LRT+L  +SS+ DSLS+  + + F+L    +H IISKMI+ +ELMASL++PT  ++MHR+EP++LQ++AL+LAE+V  L E NER++E
Sbjct:   34 QAFTFSDDEEDTKRVVRSAKDKRYEEIRNIIKQLKNHKKIKDMSNVLSDFEDLGRAYDKAKKVVEKEGIPRFYLRALVELEDFVSECWEDREARKQLSKNNAKSLTTLRQKLKKYNRDFEQGISDYRENPDQDEEEEGSDDEERDSDEEEEDDDDDKDENDTQMIADFIKKPPPSKPNVSKFLKDGD----EDSGDESDWGDESDESSELSSDDEK-YGGNLALKFLKKTTEQEKAKKDAKKKEVKERKQTKKVDKAQ----DEDEGEWEQVKG-GAPMIAEKPKMFGKDVEINHKVVCMKLIEIVAARGKKGTDRNEQINMLIELNSIASENNLGPAMEAKIMFNIAAALFDYNPNIATCMRAEMWERCIEFV-LELLNLLITNKEISVGEDITEESEQLEVAPYLVRGCILTVVERMDEEFTKMLQGCDAHSTEYVERLRDEKKVCDIIDRLVVYLEGRS-SNEELCRAYLKKIQHLYYKY-------EPVSPEGQKNSEEVMETLCRFIHTKDQTDRIRTNAILCQIYHHAIHDRWYQARDLMMMSHLQDTIHHSDVPLQILYNRAMVQLGLCAFRQGMIKDAHHCLVDIQSGGRAKELLAQGLLLQRQHERTPEQEKIEKRRQMPYHMHINLELLECVYLVSAMLMEIPYMAAHEFDARRRMISKNFHHVMRVSERNPLVGPPESMREHIVAASKAMKVGDWKACRDYAINEKMNKKVWDLFQNTAETCEMIVSKIQEESLRTYLFTYSSVYDSLSMDNMAEMFELPKATVHSIISKMIINEELMASLDEPTQTVVMHRTEPTRLQSLALQLAEKVATLVENNERIME 846          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Match: A0A1S3INV3 (Eukaryotic translation initiation factor 3 subunit C OS=Lingula unguis OX=7574 GN=LOC106166059 PE=3 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 370/832 (44.47%), Postives = 536/832 (64.42%), Query Frame = 1
Query:  106 RVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQ-----------------------EIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            + F  SD EED KRVVRS K KRYEE+ NIIK LKNHKK +D++NVL DFE L + +DKAKK+++ EG+P+FY+R + ELEDF+++ W++   +K L+KNN KSL TLRQ+L+KYN+++E  I  +RENP+   E+                          ++  +  ++     P++     D      E+S  ESDWGD S  SS    + ++ Y  N A +FLKKT E+   KK  +KKE ++ ++ K+  + Q    + D   W  V G G P   +  ++F K+ EI  + V  K+ +I+  R  K   R  Q  ML +L+ I  + N GP  + K++ +  + L  YN    +C++ E W + +  V   L  LL     +++  ++ EESE L   PY + GCI+ + E MD+E+TK+LQ  DA + +Y+E+L+ E KV ++  +L  YLE +  S+ ++CRAYL+K++H+YY++       E +S      S + M++LCR+I +KDQTDR+RT A+LC IY+ A+HD WY+ARD+M MS LQ++I  SD   QILYNRA VQLGLCAFR+G IKD+H  L D+Q  GR KELLAQG+   R +ERT ++E  EK R +PYH HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+NFHHV++ SER  LVG PE++R+H+VAASKA+ VGDW+      +N KMN KVWDLF  ++   +M++ KI+ E+LRT+L  +SS+ DSLS+  + + F+L    +H IISKMI+ +ELMASL++PT  ++MHR+EP++LQ++AL+LAE+V  L E NER++E
Sbjct:   34 QAFTFSDDEEDTKRVVRSAKDKRYEEIRNIIKQLKNHKKIKDMSNVLSDFEDLGRAYDKAKKVVEKEGIPRFYLRALVELEDFVSECWEDREARKQLSKNNAKSLTTLRQKLKKYNRDFEQGISDYRENPDQDEEEEGSDDEERDSDEEEEDDDDDKDENDTQMIADFIKKPPPSKPNVSKFLKDGD----EDSGDESDWGDESDESSELSSDDEK-YGGNLALKFLKKTTEQEKAKKDAKKKEVKERKQTKKVDKAQ----DEDEGEWEQVKG-GAPMIAEKPKMFGKDVEINHKVVCMKLIEIVAARGKKGTDRNEQINMLIELNSIASENNLGPAMEAKIMFNIAAALFDYNPNIATCMRAEMWERCIEFV-LELLNLLITNKEISVGEDITEESEQLEVAPYLVRGCILTVVERMDEEFTKMLQGCDAHSTEYVERLRDEKKVCDIIDRLVVYLEGRS-SNEELCRAYLKKIQHLYYKY-------EPVSPEGQKNSEEVMETLCRFIHTKDQTDRIRTNAILCQIYHHAIHDRWYQARDLMMMSHLQDTIHHSDVPLQILYNRAMVQLGLCAFRQGMIKDAHHCLVDIQSGGRAKELLAQGLLLQRQHERTPEQEKIEKRRQMPYHMHINLELLECVYLVSAMLMEIPYMAAHEFDARRRMISKNFHHVMRVSERNPLVGPPESMREHIVAASKAMKVGDWKACRDYAINEKMNKKVWDLFQNTAETCEMIVSKIQEESLRTYLFTYSSVYDSLSMDNMAEMFELPKATVHSIISKMIINEELMASLDEPTQTVVMHRTEPTRLQSLALQLAEKVATLVENNERIME 846          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Match: A0A2R2MJG1 (Eukaryotic translation initiation factor 3 subunit C OS=Lingula unguis OX=7574 GN=LOC106166059 PE=3 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 370/832 (44.47%), Postives = 536/832 (64.42%), Query Frame = 1
Query:  106 RVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQ-----------------------EIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIE 2517
            + F  SD EED KRVVRS K KRYEE+ NIIK LKNHKK +D++NVL DFE L + +DKAKK+++ EG+P+FY+R + ELEDF+++ W++   +K L+KNN KSL TLRQ+L+KYN+++E  I  +RENP+   E+                          ++  +  ++     P++     D      E+S  ESDWGD S  SS    + ++ Y  N A +FLKKT E+   KK  +KKE ++ ++ K+  + Q    + D   W  V G G P   +  ++F K+ EI  + V  K+ +I+  R  K   R  Q  ML +L+ I  + N GP  + K++ +  + L  YN    +C++ E W + +  V   L  LL     +++  ++ EESE L   PY + GCI+ + E MD+E+TK+LQ  DA + +Y+E+L+ E KV ++  +L  YLE +  S+ ++CRAYL+K++H+YY++       E +S      S + M++LCR+I +KDQTDR+RT A+LC IY+ A+HD WY+ARD+M MS LQ++I  SD   QILYNRA VQLGLCAFR+G IKD+H  L D+Q  GR KELLAQG+   R +ERT ++E  EK R +PYH HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+NFHHV++ SER  LVG PE++R+H+VAASKA+ VGDW+      +N KMN KVWDLF  ++   +M++ KI+ E+LRT+L  +SS+ DSLS+  + + F+L    +H IISKMI+ +ELMASL++PT  ++MHR+EP++LQ++AL+LAE+V  L E NER++E
Sbjct:   34 QAFTFSDDEEDTKRVVRSAKDKRYEEIRNIIKQLKNHKKIKDMSNVLSDFEDLGRAYDKAKKVVEKEGIPRFYLRALVELEDFVSECWEDREARKQLSKNNAKSLTTLRQKLKKYNRDFEQGISDYRENPDQDEEEEGSDDEERDSDEEEEDDDDDKDENDTQMIADFIKKPPPSKPNVSKFLKDGD----EDSGDESDWGDESDESSELSSDDEK-YGGNLALKFLKKTTEQEKAKKDAKKKEVKERKQTKKVDKAQ----DEDEGEWEQVKG-GAPMIAEKPKMFGKDVEINHKVVCMKLIEIVAARGKKGTDRNEQINMLIELNSIASENNLGPAMEAKIMFNIAAALFDYNPNIATCMRAEMWERCIEFV-LELLNLLITNKEISVGEDITEESEQLEVAPYLVRGCILTVVERMDEEFTKMLQGCDAHSTEYVERLRDEKKVCDIIDRLVVYLEGRS-SNEELCRAYLKKIQHLYYKY-------EPVSPEGQKNSEEVMETLCRFIHTKDQTDRIRTNAILCQIYHHAIHDRWYQARDLMMMSHLQDTIHHSDVPLQILYNRAMVQLGLCAFRQGMIKDAHHCLVDIQSGGRAKELLAQGLLLQRQHERTPEQEKIEKRRQMPYHMHINLELLECVYLVSAMLMEIPYMAAHEFDARRRMISKNFHHVMRVSERNPLVGPPESMREHIVAASKAMKVGDWKACRDYAINEKMNKKVWDLFQNTAETCEMIVSKIQEESLRTYLFTYSSVYDSLSMDNMAEMFELPKATVHSIISKMIINEELMASLDEPTQTVVMHRTEPTRLQSLALQLAEKVATLVENNERIME 846          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Match: A0A087T8C8 (Eukaryotic translation initiation factor 3 subunit C (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_18899 PE=3 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 378/856 (44.16%), Postives = 548/856 (64.02%), Query Frame = 1
Query:  109 VFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIE---GVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEI--DEEAAVECPHLEDRKHDQKYQKVEESESESD----------------WGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKP---EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLS-----------------------DHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIR 2523
             F  SD EE+ KRVVRS + KRYEEL  IIK +KNHKK +D++ +   FE LT+ F KA+ +I+ E    +PKFYIR + ELEDFI D W++   +K ++KNN K LATLRQ+LRKYNK++ET+I  +R+NP+   E+   E + E   DEE AV+          +K QK E+ E +S                 WG +S   SS   +  E Y  N A +FLK+  EK  +K+  ++++K  +ER       +    + D +GW  V G G P   EK  ++F K+ EI  + VLKK ++I+  R  K   R  Q ++L +L  +    N G G  +K++ +  + +  YN    +C+K + W K +  ++ +L  +L    N+ +  ++ EESE L+ PPYR+ GC + + E MD+E+TK+LQ  DA +P+Y+E+L+ ET V  +  +L  YLE +   S ++CR YLR++EH+YY+FD   FK  E +                              S   +  LC++I +KD TDR+RT+A L  IY+LALHD W+ ARD++ MS LQN+I+ SD +T I+YNRA VQLGLCAFR GFIKD+H AL D+Q  GR KELLAQG+ P R +ERT D+E  EK R +P+H+HINLEL+ECVYLVSAML ++ +   H  +GRRRMIS++FHH L++SERQ LVG PE++R+HVVAASKA+ VG+W+     I+N KMNSKVWDLFH++  V++M+ +KI+ EALRT+L  +SS  DSLS++ L + F+L+  ++H I+ KMI+ +ELMASL++PT  +I+HR+EPS++QA++L+LA++V+ L E NERL++++
Sbjct:   33 AFTFSDEEEETKRVVRSAREKRYEELIEIIKLIKNHKKIKDMSKLWTSFENLTRAFTKARPVIEKEENGNIPKFYIRCLVELEDFITDCWEDKEGRKNMSKNNSKFLATLRQKLRKYNKDFETEIANYRKNPDAEDEEREDEEEQESGDDEEKAVD--------FFKKPQKAEKEEPKSKLLKGSDDDESDDDSIDWGSSSEEESSLSTD-DEKYGGNLATKFLKRPGEKDEQKEITKREKKRDKER-------RERKRDDDDEGWEEVKG-GAPIIMEK-PKMFAKDAEINHQVVLKKFNEILAARGKKGTDRSEQIDLLIELLNVCEAHNLGSGILLKIMFAIIAAIFDYNPNIATCMKGDMWQKCLDYIN-MLLDILIENPNIVVGEHIAEESEQLITPPYRVKGCCLTVVERMDEEFTKMLQGCDAHSPEYVERLKDETVVCNIIERLQNYLEGRGTPS-ELCRIYLRRIEHLYYKFDTRVFKKKEKMGYSTAFNGTVNGTINGNVPAENDEKEEEETSADIITKLCKFICAKDTTDRIRTQATLFRIYHLALHDEWFHARDLLLMSHLQNTIEHSDITTMIIYNRALVQLGLCAFRHGFIKDAHAALLDIQSGGRAKELLAQGLLPQRQHERTPDQEKIEKRRQIPFHKHINLELLECVYLVSAMLLEIPYMAAHELEGRRRMISKSFHHQLRNSERQALVGPPESMREHVVAASKAMRVGNWKACKDYIINEKMNSKVWDLFHQAEKVREMISQKIQEEALRTYLFTYSSYYDSLSVARLSEMFELDKGVVHSILCKMIINEELMASLDEPTQSVILHRTEPSRIQALSLQLADKVSSLVEQNERLMDLK 868          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 484.567 bits (1246), Expect = 2.733e-156
Identity = 274/591 (46.36%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFK------WDESLSDHALSESYQE-----MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  ++  L  +L   NN+ +  N+ E+SENL   + P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E  V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY           ES S+    ES  E     M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  302 WEKVKG-GVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLATFMKPDMWKKCLDCIN-ELLDILFGNNNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 886          

HSP 2 Score: 115.161 bits (287), Expect = 9.798e-26
Identity = 70/125 (56.00%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP+FYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ETDI  ++ENP
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKENP 163          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 484.567 bits (1246), Expect = 2.733e-156
Identity = 274/591 (46.36%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFK------WDESLSDHALSESYQE-----MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  ++  L  +L   NN+ +  N+ E+SENL   + P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E  V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY           ES S+    ES  E     M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  302 WEKVKG-GVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLATFMKPDMWKKCLDCIN-ELLDILFGNNNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 886          

HSP 2 Score: 115.161 bits (287), Expect = 9.798e-26
Identity = 70/125 (56.00%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP+FYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ETDI  ++ENP
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKENP 163          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 483.797 bits (1244), Expect = 8.065e-156
Identity = 274/591 (46.36%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFK------WDESLSDHALSESYQE-----MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  ++  L  +L   NN+ +  N+ E+SENL   + P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E  V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY           ES S+    ES  E     M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  302 WEKVKG-GVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLATFMKPDMWKKCLDCIN-ELLDILFGNNNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 886          

HSP 2 Score: 115.161 bits (287), Expect = 1.188e-25
Identity = 70/125 (56.00%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP+FYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ETDI  ++ENP
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKENP 163          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 483.797 bits (1244), Expect = 1.170e-155
Identity = 274/591 (46.36%), Postives = 385/591 (65.14%), Query Frame = 1
Query:  835 WTAVDGSGKP--EKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFK------WDESLSDHALSESYQE-----MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            W  V G G P  ++  ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  ++  L  +L   NN+ +  N+ E+SENL   + P+R+ GCI+ L E MD+E+TKI+QN D  + +Y++ L+ E  V  +  +L +YLE K  S+ ++CR YLR++ H YY+FDY           ES S+    ES  E     M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  +D   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  302 WEKVKG-GVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLATFMKPDMWKKCLDCIN-ELLDILFGNNNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGV---YGGYFN 886          

HSP 2 Score: 115.161 bits (287), Expect = 1.135e-25
Identity = 70/125 (56.00%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHK--KTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP+FYIR +A+LED++N LW++ +  K +NKNN K+L+TLRQ++RKYN+++ETDI  ++ENP
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKENP 163          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Yeast
Match: NIP1 (eIF3c subunit of the eukaryotic translation initiation factor 3 (eIF3); involved in the assembly of preinitiation complex and start codon selection; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004926])

HSP 1 Score: 192.2 bits (487), Expect = 2.633e-51
Identity = 130/435 (29.89%), Postives = 227/435 (52.18%), Query Frame = 1
Query: 1243 RLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRA----YLRKVEHMYYR---------------FDYNFKWDESLSDHALSESYQE-MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLA-QGIAPNRYERTKDEENREKAR-LLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMI---SRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRS-EPSKLQAMALRL 2469
            R+ G I +  E +DDE+ K L NID  + DY+ +L+ E  ++ L  +   Y E      +D+ RA    ++++++H+YY+                   FK   +  D   S  Y + +      ILSK     ++ RA+L +IYY AL+  +  A+DM+  S +Q +I++ D+S QIL+NR  VQLGL AF+   I++ HQ L DL  S  L+E+L  Q +       + +    E+AR  LPYHQHINL+L++ V+L  ++L ++      Y   + + I    ++    L+  ++ +  G PET+RD+V+ A+K++  G+W+++VK +       K W L      V   L E++++E+L+T+         S S++ L + FDL    + +++  +I   E+ A LND     ++ +  E +KL+   ++L
Sbjct:  364 RILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYL----REIKSWALLPNMETVLNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEITKLEEAMVKL 794          

HSP 2 Score: 48.1358 bits (113), Expect = 6.041e-6
Identity = 32/129 (24.81%), Postives = 72/129 (55.81%), Query Frame = 1
Query:  142 KRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKI 528
            K+VV+S K K  +E++++   +   + + D   +  +F+++++   +A++     G P  +I+ VA++ED +N+      K  NK   ++  T +QR++K ++E E  +  FR +PE + ++   ++ I
Sbjct:  109 KKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQ--QNWGTPNIFIKVVAQVEDAVNNTQQADLK--NKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDI 233          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Nematostella
Match: EDO41901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S347])

HSP 1 Score: 450.669 bits (1158), Expect = 6.551e-145
Identity = 254/587 (43.27%), Postives = 370/587 (63.03%), Query Frame = 1
Query:  817 ESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESE--NLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDH-------------ALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNR-YERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHR-SEPSKLQAMALRLAERVNQLGELNERLIEIRN 2526
            + D +GWT V G    EK   +F K+ EIT   VLKK+ +I+  R  K   R  Q E L +L K+  +   G    +KL+ +  S +  YN    +C+K + W +      + L  +L N + + +  +V+EE+E  ++ +   R+ GC++++ E MD+E+TK+LQ  D  + +Y+E+L+ E  V ++  +L  YLE K  +  ++CR YLR++EH+YY+     K  + +                   +S   M  LC+YI SKD +DR+RTRAM+CH+Y+ ALH+ W+ ARD+M MS LQ +I  SD  TQILYNR  VQLGLCAFR G IKD+H AL D+Q SGR KELLAQG+   R +ERT ++E  EK R +P+H HINLEL+ECVYL SAML ++     H  D RRR+IS++FH+ L+ S++QTLVG PE++R+HVVAASKA+  GDW+     I    +  KVW LF  +  VK+ML  KI+ E+LRT+L  ++S+ DSLSL  L + FDL   ++H  ISKMI+ +EL AS ++PT  ++MHR +EP+ +Q +AL+LA++V  L E NER+ E ++
Sbjct:  243 DEDSEGWTEVKGI--TEKAKHLFPKDTEITVPVVLKKLHEILSARGKKGTDRTDQIEFLMELRKVAEEAKLGEAMTVKLMFNIISSIFDYNPNVATCMKADMWQQYRLKAISELIAILENNSGIFVGEHVMEENETFDMKENQQRIRGCVLSVIERMDNEFTKMLQGCDCHSTEYVERLKDEKTVTDIIKRLQAYLE-KNGTREELCRIYLRRIEHIYYKMVQKDKEKQDVEKEKQDNEKESEEKKSEDEDSKNTMDFLCKYIYSKDTSDRIRTRAMMCHVYHHALHNRWFAARDLMLMSHLQETIQHSDILTQILYNRTMVQLGLCAFRHGMIKDAHNALHDVQSSGRAKELLAQGLMQQRQFERTPEQEKIEKRRQVPFHMHINLELLECVYLTSAMLLEIPFMAAHAYDHRRRVISKSFHYQLRQSDKQTLVGPPESMREHVVAASKAMKTGDWRKCKDYI----LAVKVWKLFSCADQVKEMLTRKIQEESLRTYLFTYNSVYDSLSLHTLAEMFDLPPSVVHSTISKMIINEELQASWDEPTQTVVMHRGAEPTLVQNLALQLADKVGNLVENNERIYETKH 822          

HSP 2 Score: 120.168 bits (300), Expect = 8.330e-28
Identity = 69/125 (55.20%), Postives = 96/125 (76.80%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDN--HKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENP 489
            SD EE+ KRVVRS K KR++EL N+IK LKNHKK +D+   L +FE L K F KAK ++D EG+P F+IR ++ELEDF+ + W++   +K L+K N ++LATLRQ+LRKY+K++E DI+ +RENP
Sbjct:    3 SDEEEETKRVVRSQKDKRFDELSNVIKQLKNHKKIKDMAKCLTEFENLGKAFTKAKAVVDKEGIPPFFIRALSELEDFVKENWEDAEGRKKLSKINARALATLRQKLRKYSKDFEDDIEKYRENP 127          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Nematostella
Match: EDO29638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T328])

HSP 1 Score: 47.7506 bits (112), Expect = 4.007e-7
Identity = 22/57 (38.60%), Postives = 38/57 (66.67%), Query Frame = 1
Query: 1300 ILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYR 1470
            +LQ  D  + +Y+E+L+ E  V ++  +L  YLE K  +  ++CR YLR++EH+YY+
Sbjct:    1 MLQGCDCHSTEYVERLKDEKTVTDIIKRLQAYLE-KNGTREELCRIYLRRIEHIYYK 56          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Medaka
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:101174301])

HSP 1 Score: 476.093 bits (1224), Expect = 7.534e-154
Identity = 270/575 (46.96%), Postives = 376/575 (65.39%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQE----------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  +   L  +L   NN+ +  N+ E+SENL   D P+R+ GC++ L E MD+E+TKI+QN D  + +Y++ L+ E +V  +  +L  YLE K  S+ +ICR YLR++ H YY+FDY   +    L     SE  QE          M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  SD   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  281 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAIAAEHNLGQGILVKIKFNIIASLYDYNPNLAAFMKADMWKKCLECID-ELLDILFENNNIFIGENIAEDSENLAVSDQPFRVRGCVLTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVCGIVDRLLTYLENKG-STEEICRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGEDSALIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIHHSDPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRKIQEESLRTYLFTYSSVYDSISMEILSEMFQLEMPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGV---YGGYFN 850          

HSP 2 Score: 107.842 bits (268), Expect = 2.006e-23
Identity = 68/124 (54.84%), Postives = 94/124 (75.81%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFREN 486
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP FYIR +A+LED++N LW++   KK +NKNN K+L+TLRQ++RKYN+++ET+I  ++E 
Sbjct:   38 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPSFYIRLLADLEDYLNQLWEDKDGKKKMNKNNAKALSTLRQKIRKYNRDFETEIAAYKET 161          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Medaka
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:101174301])

HSP 1 Score: 477.633 bits (1228), Expect = 2.491e-153
Identity = 270/575 (46.96%), Postives = 376/575 (65.39%), Query Frame = 1
Query:  877 RVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLL--DPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYN-FKWDESLSDHALSESYQE----------MKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGI-APNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFN 2559
            ++F K  EI    V+KK+++I+Q R  K   R  Q E+L  L  I  + N G G  +K+  +  + L  YN    + +K + W K +  +   L  +L   NN+ +  N+ E+SENL   D P+R+ GC++ L E MD+E+TKI+QN D  + +Y++ L+ E +V  +  +L  YLE K  S+ +ICR YLR++ H YY+FDY   +    L     SE  QE          M  LC++I +KD+TDR+RT A+LCHIY+ ALH  WY+ARD+M MS LQ++I  SD   QILYNR  VQLG+CAFR+G IKD+H AL D+Q SGR KELL QG+   N  ER  ++E  EK R +P+H HINLEL+ECVYLVSAML ++ +   H  D RRRMIS+ FHH L+  ERQ L+G PE++R+HVVAASKA+ +GDW+     I+N KMNSKVWDLF E+  V++ML+ KI+ E+LRT+L  +SS+ DS+S+  L + F LE+  +H IISKMI+ +ELMASL+ PT  ++MHR+EP+ LQ MAL+LAE++  L E NER+ +++  V     G FN
Sbjct:  311 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAIAAEHNLGQGILVKIKFNIIASLYDYNPNLAAFMKADMWKKCLECID-ELLDILFENNNIFIGENIAEDSENLAVSDQPFRVRGCVLTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVCGIVDRLLTYLENKG-STEEICRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGEDSALIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIHHSDPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRKIQEESLRTYLFTYSSVYDSISMEILSEMFQLEMPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGV---YGGYFN 880          

HSP 2 Score: 114.005 bits (284), Expect = 2.833e-25
Identity = 70/126 (55.56%), Postives = 97/126 (76.98%), Query Frame = 1
Query:  121 SDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNH--KKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPE 492
            SD EED KRVVRS K KR+EEL N+IK ++N  K RD+   L +FE L + F K+K I+D EGVP FYIR +A+LED++N LW++   KK +NKNN K+L+TLRQ++RKYN+++ET+I  ++ENP+
Sbjct:   38 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPSFYIRLLADLEDYLNQLWEDKDGKKKMNKNNAKALSTLRQKIRKYNRDFETEIAAYKENPQ 163          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 1530 bits (3960), Expect = 0.000e+0
Identity = 844/846 (99.76%), Postives = 845/846 (99.88%), Query Frame = 1
Query:   28 IKGRFYQFXXXXXXXXXXXVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 2565
            IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLK+TDEK TEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT
Sbjct:   14 IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 859          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 1529.23 bits (3958), Expect = 0.000e+0
Identity = 844/846 (99.76%), Postives = 845/846 (99.88%), Query Frame = 1
Query:   28 IKGRFYQFXXXXXXXXXXXVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 2565
            IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLK+TDEK TEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT
Sbjct:   42 IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 887          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 1529.23 bits (3958), Expect = 0.000e+0
Identity = 844/846 (99.76%), Postives = 845/846 (99.88%), Query Frame = 1
Query:   28 IKGRFYQFXXXXXXXXXXXVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 2565
            IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLK+TDEK TEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT
Sbjct:   15 IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 860          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 1527.3 bits (3953), Expect = 0.000e+0
Identity = 844/846 (99.76%), Postives = 845/846 (99.88%), Query Frame = 1
Query:   28 IKGRFYQFXXXXXXXXXXXVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 2565
            IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLK+TDEK TEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT
Sbjct:   29 IKGRFYQFSSSESESSDEEVVKVQEKRVFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERLIEIRNTVVLPVRGRFNAT 874          
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Match: SMESG000025475.1 (SMESG000025475.1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 412/806 (51.12%), Postives = 571/806 (70.84%), Query Frame = 1
Query:  109 VFESSDSEEDEKRVVRSGKVKRYEELEXXXXXXXXXXXXRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESES-DWGDNXXXXXXXXXXAKELYKNNPAARFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYN-NKTNSCLKIEQWNKIMCNVSAXXXXXXXXXXXXXXXXXXXEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAP---DYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEXXXXXXXXXXXXLMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 2511
             F+ S   EDE+R+V+S + K+YE+L+ I+KNLKNHK  +DI  VL DFE LTK ++KA K ++ +GV KFYIR +AELE+F N  W N KK L+KNN KSLA LRQ+++KYNK++E  I  FREN ++YP +L+ E+   I+EE AVE    ED K     +   +SE E  D   +S +S+SED+E  ELYKN+PAARFLK    K  +KKKKEK+EK+++E K++         + D +GWT VD  G+PE   ++F  +EEIT ES+L K+   ++GR  K+ QR+ Q ++L+QL  +VV++ FG G Q+K+++S  S LLQY  + +N C+ +E W +I+     ++DIL  N N+++++ + +E+SE    PPY + GCII   EH++DEYTKIL   D  +    +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:   28 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWAN-KKNLSKNNSKSLAALRQKIKKYNKDFEAQIADFRENSDLYPLELVPEV---IEEEKAVEKKQ-EDPKKVSTLKDKSDSEDEMWDQDSSSESSTSEDEEEIELYKNDPAARFLKSHTSKQKDKKKKEKREKDQKEYKRK--------DKDDDNGWTTVDMYGRPE--VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 812          
The following BLAST results are available for this feature:
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3C2.270e-15346.09eukaryotic translation initiation factor 3 subunit... [more]
EIF3C2.998e-15346.09eukaryotic translation initiation factor 3 subunit... [more]
EIF3C2.998e-15346.09eukaryotic translation initiation factor 3 subunit... [more]
EIF3C2.998e-15346.09eukaryotic translation initiation factor 3 subunit... [more]
EIF3C2.998e-15346.09eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eif-3.C4.168e-13540.97Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.C4.168e-13540.97Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.C4.168e-13540.97Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eIF3c3.410e-14843.63gene:FBgn0034258 transcript:FBtr0086836[more]
eIF3c3.410e-14843.63gene:FBgn0034258 transcript:FBtr0340269[more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3c1.692e-15846.53eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tnip18.166e-15445.75TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:... [more]
tnip11.352e-15244.50TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eif3c1.951e-15346.36eukaryotic translation initiation factor 3, subuni... [more]
Eif3c1.150e-2753.17eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PFQ2|EIF3C_DANRE1.078e-15746.53Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q17Q06|EIF3C_AEDAE1.410e-15744.95Eukaryotic translation initiation factor 3 subunit... [more]
sp|B0W0S3|EIF3C_CULQU5.770e-15745.42Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q7PMU8|EIF3C_ANOGA9.664e-15644.79Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q3SYW6|EIF3C_BOVIN3.763e-15346.26Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2F3W60.000e+0100.00Eukaryotic translation initiation factor 3 subunit... [more]
A0A1S3IPT50.000e+044.47Eukaryotic translation initiation factor 3 subunit... [more]
A0A1S3INV30.000e+044.47Eukaryotic translation initiation factor 3 subunit... [more]
A0A2R2MJG10.000e+044.47Eukaryotic translation initiation factor 3 subunit... [more]
A0A087T8C80.000e+044.16Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif3c2.733e-15646.36eukaryotic translation initiation factor 3 subunit... [more]
eif3c2.733e-15646.36eukaryotic translation initiation factor 3 subunit... [more]
eif3c8.065e-15646.36eukaryotic translation initiation factor 3 subunit... [more]
eif3c1.170e-15546.36eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP12.633e-5129.89eIF3c subunit of the eukaryotic translation initia... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO419016.551e-14543.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296384.007e-738.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif3c7.534e-15446.96eukaryotic translation initiation factor 3 subunit... [more]
eif3c2.491e-15346.96eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of eukaryotic translation initiation factor 3 subunit C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025491.10.000e+099.76SMESG000025491.1[more]
SMESG000025491.10.000e+099.76SMESG000025491.1[more]
SMESG000025491.10.000e+099.76SMESG000025491.1[more]
SMESG000025491.10.000e+099.76SMESG000025491.1[more]
SMESG000025475.10.000e+051.12SMESG000025475.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007934
GenBankADK78220.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007934 ID=SMED30007934|Name=eukaryotic translation initiation factor 3 subunit C|organism=Schmidtea mediterranea sexual|type=transcript|length=2817bp
TCGTTAAATATTTTTTTATAATTGTAGATCAAAGGCAGATTTTACCAATT
CAGTTCAAGCGAGTCGGAATCTTCTGACGAAGAGGTGGTTAAAGTTCAAG
AAAAGAGAGTTTTTGAATCAAGCGATTCTGAAGAAGACGAGAAACGAGTC
GTTCGTTCAGGGAAAGTTAAAAGATATGAAGAATTGGAGAACATTATCAA
AAATTTGAAAAACCACAAAAAGAATCGAGATATTAATAACGTTTTGATTG
ATTTTGAAATTTTGACTAAATGTTTTGATAAAGCAAAAAAAATTATCGAT
ATCGAAGGGGTACCCAAATTTTATATTAGAACCGTTGCCGAACTCGAAGA
TTTCATTAATGACTTATGGGACAATCATAAGAAAACTTTGAATAAAAACA
ATTGTAAAAGCTTAGCAACGTTGCGTCAGAGGTTGCGTAAATATAATAAG
GAATATGAAACGGATATAAAGTTATTTAGAGAAAATCCTGAAGTTTATCC
TGAAGATTTGATTCAGGAAATCAAAATTGAAATTGATGAGGAAGCCGCTG
TTGAGTGTCCGCATCTGGAAGACAGAAAGCACGATCAAAAGTACCAAAAA
GTTGAAGAATCAGAATCTGAATCAGACTGGGGAGATAATTCCACAACCTC
GTCGTCAGAAGATGACGAGGCAAAGGAGTTGTATAAAAACAATCCGGCTG
CAAGATTTCTGAAAAAAACAGATGAAAAGTGTACAGAAAAGAAGAAAAAG
GAGAAAAAAGAAAAGGAAAAGGAAGAAAGAAAAAAAGAGAAAAAGAGAAA
ACAGTTGTCAGCAGGAGAGAGCGATGTAGATGGTTGGACAGCGGTTGATG
GGTCAGGAAAACCAGAAAAGTTGACTCGAGTCTTTGAAAAAAATGAAGAA
ATTACTGCTGAATCGGTGTTGAAGAAAATCGATGATATCATTCAAGGTCG
TGTTGTGAAAAGAGGTCAGAGACAAATTCAATTCGAAATGCTAGAACAGC
TTCATAAAATCGTTGTCGATCAGAATTTTGGCCCGGGATTTCAAATAAAG
CTCATTATAAGCTGTACTTCGTTCCTTCTCCAGTACAATAACAAGACCAA
TTCATGCTTGAAAATCGAACAATGGAACAAGATAATGTGCAATGTATCGG
CATTATTGGATATTCTATTGAACAATGTGAATAATGTCACTCTAAAAATC
AATGTACTTGAAGAAAGTGAAAATTTGTTGGATCCTCCATATCGCCTTCA
TGGATGCATCATTAACCTTTTTGAACACATGGATGATGAATATACTAAAA
TACTGCAAAATATTGATGCAAGAGCTCCTGATTATATTGAGAAATTGCAA
TTTGAAACGAAAGTATTTGAATTATGTACCAAGTTGAACAGATATCTGGA
AATGAAAGAATATAGTTCGAATGATATCTGTCGGGCGTATCTCAGGAAAG
TCGAGCACATGTATTATAGATTTGATTACAATTTCAAATGGGACGAATCC
TTATCGGATCATGCTTTATCGGAATCTTATCAAGAAATGAAATCGCTGTG
TAGGTATATTTTGTCAAAGGATCAAACCGATCGCCTTCGAACTCGGGCTA
TGTTATGCCATATTTATTATCTGGCATTACATGATCATTGGTATGAAGCT
AGAGACATGATGGCTATGTCAGCTCTTCAGAATTCAATAGATCGGTCTGA
CGCTTCTACTCAGATACTTTATAACCGAGCAACAGTTCAACTGGGATTGT
GTGCATTCAGAAAAGGATTTATCAAGGATTCTCACCAAGCATTGGCAGAT
CTCCAAGGCTCTGGGCGATTAAAAGAATTATTGGCACAAGGAATCGCTCC
AAATCGATATGAAAGAACGAAGGATGAAGAAAATAGAGAAAAGGCTCGTT
TACTACCGTATCATCAGCATATCAATTTAGAGTTAATGGAATGCGTTTAT
CTGGTATCAGCAATGTTATCGGATGTGAATCACTGCTTGACTCATTATCC
AGACGGCCGCAGAAGAATGATATCCAGAAATTTCCACCATGTCCTGAAAA
GTAGTGAACGACAAACATTGGTAGGATCACCGGAAACGGTGAGGGATCAC
GTCGTTGCAGCTTCCAAGGCATTATTTGTCGGAGATTGGCAGAATACCGT
TAAAAATATTGTAAATCCGAAAATGAATTCAAAAGTCTGGGATTTATTCC
ATGAATCTTCAGCAGTTAAGCAGATGTTGATTGAGAAAATAAAAATGGAA
GCTCTGCGAACTTTCTTATTGGGCCACAGTTCGATTTGTGATTCGTTGAG
TCTGTCGTTTTTAGAGAAGCAATTTGATTTGGAAATAAAAATAATCCATC
AGATTATCAGTAAAATGATTCTCATGGACGAGTTGATGGCATCGCTCAAT
GATCCAACAAATTGTTTGATCATGCATCGCAGTGAGCCTTCAAAATTGCA
GGCTATGGCCTTGCGATTGGCTGAGAGAGTGAACCAGTTGGGAGAACTAA
ATGAGCGGTTAATCGAAATCCGCAACACTGTCGTCCTTCCAGTCAGAGGA
AGATTTAATGCAACTTAAATTTCTGAATTTGAAGATTCTTCGAGGTCCTT
TTAAAAGTCTTGGTTGGTTTGGATGTCTTATCAAAGAAATCTAATTGAAT
AATTAAATGTTTAGTTGTATATTTTTTTAATAAAATTAGTGTACTAAAAT
TCCGTTTTAAGTTTCATCAAATATCAGATGTGCTTTTCAGAAATGTCACA
TTTATCATTCTATTTCATTTAATTGGAAGGTTGAAACCGTCCAGTTTAAA
AAACTTGTCCATTGGCG
back to top

protein sequence of SMED30007934-orf-1

>SMED30007934-orf-1 ID=SMED30007934-orf-1|Name=SMED30007934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYNNKTNSCLKIEQWNKIM
CNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDD
EYTKILQNIDARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRA
YLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRL
RTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATV
QLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENR
EKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFH
HVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKV
WDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEI
KIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQ
LGELNERLIEIRNTVVLPVRGRFNAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0003743translation initiation factor activity
GO:0031369translation initiation factor binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000419prepharyngeal region
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR027516EIF3C
IPR036390WH_DNA-bd_sf
IPR000717PCI_dom
IPR011991WHTH_DNA-bd_dom
IPR008905EIF3C_N_dom
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005852eukaryotic translation initiation factor 3 complex
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 57..77
NoneNo IPR availableSMARTSM00753PINTcoord: 413..497
e-value: 4.1E-7
score: 39.7
NoneNo IPR availablePANTHERPTHR13937:SF0EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT C-RELATEDcoord: 2..513
IPR000717Proteasome component (PCI) domainSMARTSM00088PINT_4coord: 413..497
e-value: 4.1E-7
score: 39.7
IPR000717Proteasome component (PCI) domainPFAMPF01399PCIcoord: 348..481
e-value: 2.7E-10
score: 40.7
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 308..484
score: 16.939
IPR008905Eukaryotic translation initiation factor 3 subunit C, N-terminal domainPFAMPF05470eIF-3c_Ncoord: 2..333
e-value: 2.7E-106
score: 356.2
IPR027516Eukaryotic translation initiation factor 3 subunit CPANTHERPTHR13937EUKARYOTIC TRANSLATION INITATION FACTOR 3, SUBUNIT 8 EIF3S8 -RELATEDcoord: 2..513
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 411..484