ULP_PROTEASE domain-containing protein

Overview
NameULP_PROTEASE domain-containing protein
Smed IDSMED30007932
Length (bp)2499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ULP_PROTEASE domain-containing protein (SMED30007932) t-SNE clustered cells

Violin plots show distribution of expression levels for ULP_PROTEASE domain-containing protein (SMED30007932) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ULP_PROTEASE domain-containing protein (SMED30007932) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ULP_PROTEASE domain-containing protein (SMED30007932) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007932

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007932SMESG000021486.1 SmedASXL_018363SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007932SMESG000021486.1 SmedASXL_018363SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30007932SMESG000021486.1 SmedASXL_012156SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007932SMESG000021486.1 SmedASXL_012156SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007932SMESG000021486.1 dd_Smed_v4_19123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007932SMESG000021486.1 dd_Smed_v4_19123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007932SMESG000021486.1 dd_Smed_v4_19123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007932SMESG000021486.1 dd_Smed_v4_19123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 1583.16 bits (4098), Expect = 0.000e+0
Identity = 786/833 (94.36%), Postives = 795/833 (95.44%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTGSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2499
            LQNLSNNINAI+SE DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLT SDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTT                               +SKSALIS+ETDADSTIKIIEINKPLNE+ RDPTIWFTDDDIDLYL+NHISSLEFASINCFIVEILR NPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIR+EVHQLQL CQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTF+RENVTFRQFTGIDHIISIVPNDSNWSLF+FSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDY TDEYYIINPTTLCGTES QSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKS+LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL
Sbjct: 4548 LQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTT-------------------------------ISKSALISEETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSNLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 5349          

HSP 2 Score: 1547.33 bits (4005), Expect = 0.000e+0
Identity = 775/835 (92.81%), Postives = 783/835 (93.77%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTGSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIIS--IVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2499
            LQNLSNNINAI+SE DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLT SDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNH                        +SKSALISKETDADSTIKIIEINKPLNE+ RDPTIWFTDDDIDLYL+NHISSLEFASINCFIVEILR NPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIR+EVHQLQL CQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ                I H +   IVPNDSNWSLF+FSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDY TDEYYIINPTTLCGTES QSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKS+LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL
Sbjct: 2199 LQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNH------------------------ISKSALISKETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ----------------ISHSLEKIIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSNLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2993          

HSP 3 Score: 567.385 bits (1461), Expect = 4.246e-177
Identity = 330/832 (39.66%), Postives = 500/832 (60.10%), Query Frame = 1
Query:   46 DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSL---LLTLTGSDS-EQIADRSDSITLVNTTQSVEINP--GTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPK-------FMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPD----RVKSKHKPYLG-NKTRPQKIN 2487
            DD    K+KRF++F++RD KK+L+ ++ ++R+   C K CT+ M+  I  II  L   ++ +   D  EQ  D    I  ++ T+ + I      +  SI++  ++          +  L   I  VE   + ++ T  NH ++   +   N   K        +  ++ +  + +   STI     NK L    RDP IWF+D+DID YLE HI +     I CFIV IL +N  E++  IP  +  A+++ CPLNI+ +HWILFVYCK S +SYFIDPIL+ R+  +NK  AL++ +ALN+ FNLK A++++PH+N  YQ N++DCGP+ CAYA++IS    +FPD FID IR +VH+ Q+        + GG   K       F + I +      +  T   L  Q  C+SS++ +Y++     +VLS ELT+N++AQN +F+ +NVTF+QF GIDHI+ ++P  ++W LFI+S+ L +S+IF+F+ R + +RLI IG  +T+YLN+F + NR V F++ H+I H++  S D+  FAS FI+L E L++   +   +  + L  +K +   EI   LN IN KI ++I  +YF+ LKL+ +++LLN+T+C AI DDCT+++  FLN E ++KA VIFAII+PPK  E+LL+IDY+T+E+Y ++P T       Q  C     KINE++E+ GR +  G   +DIRGSGL+SK+LICAFI+NYA D  L N+NL EIG  ++SL+PI+  S  +      K+       LNL+QRK KI++LL  +S   V+EII  I+   P     + K   +PYLG N  +P+K N
Sbjct:   11 DDTYDVKSKRFIYFLLRDSKKYLIRNQ-TFRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNH-DSPITENIINPPTKR-------TGQRNTVKKQPSKPKSTI----CNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQMEIVGN---LIGGAKTKMDMSSFNFKKAIAKTKYSNNNPNTSNILKSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDFNYRTIDDRLIEIGVKITDYLNQFCL-NRNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKLKAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLGKNHNKPKKFN 825          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 1474.53 bits (3816), Expect = 0.000e+0
Identity = 747/835 (89.46%), Postives = 754/835 (90.30%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTGSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIIS--IVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2499
            LQNLSNNINAI+SE DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLT SDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLE                                                     ETDADSTIKIIEINKPLNE+ RDPTIWFTDDDIDLYL+NHISSLEFASINCFIVEILR NPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIR+EVHQLQL CQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ                I H +   IVPNDSNWSLF+FSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDY TDEYYIINPTTLCGTES QSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKS+LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL
Sbjct: 2199 LQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLE-----------------------------------------------------ETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ----------------ISHSLEKIIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSNLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2964          

HSP 2 Score: 1460.28 bits (3779), Expect = 0.000e+0
Identity = 736/833 (88.36%), Postives = 752/833 (90.28%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTGSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 2499
            LQNLSNNINAI+SE DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLT SDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDI                         S++ T S                               ++ A + +  + D    I E+   ++   RDPTIWFTDDDIDLYL+NHISSLEFASINCFIVEILR NPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIR+EVHQLQL CQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTF+RENVTFRQFTGIDHIISIVPNDSNWSLF+FSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDY TDEYYIINPTTLCGTES QSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKS+LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL
Sbjct: 4519 LQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIVDI-------------------------SVVETGS-------------------------------TEHARVKRRLEVD----IDEVESIIHTTNRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSNLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQKINKGIL 5291          

HSP 3 Score: 567.385 bits (1461), Expect = 4.282e-177
Identity = 330/832 (39.66%), Postives = 500/832 (60.10%), Query Frame = 1
Query:   46 DDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSL---LLTLTGSDS-EQIADRSDSITLVNTTQSVEINP--GTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHLNTKSIKKARNSLAKNK*RCVPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGGLPK-------FMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPD----RVKSKHKPYLG-NKTRPQKIN 2487
            DD    K+KRF++F++RD KK+L+ ++ ++R+   C K CT+ M+  I  II  L   ++ +   D  EQ  D    I  ++ T+ + I      +  SI++  ++          +  L   I  VE   + ++ T  NH ++   +   N   K        +  ++ +  + +   STI     NK L    RDP IWF+D+DID YLE HI +     I CFIV IL +N  E++  IP  +  A+++ CPLNI+ +HWILFVYCK S +SYFIDPIL+ R+  +NK  AL++ +ALN+ FNLK A++++PH+N  YQ N++DCGP+ CAYA++IS    +FPD FID IR +VH+ Q+        + GG   K       F + I +      +  T   L  Q  C+SS++ +Y++     +VLS ELT+N++AQN +F+ +NVTF+QF GIDHI+ ++P  ++W LFI+S+ L +S+IF+F+ R + +RLI IG  +T+YLN+F + NR V F++ H+I H++  S D+  FAS FI+L E L++   +   +  + L  +K +   EI   LN IN KI ++I  +YF+ LKL+ +++LLN+T+C AI DDCT+++  FLN E ++KA VIFAII+PPK  E+LL+IDY+T+E+Y ++P T       Q  C     KINE++E+ GR +  G   +DIRGSGL+SK+LICAFI+NYA D  L N+NL EIG  ++SL+PI+  S  +      K+       LNL+QRK KI++LL  +S   V+EII  I+   P     + K   +PYLG N  +P+K N
Sbjct:   11 DDTYDVKSKRFIYFLLRDSKKYLIRNQ-TFRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNH-DSPITENIINPPTKR-------TGQRNTVKKQPSKPKSTI----CNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQMEIVGN---LIGGAKTKMDMSSFNFKKAIAKTKYSNNNPNTSNILKSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDFNYRTIDDRLIEIGVKITDYLNQFCL-NRNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKLKAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLGKNHNKPKKFN 825          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000044750.1 (SMESG000044750.1)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 372/654 (56.88%), Postives = 479/654 (73.24%), Query Frame = 1
Query:  550 ETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGG---LPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQ-KINKGIL 2499
            ETDADSTI    IN    E  RD  IWFTDDDID YLE+HI +  FA + CFIVEIL +N  +++FP+P+ +FKAQIILCPLNI+++HWILFVYCK +  SYF+DPIL+ RH  +NK+ AL++TMALN LF+LKAA+TFHPH+N +YQ+N+YDCGPYICAYAM+IS  WQ+FP++FI+ IR+ VH+ Q +  Q   KVSGGG   LP F          K +   +A L  +NSC+ SL+ E+F  +   TVLSPELT+N++A N  F+RENVTFRQFT + ++I+++PN+ +W L+IFS V   SYI NF  R++ ERL++IGE+MT+YLNKF IS  KV FI  HN  H S  S+D   FASAFI  +E   F   +S T+ +E LKS K++  NEIC NLN IN  IN+EI  KYF NL L SNF+ LN  MCTAI+DDCTR+L  FLNY+++IKAQVIFAI+APPK REIL IIDYNTDEYY++NPTTL G ++Y S C+I RNKINEI+E+P RV+N+G+ P+DIRGSGLVSK+L C+++ NYANDLPL+ LNLR+IG  +SS LPI SE KK+   +   I +  K S NL++RK KID+LL  V  + V+EI+D+I+ Q   +    HKPYLGN  R + +INK  L
Sbjct:  570 ETDADSTI----INYFFPE--RDSKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWILFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVYQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTTKFQNPPKVSGGGITTLPIFKRFQNVTRPPKVALPYKASLQNENSCVPSLIKEWFSNKNYITVLSPELTLNLIAHNNQFIRENVTFRQFTRVKYVIAVIPNNPHWCLYIFSPVFERSYILNFQGRVLNERLVSIGESMTDYLNKFFISTAKVNFIVNHNQTHFSFRSEDPHFFASAFIEFLERFFFGNILSFTKINETLKSFKLQITNEICKNLNLINFSINDEIITKYFKNLNLPSNFIFLNSAMCTAIMDDCTRYLNDFLNYDNIIKAQVIFAIVAPPKFREILFIIDYNTDEYYLLNPTTLLGNDNYLSACKILRNKINEIRESPNRVLNLGECPHDIRGSGLVSKILFCSYMSNYANDLPLVGLNLRQIGNVVSSFLPIASEIKKVKSLENNIINENHKESENLKERKNKIDQLLIKVFKMNVDEIVDVILDQISIKTVPTHKPYLGNIERVESQINKSNL 1217          

HSP 2 Score: 68.9366 bits (167), Expect = 1.396e-11
Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQS 207
            L  L   IN IE + D + + KAKR L+F+IRDKK+FL    ++Y IP +CRKICT  M+  I  +IQS
Sbjct:  461 LTCLGEKINNIEIDNDVDDLVKAKRMLYFIIRDKKRFLNKDNFNYHIPFNCRKICTLKMSDFITKLIQS 529          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000013454.1 (SMESG000013454.1)

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 352/613 (57.42%), Postives = 453/613 (73.90%), Query Frame = 1
Query:  511 VPASVSKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGG---LPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQR 2340
            VPASVS S  IS+ETDADSTI    IN    E  RDP IWFTDDDID YLE+HI +  FA + CFIVEIL +N  +++FP+P+ +FKAQIILCPLNI+++HWI+FVYCK +  SYF+DPIL+ RH  +NK+ AL++TMALN LF+LKAA+TFHPH+N + Q+N+YDCGPYICAYAM+IS  WQ+FP++FI+ IR+ VH+ Q S  Q   KVSG G   LP F          K +   +A L  +NSC+ SL+ E+F  +   TVLSP+LT+N++A N  F+RENVTFRQFT + ++I+++PN+ +W L+IFS     SYI NF DR++ ERL++IGE+MT+YLNKF IS  KV FI  HN  H S  S+D   FASAFI  +E   F   +S T+ +E LKS K++  NEIC NLN IN  IN+EI  KYF NL L SNF+ LN  MCTAI+DDC R+L  FLNY+++IKAQVIFAI+APPK REIL IIDYNTDEYY++NPTTL G ++Y S C+I RNKINEI+E+P RV+N+G+  +DIRGSGLVSK+L C+++ NYANDLPL+ LNLR+IG  +SS LPI+SE KK+   +   I +  K S NL++R
Sbjct:  431 VPASVSISVPISEETDADSTI----INYFFPE--RDPKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWIVFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVCQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTSKFQNPPKVSGDGITTLPIFKRFQNVTRPPKVALPYKASLQNENSCVPSLIKEWFSNKNYITVLSPDLTLNLIAHNNQFIRENVTFRQFTRVKYVIAVIPNNPHWCLYIFSPAFERSYILNFQDRVLNERLVSIGESMTDYLNKFFISTAKVNFIVNHNQTHFSFRSEDPHFFASAFIEFLERFFFGNILSFTKINETLKSFKLQITNEICKNLNLINFSINDEIITKYFKNLNLPSNFIFLNSAMCTAIMDDCIRYLNDFLNYDNIIKAQVIFAIVAPPKFREILFIIDYNTDEYYLLNPTTLLGNDNYLSTCKILRNKINEIRESPNRVLNLGECSHDIRGSGLVSKILFCSYMSNYANDLPLVGLNLRQIGNVVSSFLPIVSEIKKVKSLENNIINENHKESENLKER 1037          

HSP 2 Score: 74.3294 bits (181), Expect = 2.997e-13
Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 1
Query:    1 LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQS 207
            L +LS  IN IE + D + + KAKR L+F+IRDKK+FL    ++YRIP +CRKICT  M+  I  +IQS
Sbjct:  325 LTSLSEKINNIEIDNDVDDLVKAKRMLYFIIRDKKRFLNKDNFNYRIPFNCRKICTLKMSDFITKLIQS 393          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000078596.1 (SMESG000078596.1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 358/662 (54.08%), Postives = 464/662 (70.09%), Query Frame = 1
Query:  526 SKSALISKETDADSTIKIIEINKPLNEAVRDPTIWFTDDDIDLYLENHISSLEFASINCFIVEILRNNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIREEVHQLQLSCQQKDQKVSGGG---LPKFMEIIKRNGVRKTSSATQAFLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQFTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSKHKPYLGNKTRPQ-KINKGIL 2499
            S S  IS+ETDADSTI      +      RDP IWFTDDDID YLE+HI +  FA + CFIVEIL +N  +++FP+P+ +FKAQIILCPLNI+++HWILFVYCK +  SYF+DPI +  H  +NK+ AL++TMALN LF+LKAA+TFHPH+N +YQ+N+YDCGP+ICAYAM+IS  WQ+FP++FI+ IR+ VH+ Q S  Q   KVSGGG   LP F          K +   +A L  +NSC+ SL+ E F  +   TVLSPELT+N +A N  F+RENVTFRQFT + ++I+++PN+ +W L                 + + ERL++IGE+MT+Y NKF IS  KV FI  HN  H S  S+D   FASAFI  +E   F   +S T+ +E LKS K++  NEIC NLN IN  IN+EI  KYF NL L SNF+ LN  MCTAI+DDCTR+L  FLNY+++IKAQVIFAI+APPK REIL IIDYNTDE Y++NPTTL G ++Y S C+I RNKINEI+E+P RV+N+G+ P DIRGSGLVSK+L C+++ NYANDLPL+ LNLR+I + +SS LPI+SE K +   +   I +  K S NL++RK KID+LL  V  + V+EI+D+I  Q   +    HKPYL NK R + +INK  L
Sbjct:   69 SISVSISEETDADSTINYYFFPE------RDPKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWILFVYCKLTKISYFVDPIFRKWHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVYQDNNYDCGPHICAYAMLISQEWQTFPNNFIETIRKNVHRFQTSKFQNPPKVSGGGITTLPIFKRFQNVTRPPKVALPYKASLQNENSCVPSLIKEGFSNKNYITVLSPELTLNFIAHNNQFIRENVTFRQFTRVKYVIAVIPNNPHWCL-----------------QSLNERLVSIGESMTDYPNKFFISTAKVNFIVNHNQIHFSFRSEDPHFFASAFIEFLEKFFFGNILSFTKINETLKSFKLQITNEICKNLNLINFSINDEIITKYFKNLNLPSNFIFLNSAMCTAIMDDCTRYLNDFLNYDNIIKAQVIFAIVAPPKFREILFIIDYNTDECYLLNPTTLLGNDNYLSTCKILRNKINEIRESPNRVLNLGECPYDIRGSGLVSKILFCSYMSNYANDLPLVGLNLRQIDSVVSSFLPIVSEIKNVKSLENNIINENHKESENLKERKNKIDQLLIKVFKMNVDEIVDVIFDQISIKTVPTHKPYLDNKERVESQINKSNL 707          
The following BLAST results are available for this feature:
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021486.14.246e-17794.36SMESG000021486.1[more]
SMESG000021486.14.282e-17789.46SMESG000021486.1[more]
SMESG000044750.11.396e-1156.88SMESG000044750.1[more]
SMESG000013454.12.997e-1357.42SMESG000013454.1[more]
SMESG000078596.10.000e+054.08SMESG000078596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007932 ID=SMED30007932|Name=ULP_PROTEASE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2499bp
CTTCAGAACTTGAGCAACAACATCAATGCAATCGAGTCAGAGCCAGATGA
CGAAACGATTGCAAAAGCCAAGAGATTTCTCTTTTTCGTAATTCGCGACA
AAAAGAAATTCCTTTTAGGTAGTAAATATTCTTACCGGATTCCACTGCAT
TGTAGAAAGATTTGCACTACTAACATGACTACGCATATCTTTTCTATAAT
ACAAAGTCTCCTCCTTACTTTAACTGGTAGCGATAGCGAGCAAATAGCAG
ACAGATCTGATTCGATTACTCTGGTGAACACCACTCAGTCTGTAGAAATA
AATCCAGGAACGCAGTCTGGTTCGATAGTTGATATCAGCGTTGTAGAGAC
TGGCTCTACTGAACATGCCAGAGTGAAACGCAGACTTGAAGTTGACATTG
ACGAGGTCGAGTCAATAATTCATACTACTAGTGGAACCCAACAAAACCAT
CTTAACACTAAATCTATTAAAAAAGCCAGAAATTCACTGGCGAAAAACAA
ATGAAGGTGCGTGCCTGCATCAGTCTCAAAATCTGCTCTAATCTCTAAGG
AGACTGATGCAGACAGCACAATAAAAATCATCGAAATAAATAAACCTCTA
AATGAAGCAGTTCGTGATCCTACAATTTGGTTTACTGATGATGATATTGA
TCTTTACCTAGAAAATCACATCAGTAGCCTTGAGTTTGCGTCCATAAATT
GTTTCATCGTTGAGATTTTGCGCAATAACCCTGGCGAAGATCTTTTTCCA
ATCCCGGAAAAGGTTTTCAAAGCGCAAATAATTTTATGCCCTTTAAATAT
TGACAAAACTCACTGGATCTTGTTTGTATATTGTAAGAACTCCTTGACAT
CTTACTTTATTGATCCAATCCTTCAATATCGGCATCGGTTTGTCAACAAA
ACATATGCACTTCAAGTTACAATGGCATTGAATCAGCTTTTCAATCTTAA
AGCTGCCATGACCTTCCACCCACATGAAAATTTCTTATACCAAGAAAATA
GTTACGACTGTGGGCCTTACATCTGTGCTTACGCAATGATGATAAGTGGA
GTTTGGCAAAGCTTTCCTGACCATTTTATTGACATCATCAGAGAGGAGGT
TCACCAACTTCAACTCTCCTGTCAACAGAAAGATCAAAAGGTTTCAGGAG
GTGGCCTACCGAAATTCATGGAAATCATCAAACGGAATGGGGTCAGGAAG
ACTAGCAGTGCTACCCAGGCTTTTCTCCTTAAACAGAATTCATGTATTTC
ATCCCTATTAGATGAATACTTCAAAACGAGAACCAATACGACTGTTCTAT
CTCCAGAACTAACAATGAACATTGTCGCCCAAAATCTCACATTCGTTAGA
GAAAATGTGACATTCAGACAATTCACTGGAATAGATCACATCATCAGTAT
TGTCCCAAATGACTCGAATTGGAGTCTGTTTATTTTCTCTCTTGTGTTAG
GGAACAGTTACATTTTCAACTTCCATGACAGAATAGTAACGGAAAGACTA
ATTGCCATTGGAGAAAATATGACTGAATACCTCAACAAATTCATCATCTC
CAATAGAAAAGTGATCTTCATTAGCGAACACAACATCGAACACGCTTCCA
TCACATCTGACGACTCACTTCTCTTTGCTTCTGCTTTCATTATATTAATC
GAAAGTCTTATTTTTAGCAAACAGGTTTCCCACACAAGAACCAGTGAGTT
TCTAAAATCAGTTAAAATTAAACAAGCAAATGAGATCTGTTTGAATTTAA
ACTCAATAAACTGTAAAATCAACGAGGAAATAACTGCAAAATATTTTAGT
AATTTGAAACTAAATTCGAACTTTATGCTACTAAATGAGACAATGTGCAC
TGCTATTCTTGATGATTGCACACGACATTTGACAAAATTTTTAAATTATG
AGGATCTCATTAAAGCACAAGTAATATTCGCCATAATTGCGCCCCCTAAA
CATCGAGAAATTCTTTTGATAATAGACTATAATACTGATGAATACTACAT
CATCAACCCAACTACTCTGTGTGGAACAGAGAGTTATCAATCAGTCTGCA
GAATTTTTCGAAATAAAATCAACGAGATTAAGGAAACACCTGGGCGCGTC
ATAAACATGGGTGATATTCCCAATGACATTCGTGGATCTGGTCTTGTGAG
TAAACTACTCATTTGCGCTTTCATTAAAAATTATGCTAATGATTTACCCC
TGATTAACTTAAACTTGCGCGAGATAGGTACCAACATCAGCTCTTTACTT
CCAATCATCAGTGAATCGAAAAAAATTCTAATGTCAGATTTGACTAAAAT
CACAAAAATAAAAAAGAGCAGCCTGAACCTGGAACAACGTAAACTCAAGA
TTGACGAACTTCTCCACGACGTTTCTCACCTGACTGTCAATGAAATCATT
GATATTATAGTAAGGCAATTCCCTGACCGTGTAAAATCAAAACACAAGCC
GTATTTGGGTAATAAAACACGACCTCAAAAAATAAATAAAGGGATATTA
back to top

protein sequence of SMED30007932-orf-1

>SMED30007932-orf-1 ID=SMED30007932-orf-1|Name=SMED30007932-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
LQNLSNNINAIESEPDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLH
CRKICTTNMTTHIFSIIQSLLLTLTGSDSEQIADRSDSITLVNTTQSVEI
NPGTQSGSIVDISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNH
LNTKSIKKARNSLAKNK*
back to top

protein sequence of SMED30007932-orf-2

>SMED30007932-orf-2 ID=SMED30007932-orf-2|Name=SMED30007932-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
MALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPD
HFIDIIREEVHQLQLSCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQA
FLLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFVRENVTFRQ
FTGIDHIISIVPNDSNWSLFIFSLVLGNSYIFNFHDRIVTERLIAIGENM
TEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSK
QVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSN
FMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLI
IDYNTDEYYIINPTTLCGTESYQSVCRIFRNKINEIKETPGRVINMGDIP
NDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESK
KILMSDLTKITKIKKSSLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQF
PDRVKSKHKPYLGNKTRPQKINKGIL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR003653Peptidase_C48_C
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 3..55