mre11-like protein

Overview
Namemre11-like protein (ACT98279.1)
Smed IDSMED30007929
Length (bp)2028
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mre11-like protein (SMED30007929) t-SNE clustered cells

Violin plots show distribution of expression levels for mre11-like protein (SMED30007929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mre11-like protein (SMED30007929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mre11-like protein (SMED30007929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007929h1SMcG0007321 SmedASXL_014065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007929h1SMcG0007321 SmedASXL_014065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30007929h1SMcG0007321 Contig37491uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007929h1SMcG0007321 Contig37491newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30007929h1SMcG0007321 dd_Smed_v4_4961_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mre11-like protein vs. Ensembl Human
Match: MRE11 (MRE11 homolog, double strand break repair nuclease [Source:HGNC Symbol;Acc:HGNC:7230])

HSP 1 Score: 483.026 bits (1242), Expect = 5.490e-162
Identity = 239/505 (47.33%), Postives = 343/505 (67.92%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRR 503          
BLAST of mre11-like protein vs. Ensembl Human
Match: MRE11 (MRE11 homolog, double strand break repair nuclease [Source:HGNC Symbol;Acc:HGNC:7230])

HSP 1 Score: 483.411 bits (1243), Expect = 8.062e-162
Identity = 239/505 (47.33%), Postives = 343/505 (67.92%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRR 503          
BLAST of mre11-like protein vs. Ensembl Human
Match: MRE11 (MRE11 homolog, double strand break repair nuclease [Source:HGNC Symbol;Acc:HGNC:7230])

HSP 1 Score: 483.411 bits (1243), Expect = 9.095e-162
Identity = 239/505 (47.33%), Postives = 343/505 (67.92%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRR 503          
BLAST of mre11-like protein vs. Ensembl Human
Match: MRE11 (MRE11 homolog, double strand break repair nuclease [Source:HGNC Symbol;Acc:HGNC:7230])

HSP 1 Score: 481.871 bits (1239), Expect = 4.265e-161
Identity = 239/502 (47.61%), Postives = 342/502 (68.13%), Query Frame = 2
Query:  140 DEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
            DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R
Sbjct:   12 DENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRR 506          
BLAST of mre11-like protein vs. Ensembl Human
Match: MRE11 (MRE11 homolog, double strand break repair nuclease [Source:HGNC Symbol;Acc:HGNC:7230])

HSP 1 Score: 268.085 bits (684), Expect = 4.815e-85
Identity = 121/217 (55.76%), Postives = 166/217 (76.50%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRV 781
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNRV
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRV 221          
BLAST of mre11-like protein vs. Ensembl Celegans
Match: mre-11 (Double-strand break repair protein mre-11 [Source:UniProtKB/Swiss-Prot;Acc:Q23255])

HSP 1 Score: 335.88 bits (860), Expect = 5.196e-105
Identity = 176/412 (42.72%), Postives = 252/412 (61.17%), Query Frame = 2
Query:  143 EDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHA----AKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQ-----FYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLA--------TTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFS---SMRFSQEYIGKIANPKDLLMLHR 1318
            ED +KI+++TD H G+ E       D+  TFEE+L I+ ++  D +LLGGDLFHEN PS     + ++L+R+Y  N NPI  + +SD ++NF QS  F H N+ D+NLNVG+PIFTIHGNHDD +    L ALDL H +GLVNLFGK ++++  I+ PIL++KG T+LALYG+G+ R++RL R F+   ++F RP   +E+WF++FV+HQNR + A      N++PES IP F DL+IWGHEH+C+ DP+Y  S +     FY+ QPGS+VATSL+  E+L+K    + IKG+ F    IPLQTVRP    +      ++    S P +     K   G+  D +A         T  +     +QP LPLIRL V Y G +   +   + R    Y   +AN  D++ + +
Sbjct:   63 EDIIKILVATDIHCGYGENKANIHMDAVNTFEEVLQIATEQKVDMILLGGDLFHENNPSREVQHRVTQLLRQYCLNGNPIALEFLSDASVNFNQS-VFGHVNYYDQNLNVGLPIFTIHGNHDD-LSGKGLTALDLLHESGLVNLFGKHSNIQEFIVSPILLRKGETRLALYGIGSQRDDRLVRAFKNNSISFLRPNAGAEDWFNLFVLHQNRPRRAMHRSTGNFLPESLIPQFFDLLIWGHEHECKPDPQYVASSEAVGDGFYILQPGSTVATSLTPEEALQKNAFLIKIKGRKFASKPIPLQTVRPMVCDE---LLLDKIPPGSRPILKTDRPKHTDGRYIDEIAIEAKINEMITTAKAKRRPRQPELPLIRLKVIYDGDWLNITPANAKRIGLRYENVVANAVDMVFIKK 469          
BLAST of mre11-like protein vs. Ensembl Celegans
Match: mre-11 (Double-strand break repair protein mre-11 [Source:UniProtKB/Swiss-Prot;Acc:Q23255])

HSP 1 Score: 335.88 bits (860), Expect = 5.196e-105
Identity = 176/412 (42.72%), Postives = 252/412 (61.17%), Query Frame = 2
Query:  143 EDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHA----AKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQ-----FYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLA--------TTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFS---SMRFSQEYIGKIANPKDLLMLHR 1318
            ED +KI+++TD H G+ E       D+  TFEE+L I+ ++  D +LLGGDLFHEN PS     + ++L+R+Y  N NPI  + +SD ++NF QS  F H N+ D+NLNVG+PIFTIHGNHDD +    L ALDL H +GLVNLFGK ++++  I+ PIL++KG T+LALYG+G+ R++RL R F+   ++F RP   +E+WF++FV+HQNR + A      N++PES IP F DL+IWGHEH+C+ DP+Y  S +     FY+ QPGS+VATSL+  E+L+K    + IKG+ F    IPLQTVRP    +      ++    S P +     K   G+  D +A         T  +     +QP LPLIRL V Y G +   +   + R    Y   +AN  D++ + +
Sbjct:   63 EDIIKILVATDIHCGYGENKANIHMDAVNTFEEVLQIATEQKVDMILLGGDLFHENNPSREVQHRVTQLLRQYCLNGNPIALEFLSDASVNFNQS-VFGHVNYYDQNLNVGLPIFTIHGNHDD-LSGKGLTALDLLHESGLVNLFGKHSNIQEFIVSPILLRKGETRLALYGIGSQRDDRLVRAFKNNSISFLRPNAGAEDWFNLFVLHQNRPRRAMHRSTGNFLPESLIPQFFDLLIWGHEHECKPDPQYVASSEAVGDGFYILQPGSTVATSLTPEEALQKNAFLIKIKGRKFASKPIPLQTVRPMVCDE---LLLDKIPPGSRPILKTDRPKHTDGRYIDEIAIEAKINEMITTAKAKRRPRQPELPLIRLKVIYDGDWLNITPANAKRIGLRYENVVANAVDMVFIKK 469          
BLAST of mre11-like protein vs. Ensembl Celegans
Match: mre-11 (Double-strand break repair protein mre-11 [Source:UniProtKB/Swiss-Prot;Acc:Q23255])

HSP 1 Score: 335.88 bits (860), Expect = 5.196e-105
Identity = 176/412 (42.72%), Postives = 252/412 (61.17%), Query Frame = 2
Query:  143 EDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHA----AKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQ-----FYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLA--------TTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFS---SMRFSQEYIGKIANPKDLLMLHR 1318
            ED +KI+++TD H G+ E       D+  TFEE+L I+ ++  D +LLGGDLFHEN PS     + ++L+R+Y  N NPI  + +SD ++NF QS  F H N+ D+NLNVG+PIFTIHGNHDD +    L ALDL H +GLVNLFGK ++++  I+ PIL++KG T+LALYG+G+ R++RL R F+   ++F RP   +E+WF++FV+HQNR + A      N++PES IP F DL+IWGHEH+C+ DP+Y  S +     FY+ QPGS+VATSL+  E+L+K    + IKG+ F    IPLQTVRP    +      ++    S P +     K   G+  D +A         T  +     +QP LPLIRL V Y G +   +   + R    Y   +AN  D++ + +
Sbjct:   63 EDIIKILVATDIHCGYGENKANIHMDAVNTFEEVLQIATEQKVDMILLGGDLFHENNPSREVQHRVTQLLRQYCLNGNPIALEFLSDASVNFNQS-VFGHVNYYDQNLNVGLPIFTIHGNHDD-LSGKGLTALDLLHESGLVNLFGKHSNIQEFIVSPILLRKGETRLALYGIGSQRDDRLVRAFKNNSISFLRPNAGAEDWFNLFVLHQNRPRRAMHRSTGNFLPESLIPQFFDLLIWGHEHECKPDPQYVASSEAVGDGFYILQPGSTVATSLTPEEALQKNAFLIKIKGRKFASKPIPLQTVRPMVCDE---LLLDKIPPGSRPILKTDRPKHTDGRYIDEIAIEAKINEMITTAKAKRRPRQPELPLIRLKVIYDGDWLNITPANAKRIGLRYENVVANAVDMVFIKK 469          
BLAST of mre11-like protein vs. Ensembl Fly
Match: mre11 (gene:FBgn0020270 transcript:FBtr0080213)

HSP 1 Score: 372.474 bits (955), Expect = 2.917e-120
Identity = 208/511 (40.70%), Postives = 309/511 (60.47%), Query Frame = 2
Query:  143 EDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPE-----------QESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDR-NRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKR 1633
            ++ ++I+++TDNHLG+ EKD +RG DSF  FEEIL ++  +  D +LLGGDLFH+  PS ++L KC EL+RRY+F + P+  +I+SDQ   F+ +   +  N+ D NLN+ IP+F+IHGNHDDP     L +LDL   +GLVN FG+   +  + I P+L++KG ++LALYGL  I + RL RL +  KV F  PE           +E E+WF + V+HQNR     KNY+PE  +PSF+ LVIWGHEHDCRI+PE N  ++FYVSQPGSSV TSLS+GE+ KK++G L I    FK+  +PL+TVRPF    ++L D  + + L   + S +V KF   ++E ++     Q T H +QPTLPLIRL + Y+    MF+++RF +    ++AN +D++   +  ++T  E  N       L    +R     D   RVE+++ ++F   K+N+ L L   K L+      +++ D D    +V     + + HL      +  I EE++R
Sbjct:   12 DNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLGGDLFHDAVPSQNALHKCIELLRRYTFGDRPVSLEILSDQGQCFHNA-VNQSVNYEDPNLNIAIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLTQVEISPVLMRKGESQLALYGLSHIHDGRLARLIKDFKVKFNCPENVANGEDGNESKEEEDWFHLLVVHQNRADRGPKNYLPEDLLPSFLHLVIWGHEHDCRIEPEENAKKRFYVSQPGSSVPTSLSEGEAKKKHVGLLEIYKGKFKLKPLPLETVRPFVYESVVLADHADELGLVEGDASTKVFKFAQERVEAMIERAVAQHTGHPKQPTLPLIRLRLLYTDESCMFNAIRFGEMLSTRVANVQDVVQFSKVVKRTKTEAVN-------LDKEALRRALEADNATRVEELVDRYFEEAKSNKPLKLFHSKALAEMTYRLLEQRDADAAENIVKFYKEKAVDHLMEAMPNDENIDEELER 514          
BLAST of mre11-like protein vs. Ensembl Zebrafish
Match: mre11a (MRE11 homolog A, double strand break repair nuclease [Source:ZFIN;Acc:ZDB-GENE-040426-2638])

HSP 1 Score: 478.404 bits (1230), Expect = 3.716e-161
Identity = 243/505 (48.12%), Postives = 346/505 (68.51%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIKR 1633
            T+ DEDT KI+++TD HLG+ EKD IRGND+F+TF+EI+  + Q   DF+LLGGDLFH+NKPS  ++  C E++R+Y   + PI F+IISDQA+NF  S  F   N+ D+NLN+ IPIF++HGNHDDP     LCA+DL    GLVN FG+S SVE + I P+L+QKG+T++ALYGLG+I +ERL+R+F   +VT  RP ++ + WF++FVIHQNR KH A NYIPE F+  F+DLV+WGHEH+C+I P  N  Q FYV+QPGSSV TSLS GE++KK+IG L +KGK   + KIPLQTVR F I  ++L D  E  S   PN   +V+ FC  K+E++L   + +   + Q P  PLIRL VDYSGGFE+F++MRFSQ+++ K+ANPKD+L   R RE     + N   ++V       R    + + RVED++K++F   + N +L LL+E+ +   ++  +DK+++D +  L++ ++ +   +L   ++   E  I EEI++
Sbjct:    7 TVDDEDTFKILIATDIHLGYLEKDAIRGNDTFVTFDEIMKQAMQNEVDFVLLGGDLFHDNKPSRKTMHSCMEVMRKYCMGDRPIIFEIISDQAVNFSHSR-FPWVNYLDDNLNISIPIFSVHGNHDDPTGSDGLCAVDLLSCAGLVNHFGRSRSVEKVEISPVLLQKGDTRIALYGLGSIPDERLYRMFVNNQVTMLRPREDEDGWFNLFVIHQNRSKHGATNYIPEQFLDDFLDLVVWGHEHECKIAPVRNEQQLFYVTQPGSSVITSLSPGEAVKKHIGLLRVKGKKMNLQKIPLQTVRQFFIQDVVLSDYPELFSPEQPNTMLKVQAFCQEKVEEMLEEAERERLGNPQIPEKPLIRLRVDYSGGFEVFNTMRFSQKFVDKVANPKDILHFVRHRET----KGNIKDEDVDFEALFSRPTSEVLQLRVEDLVKEYFQTAEKNVQLSLLTEQGMGKAVQEFVDKEERDAIEELINYQLEKTQRYLRERRVDATEEKIDEEIRQ 506          
BLAST of mre11-like protein vs. Ensembl Zebrafish
Match: mre11a (MRE11 homolog A, double strand break repair nuclease [Source:ZFIN;Acc:ZDB-GENE-040426-2638])

HSP 1 Score: 480.33 bits (1235), Expect = 8.416e-161
Identity = 243/505 (48.12%), Postives = 346/505 (68.51%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIKR 1633
            T+ DEDT KI+++TD HLG+ EKD IRGND+F+TF+EI+  + Q   DF+LLGGDLFH+NKPS  ++  C E++R+Y   + PI F+IISDQA+NF  S  F   N+ D+NLN+ IPIF++HGNHDDP     LCA+DL    GLVN FG+S SVE + I P+L+QKG+T++ALYGLG+I +ERL+R+F   +VT  RP ++ + WF++FVIHQNR KH A NYIPE F+  F+DLV+WGHEH+C+I P  N  Q FYV+QPGSSV TSLS GE++KK+IG L +KGK   + KIPLQTVR F I  ++L D  E  S   PN   +V+ FC  K+E++L   + +   + Q P  PLIRL VDYSGGFE+F++MRFSQ+++ K+ANPKD+L   R RE     + N   ++V       R    + + RVED++K++F   + N +L LL+E+ +   ++  +DK+++D +  L++ ++ +   +L   ++   E  I EEI++
Sbjct:    7 TVDDEDTFKILIATDIHLGYLEKDAIRGNDTFVTFDEIMKQAMQNEVDFVLLGGDLFHDNKPSRKTMHSCMEVMRKYCMGDRPIIFEIISDQAVNFSHSR-FPWVNYLDDNLNISIPIFSVHGNHDDPTGSDGLCAVDLLSCAGLVNHFGRSRSVEKVEISPVLLQKGDTRIALYGLGSIPDERLYRMFVNNQVTMLRPREDEDGWFNLFVIHQNRSKHGATNYIPEQFLDDFLDLVVWGHEHECKIAPVRNEQQLFYVTQPGSSVITSLSPGEAVKKHIGLLRVKGKKMNLQKIPLQTVRQFFIQDVVLSDYPELFSPEQPNTMLKVQAFCQEKVEEMLEEAERERLGNPQIPEKPLIRLRVDYSGGFEVFNTMRFSQKFVDKVANPKDILHFVRHRET----KGNIKDEDVDFEALFSRPTSEVLQLRVEDLVKEYFQTAEKNVQLSLLTEQGMGKAVQEFVDKEERDAIEELINYQLEKTQRYLRERRVDATEEKIDEEIRQ 506          
BLAST of mre11-like protein vs. Ensembl Xenopus
Match: mre11 (MRE11 homolog , double strand break repair nuclease [Source:NCBI gene;Acc:100135381])

HSP 1 Score: 480.33 bits (1235), Expect = 7.082e-163
Identity = 241/506 (47.63%), Postives = 352/506 (69.57%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIK 1630
            M DEDT KI+++TD HLGF EKD +RGNDSF TF+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+    GLVN FG++ SVE I I P+L+QKG +K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DL+IWGHEH+C+I+P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   +++QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++      DN+ ++   + +    + +  RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L   +I  +E+ I EE++
Sbjct:    6 MDDEDTFKILVATDIHLGFMEKDAVRGNDSFSTFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSCAGLVNHFGRATSVEKIDISPVLLQKGRSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDDFLDLIIWGHEHECKINPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPKVTQEIESFCIEKVEAMLDTAERERLGNARQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK------DNITINFGKLDSKPLFEGSTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERQIDAEEDKIDEEVR 503          
BLAST of mre11-like protein vs. Ensembl Xenopus
Match: mre11 (MRE11 homolog , double strand break repair nuclease [Source:NCBI gene;Acc:100135381])

HSP 1 Score: 479.559 bits (1233), Expect = 1.400e-162
Identity = 241/506 (47.63%), Postives = 352/506 (69.57%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIK 1630
            M DEDT KI+++TD HLGF EKD +RGNDSF TF+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+    GLVN FG++ SVE I I P+L+QKG +K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DL+IWGHEH+C+I+P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   +++QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++      DN+ ++   + +    + +  RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L   +I  +E+ I EE++
Sbjct:    7 MDDEDTFKILVATDIHLGFMEKDAVRGNDSFSTFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSCAGLVNHFGRATSVEKIDISPVLLQKGRSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDDFLDLIIWGHEHECKINPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPKVTQEIESFCIEKVEAMLDTAERERLGNARQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK------DNITINFGKLDSKPLFEGSTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERQIDAEEDKIDEEVR 504          
BLAST of mre11-like protein vs. Ensembl Xenopus
Match: mre11 (MRE11 homolog , double strand break repair nuclease [Source:NCBI gene;Acc:100135381])

HSP 1 Score: 479.945 bits (1234), Expect = 2.350e-162
Identity = 241/506 (47.63%), Postives = 352/506 (69.57%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIK 1630
            M DEDT KI+++TD HLGF EKD +RGNDSF TF+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+    GLVN FG++ SVE I I P+L+QKG +K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DL+IWGHEH+C+I+P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   +++QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++      DN+ ++   + +    + +  RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L   +I  +E+ I EE++
Sbjct:    7 MDDEDTFKILVATDIHLGFMEKDAVRGNDSFSTFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSCAGLVNHFGRATSVEKIDISPVLLQKGRSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDDFLDLIIWGHEHECKINPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPKVTQEIESFCIEKVEAMLDTAERERLGNARQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK------DNITINFGKLDSKPLFEGSTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERQIDAEEDKIDEEVR 504          
BLAST of mre11-like protein vs. Ensembl Xenopus
Match: mre11 (MRE11 homolog , double strand break repair nuclease [Source:NCBI gene;Acc:100135381])

HSP 1 Score: 481.485 bits (1238), Expect = 1.061e-161
Identity = 240/509 (47.15%), Postives = 353/509 (69.35%), Query Frame = 2
Query:  128 ITMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIKR 1633
            +   DEDT KI+++TD HLGF EKD +RGNDSF TF+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+    GLVN FG++ SVE I I P+L+QKG +K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DL+IWGHEH+C+I+P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   +++QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++      DN+ ++   + +    + +  RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L   +I  +E+ I EE+++
Sbjct:    1 VPQDDEDTFKILVATDIHLGFMEKDAVRGNDSFSTFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSCAGLVNHFGRATSVEKIDISPVLLQKGRSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDDFLDLIIWGHEHECKINPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPKVTQEIESFCIEKVEAMLDTAERERLGNARQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK------DNITINFGKLDSKPLFEGSTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERQIDAEEDKIDEEVRK 501          
BLAST of mre11-like protein vs. Ensembl Xenopus
Match: mre11 (MRE11 homolog , double strand break repair nuclease [Source:NCBI gene;Acc:100135381])

HSP 1 Score: 476.863 bits (1226), Expect = 1.404e-161
Identity = 240/506 (47.43%), Postives = 352/506 (69.57%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIK 1630
            + DEDT KI+++TD HLGF EKD +RGNDSF TF+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+    GLVN FG++ SVE I I P+L+QKG +K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DL+IWGHEH+C+I+P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   +++QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++    T  N+ ++   + +    + +  RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L   +I  +E+ I EE++
Sbjct:    1 LDDEDTFKILVATDIHLGFMEKDAVRGNDSFSTFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSCAGLVNHFGRATSVEKIDISPVLLQKGRSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDDFLDLIIWGHEHECKINPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPKVTQEIESFCIEKVEAMLDTAERERLGNARQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK---GTYYNITINFGKLDSKPLFEGSTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERQIDAEEDKIDEEVR 501          
BLAST of mre11-like protein vs. Ensembl Mouse
Match: Mre11a (MRE11A homolog A, double strand break repair nuclease [Source:MGI Symbol;Acc:MGI:1100512])

HSP 1 Score: 487.649 bits (1254), Expect = 1.513e-163
Identity = 243/511 (47.55%), Postives = 350/511 (68.49%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKRKVEALER 1654
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F++ISDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE + I P+L+QKG+TKLALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH   N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FYVSQPGSSV TSLS GE++KK++G L IKG+   + K+PL+TVR F I  ++L +     +  +P V++ ++ FC  K+E++L + + +   + QQP  PLIRL VDYSGGFE F+ +RFSQ+++ ++ANPKD++   R REQ  +    + ++  +L          L   RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R  E+ +R
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDLVIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGK--TGEEINFGMLITKPASEGATL---RVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRESRQR 511          
BLAST of mre11-like protein vs. Ensembl Mouse
Match: Mre11a (MRE11A homolog A, double strand break repair nuclease [Source:MGI Symbol;Acc:MGI:1100512])

HSP 1 Score: 453.366 bits (1165), Expect = 1.434e-150
Identity = 233/511 (45.60%), Postives = 332/511 (64.97%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKT--NEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKRKVEALER 1654
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F++ISDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE + I P+L+QKG+TKLALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH   N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FYVSQPGSSV TSLS GE++KK++G L IKG+   + K+PL+TVR F I  ++L +     +  +P V++ ++ FC  K                           VDYSGGFE F+ +RFSQ+++ ++ANPKD++   R REQ  +    + ++  +L          L   RVED++KQ+F     N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R  E+ +R
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDLVIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEK---------------------------VDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGK--TGEEINFGMLITKPASEGATL---RVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRESRQR 484          
BLAST of mre11-like protein vs. Ensembl Mouse
Match: Mre11a (MRE11A homolog A, double strand break repair nuclease [Source:MGI Symbol;Acc:MGI:1100512])

HSP 1 Score: 244.973 bits (624), Expect = 1.029e-76
Identity = 113/198 (57.07%), Postives = 150/198 (75.76%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRP 727
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F++ISDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE + I P+L+QKG+TKLALYGLG+I +ERL+R+F  KKVT  RP
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRP 203          
BLAST of mre11-like protein vs. Ensembl Mouse
Match: Mre11a (MRE11A homolog A, double strand break repair nuclease [Source:MGI Symbol;Acc:MGI:1100512])

HSP 1 Score: 103.219 bits (256), Expect = 5.477e-25
Identity = 49/121 (40.50%), Postives = 81/121 (66.94%), Query Frame = 2
Query:  962 KYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKR 1324
            +++G L IKG+   + K+PL+TVR F I  ++L +     +  +P V++ ++ FC  K+E++L + + +   + QQP  PLIRL VDYSGGFE F+ +RFSQ+++ ++ANPKD++   R R
Sbjct:   50 RHVGLLRIKGRKMNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHR 170          

HSP 2 Score: 73.1738 bits (178), Expect = 1.464e-14
Identity = 31/49 (63.27%), Postives = 42/49 (85.71%), Query Frame = 2
Query:  632 GNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNR 778
            G+TKLALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR
Sbjct:    2 GSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNR 50          
BLAST of mre11-like protein vs. Ensembl Mouse
Match: Mre11a (MRE11A homolog A, double strand break repair nuclease [Source:MGI Symbol;Acc:MGI:1100512])

HSP 1 Score: 65.855 bits (159), Expect = 2.784e-13
Identity = 29/51 (56.86%), Postives = 41/51 (80.39%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLL 286
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LL
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILL 57          
BLAST of mre11-like protein vs. UniProt/SwissProt
Match: sp|Q9JIM0|MRE11_RAT (Double-strand break repair protein MRE11 OS=Rattus norvegicus OX=10116 GN=Mre11 PE=1 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 2.837e-163
Identity = 240/511 (46.97%), Postives = 349/511 (68.30%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKT--NEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKRKVEALER 1654
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+IISDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE + I P+L+QKG+TKLALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FYVSQPGSSV T+LS GE++KK++G L +KG+   + K+PL+TVR F +  ++L +     +  +P V++ ++ FC  K+E++L + + +   + QQP  PLIRL VDYSGGFE F+ +RFSQ+++ ++ANPKD++   R REQ  +         +I+  ++          RVED++KQ+F     N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R  E+ +R
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEIISDQSVNFGFSK-FPWVNYRDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIGPTRNEQQLFYVSQPGSSVVTALSPGETVKKHVGLLRVKGRKMNMQKLPLRTVRQFFMEDVVLANHPSLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPEKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGKTGEEINFGKLIIKPASEGTTL-----RVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRESRQR 511          
BLAST of mre11-like protein vs. UniProt/SwissProt
Match: sp|Q61216|MRE11_MOUSE (Double-strand break repair protein MRE11 OS=Mus musculus OX=10090 GN=Mre11 PE=1 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 1.058e-162
Identity = 243/511 (47.55%), Postives = 350/511 (68.49%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKRKVEALER 1654
            + DEDT KI+++TD HLGF EKD +RGND+F+TF+EIL ++ +   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F++ISDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE + I P+L+QKG+TKLALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH   N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FYVSQPGSSV TSLS GE++KK++G L IKG+   + K+PL+TVR F I  ++L +     +  +P V++ ++ FC  K+E++L + + +   + QQP  PLIRL VDYSGGFE F+ +RFSQ+++ ++ANPKD++   R REQ  +    + ++  +L          L   RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R  E+ +R
Sbjct:    7 LDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDLVIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGK--TGEEINFGMLITKPASEGATL---RVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRESRQR 511          
BLAST of mre11-like protein vs. UniProt/SwissProt
Match: sp|P49959|MRE11_HUMAN (Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3)

HSP 1 Score: 483.411 bits (1243), Expect = 3.872e-161
Identity = 239/505 (47.33%), Postives = 343/505 (67.92%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFM--KTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL ++++   DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRR 503          
BLAST of mre11-like protein vs. UniProt/SwissProt
Match: sp|Q60HE6|MRE11_MACFA (Double-strand break repair protein MRE11 OS=Macaca fascicularis OX=9541 GN=MRE11 PE=2 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 4.183e-161
Identity = 240/512 (46.88%), Postives = 347/512 (67.77%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKRKVEALER 1654
             + DE+T KI+++TD HLGF EKD +RGND+F+T +EIL +++    DF+LLGGDLFHENKPS  +L  C EL+R+Y   + P++F+I+SDQ++NF  S+ F   N+ D NLN+ IP+F+IHGNHDDP     LCALD+    G VN FG+S SVE I I P+L+QKG+TK+ALYGLG+I +ERL+R+F  KKVT  RP+++  +WF++FVIHQNR KH + N+IPE F+  FIDLVIWGHEH+C+I P  N  Q FY+SQPGSSV TSLS GE++KK++G L IKG+   + KIPL TVR F +  I+L +  +  +  +P V++ ++ FC  K+E++L   + +   +S+QP  PL+RL VDYSGGFE FS +RFSQ+++ ++ANPKD++   R REQ  +         +I   S           RVED++KQ+F   + N +L LL+E+ +   ++  +DK++KD +  LV  ++ +    L    I   E+ I EE++R  E+ ++
Sbjct:    6 ALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLARGNEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSK-FPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSRQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTT------LRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRESRQK 510          
BLAST of mre11-like protein vs. UniProt/SwissProt
Match: sp|Q9W6K1|MRE11_XENLA (Double-strand break repair protein MRE11 OS=Xenopus laevis OX=8355 GN=mre11 PE=2 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 2.185e-160
Identity = 240/507 (47.34%), Postives = 351/507 (69.23%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRN--RVEDMIKQHFMKTNEK---LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKI--KENFIVEEIKR 1633
            + DEDT KI+++TD HLGF EKD +RGNDSF+ F+EIL +++    DF+LLGGDLFH+NKPS  +L  C E +R+Y   + PI+F+++SDQ++NF  S+ F   N+ D NLN+ +P+F++HGNHDDP     LCALD+  + GLVN FG++ SVE I I P+L+QKG++K+ALYGLG+I +ERL+R+F  K+V   RP ++  +WF++FVIHQNR KH   NYIPE F+  F+DLVIWGHEH+C+I P  N  Q FYVSQPGSSVATSLS GE+ KK++G L IKGK   + KIPLQTVR F I  ++L D  +  +  +P V++++E FC  K+E +L T + +   + +QP  PLIRL VDY+GGFE F+++RFSQ+++ + ANPKD++   R +EQ +++      D++ ++   + +   L+    RVED++K++F KT EK   L LL+E+ +   ++  +DK++KD L  LV  ++ +    L    I  +E  I EE+++
Sbjct:    8 LDDEDTFKILVATDIHLGFMEKDAVRGNDSFVAFDEILRLAQDNEVDFLLLGGDLFHDNKPSRRTLHICLEQLRKYCMGDRPIEFEVLSDQSVNFGYSK-FPWVNYQDNNLNISLPVFSVHGNHDDPTGADALCALDILSSAGLVNHFGRATSVEKIDISPVLLQKGHSKIALYGLGSIPDERLYRMFVNKQVMMLRPREDESSWFNLFVIHQNRSKHGPTNYIPEQFLDEFLDLVIWGHEHECKIAPTRNEQQLFYVSQPGSSVATSLSPGEAEKKHVGLLRIKGKKMNMQKIPLQTVRQFFIEDLVLSDYPDIFNPDNPRVTQEIETFCIEKVEAMLDTAERERLGNPRQPDKPLIRLRVDYTGGFEPFNTLRFSQKFVDRTANPKDIIHFFRHKEQKDKK------DSITINFGKIDSKPLLEGTTLRVEDLVKEYF-KTAEKNVQLSLLTERGMGEAVQEFVDKEEKDALEELVKFQLEKTQRFLKERHIDAEEEKIDEEVRK 506          
BLAST of mre11-like protein vs. TrEMBL
Match: D2DJU2 (Mre11-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 947.962 bits (2449), Expect = 0.000e+0
Identity = 474/475 (99.79%), Postives = 475/475 (100.00%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDR 1558
            MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSEL+RRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDR
Sbjct:    1 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELIRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDR 475          
BLAST of mre11-like protein vs. TrEMBL
Match: A0A0X9SLY9 (Putative MRE11 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 428/429 (99.77%), Postives = 429/429 (100.00%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNR 1420
            MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSEL+RRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNR
Sbjct:    1 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELIRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNR 429          
BLAST of mre11-like protein vs. TrEMBL
Match: V3ZT04 (Double-strand break repair protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_108504 PE=3 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 7.681e-170
Identity = 252/503 (50.10%), Postives = 350/503 (69.58%), Query Frame = 2
Query:  140 DEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPN---VSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMK--TNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKR 1633
            DE+ LKI+L+TD HLG+ EKDPIRGNDS ++FEEIL I+K+K  DF+LLGGDL+H+NKPS  +L     L+RRY   + PI+F+ +SDQ+INF   + F   N+ D+N NV +P+F+IHGNHDDP  Q NLC+LDL H+ GLVN FGK+ S+E I + P+L+QKGNTKLALYGLG++R+ERLHR+F  K     RP++  ++WF++FVIHQNR KH A NYIPE F+  F+DLV WGHEH+CRIDPE+N +Q FYV+QPGSS+ATSLS+GES +K++G L I+GKDFK+ KIPL+TVR F I     ED   S +   PN   V ++VE +C  K+E+LL   + + T +++QP  PLIRL +DYSGGFE FS  RF Q+++ KIANPKD+++  RK+  + ++      D   L +        LD  RVEDM++ +F K  +  KL +L+EK + + ++  +DK++++ +  LV  ++ +   +L      E  I  EI R
Sbjct:    7 DENMLKILLATDIHLGYMEKDPIRGNDSLVSFEEILEIAKKKDVDFVLLGGDLYHDNKPSRKTLHGSIALLRRYCMGDRPIQFEFLSDQSINFDHCQ-FPTLNYEDQNFNVNMPVFSIHGNHDDPTGQGNLCSLDLLHSAGLVNYFGKTTSLEKIQLSPLLLQKGNTKLALYGLGSVRDERLHRMFVHKNCAMLRPKENKDDWFNLFVIHQNRSKHTATNYIPEQFLDDFLDLVFWGHEHECRIDPEWNGNQNFYVTQPGSSIATSLSEGESKEKHVGLLMIRGKDFKLTKIPLETVRQFYI-----EDVVLSDTTLDPNDHDVGQKVESYCQQKVENLLLKAEAEHTGNAKQPDKPLIRLRIDYSGGFEPFSVYRFGQKFVDKIANPKDIVLFQRKKVHSIKKD-----DGDELELLAKIKPQSLDSARVEDMVRDYFTKVESGSKLQVLTEKGMGDAIKEYVDKEEREAISELVKYQVGKTQKYLKQRNADEEVIDVEICR 498          
BLAST of mre11-like protein vs. TrEMBL
Match: K1PK70 (Double-strand break repair protein OS=Crassostrea gigas OX=29159 GN=CGI_10008894 PE=3 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 7.795e-168
Identity = 252/501 (50.30%), Postives = 352/501 (70.26%), Query Frame = 2
Query:  137 SDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKT--NEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKR 1633
            S ED  KII++TD HLG+ EKD IRGNDS +TFEEIL  +K+   DF+LLGGDLFHENKP    +  C  L+R++ F + PI F+ +SDQ+ +F   + F   N+ D NLNV IP+F+IHGNHDDP  Q NLC+LDL H+ GL+N FGK+ S+E I + P+L+QKGNTKLALYGLG++R+ERLHRLF  K VT  RP++  E+WF++FVIHQNR KH+  +YIPE F+  F+DLVIWGHEH+CR++PE+N+SQ F+VSQPGSSVATSLS+GE++KK+IG L IKGK+FKI KIPL TVR F +    +   E  ++ +  ++ R+VE +C  K+E +L     + + + +QP  PL+RL +DY+GGFE FS  RF Q+++ K+ANPKD  M+H  R +  + + ++  D VI    +V+ D  LD +RVEDM+K  F     N +L LL+EK + + ++  +DK++K+ +  LV  ++ +   HL    I E+ IV+E+ R
Sbjct:    5 SSEDVFKIIVATDIHLGYGEKDVIRGNDSLVTFEEILENAKKHEADFILLGGDLFHENKPPRRIMHGCISLLRKFCFGDKPILFEYLSDQSADFKHCQ-FPTLNYEDTNLNVSIPVFSIHGNHDDPSGQGNLCSLDLLHSAGLMNYFGKTTSLEKIEMSPLLMQKGNTKLALYGLGSVRDERLHRLFVHKNVTMLRPKENQEDWFNVFVIHQNRAKHSTTSYIPEQFLDDFLDLVIWGHEHECRLEPEWNSSQNFFVSQPGSSVATSLSEGETVKKHIGLLQIKGKNFKITKIPLTTVRQFYM--EDVVLSETELNPADHDIDRKVEAYCFEKVEAILEKAALEHSGNRRQPDKPLVRLRIDYTGGFEPFSGYRFGQKFVDKVANPKD--MIHFTRRKITKVKTDEK-DPVI---GDVKVD-NLDTSRVEDMVKDIFSNADQNWQLKLLTEKGMGDAVQEYVDKEEKEAISELVKYQLEKTQTHLKQRNISEDLIVDEVNR 495          
BLAST of mre11-like protein vs. TrEMBL
Match: A0A210QGS1 (Double-strand break repair protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05428 PE=3 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 8.206e-168
Identity = 246/501 (49.10%), Postives = 349/501 (69.66%), Query Frame = 2
Query:  137 SDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEK--LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKR 1633
            S++DTLKI+++TD HLG+ EKD IRGNDS ++FEEIL  +K+   DF+LLGGDLFHENKP    +  C  L R+Y   + P++F+ +SDQ+ +F   + F + N+ D NLNV IP+F+IHGNHDDP  Q NLC LD+ H +G VN FGK  S+E I + P+L+QKG+TKLA+YGLG+IR+ERLHR+F +K V+  RP +  E WF++FVIHQNR KH   NYIPE F+  F+DLVIWGHEH+CRI+PE+N+ Q FYVSQPGSSVATSLS+GE++KK+IG L IKGK+FK+ KIPL+TVRPF +  ++L D          N++++VE FC  K+E LL   + + + +S+QP  PLIRL +DYSGGFE FS+ RF Q++I K+ANPKD++   RK+    +  + + + +    +  ++ D  LD +RVEDM+K +F  ++ K  L LL+EK +   ++  +DK++++ +  LV  ++ +   +L      E  I  E+ R
Sbjct:    7 SEDDTLKILVATDIHLGYAEKDGIRGNDSLVSFEEILENAKKHDVDFILLGGDLFHENKPPRRIMHGCISLFRKYCMGDKPVQFEYLSDQSKDFNHCQ-FPYLNYEDPNLNVSIPVFSIHGNHDDPTGQGNLCTLDILHTSGFVNYFGKHTSLEKIEMSPLLLQKGSTKLAMYGLGSIRDERLHRMFLKKTVSMLRPRENQEEWFNMFVIHQNRSKHTTTNYIPEQFLDDFLDLVIWGHEHECRIEPEWNSVQNFYVSQPGSSVATSLSEGETVKKHIGLLQIKGKNFKMTKIPLETVRPFYMEDVVLSDTSLDPQDH--NIAKKVEAFCAEKVEGLLEKAESEHSGNSKQPDKPLIRLRIDYSGGFEPFSAHRFGQKFIDKVANPKDMVQFQRKKVLATKSDSKEDMGD----LGAIKAD-ALDTSRVEDMVKDYFSSSDCKMQLKLLTEKGMGQAVQEFVDKEEREAISELVKYQLQKTQTYLKQRNANEEIIDAEVTR 499          
BLAST of mre11-like protein vs. Ensembl Cavefish
Match: mre11a (MRE11 homolog, double strand break repair nuclease [Source:NCBI gene;Acc:103034489])

HSP 1 Score: 490.73 bits (1262), Expect = 6.485e-165
Identity = 244/505 (48.32%), Postives = 349/505 (69.11%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
            TM D+DT KI+++TD HLG+ EKD +RGND+F+TF+EI+  +K+   DF+LLGGDLFH+NKPS  ++  C E++R+Y   +NPI F I+SDQA+NF  S  F   N+ DENLN+ IPIF++HGNHDDP     LCALDL    G VN FG+S SVE + I P+L+QKG+TK+ALYG+G+I +ERL+R+F   +VT  RP ++ E+WF++FVIHQNR KH A NYIPE F+  F+DLV+WGHEH+C+I P  N  Q FYV+QPGSSV TSLS GE++KK+IG L +KG+   + KIPLQTVR F I  + L D  E  S   PNV+++V+ FC  K+E++L   + +   +   P  PLIRL VDYSGGFE F++MRFSQ+++ ++ANPKD+L   R RE  +  +      +++LS    R    + + RVED++K++F   + N +L LL+E+ +   ++  +DK++KD +  L++ ++ +    L   +++  E  I EEI+R
Sbjct:    7 TMDDDDTFKILIATDIHLGYLEKDAVRGNDTFVTFDEIMKYAKEHDVDFVLLGGDLFHDNKPSRKAMHSCMEIMRKYCMGDNPILFDILSDQAVNFGNSR-FPWVNYQDENLNISIPIFSVHGNHDDPTGADGLCALDLLSCAGFVNHFGRSRSVEKLEISPVLLQKGSTKIALYGIGSIPDERLYRMFVNNQVTMLRPREDEESWFNLFVIHQNRSKHGATNYIPEQFLDDFLDLVVWGHEHECKITPARNEQQLFYVTQPGSSVVTSLSPGEAVKKHIGLLRVKGRKMNLQKIPLQTVRQFLIEDVTLADYSELFSPEQPNVTQKVQAFCQQKVEEMLEEAERERLGNPLTPEKPLIRLRVDYSGGFESFNTMRFSQKFVDRVANPKDILHFVRHRESKDNVKEEAIDFDMLLS----RPSADILQLRVEDLVKEYFQTAEKNMQLSLLTEQGMGKAVQEYVDKEEKDAIEELINYQLEKTQRFLRERRVEASEEKIDEEIRR 506          
BLAST of mre11-like protein vs. Ensembl Cavefish
Match: mre11a (MRE11 homolog, double strand break repair nuclease [Source:NCBI gene;Acc:103034489])

HSP 1 Score: 490.73 bits (1262), Expect = 6.485e-165
Identity = 244/505 (48.32%), Postives = 349/505 (69.11%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIK--ENFIVEEIKR 1633
            TM D+DT KI+++TD HLG+ EKD +RGND+F+TF+EI+  +K+   DF+LLGGDLFH+NKPS  ++  C E++R+Y   +NPI F I+SDQA+NF  S  F   N+ DENLN+ IPIF++HGNHDDP     LCALDL    G VN FG+S SVE + I P+L+QKG+TK+ALYG+G+I +ERL+R+F   +VT  RP ++ E+WF++FVIHQNR KH A NYIPE F+  F+DLV+WGHEH+C+I P  N  Q FYV+QPGSSV TSLS GE++KK+IG L +KG+   + KIPLQTVR F I  + L D  E  S   PNV+++V+ FC  K+E++L   + +   +   P  PLIRL VDYSGGFE F++MRFSQ+++ ++ANPKD+L   R RE  +  +      +++LS    R    + + RVED++K++F   + N +L LL+E+ +   ++  +DK++KD +  L++ ++ +    L   +++  E  I EEI+R
Sbjct:    7 TMDDDDTFKILIATDIHLGYLEKDAVRGNDTFVTFDEIMKYAKEHDVDFVLLGGDLFHDNKPSRKAMHSCMEIMRKYCMGDNPILFDILSDQAVNFGNSR-FPWVNYQDENLNISIPIFSVHGNHDDPTGADGLCALDLLSCAGFVNHFGRSRSVEKLEISPVLLQKGSTKIALYGIGSIPDERLYRMFVNNQVTMLRPREDEESWFNLFVIHQNRSKHGATNYIPEQFLDDFLDLVVWGHEHECKITPARNEQQLFYVTQPGSSVVTSLSPGEAVKKHIGLLRVKGRKMNLQKIPLQTVRQFLIEDVTLADYSELFSPEQPNVTQKVQAFCQQKVEEMLEEAERERLGNPLTPEKPLIRLRVDYSGGFESFNTMRFSQKFVDRVANPKDILHFVRHRESKDNVKEEAIDFDMLLS----RPSADILQLRVEDLVKEYFQTAEKNMQLSLLTEQGMGKAVQEYVDKEEKDAIEELINYQLEKTQRFLRERRVEASEEKIDEEIRR 506          
BLAST of mre11-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007314.1 (pep scaffold:Pmarinus_7.0:GL477468:25444:77105:1 gene:ENSPMAG00000006588.1 transcript:ENSPMAT00000007314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 5.776e-64
Identity = 118/299 (39.46%), Postives = 192/299 (64.21%), Query Frame = 2
Query:  782 KHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHF--MKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKE-NFIVEEIKRKVEALERMIMID 1669
            KH+A NYIPE F+ SF+DLV+WGHEH+C I P  N  + FYV+QPGSSV TSLS GE++ K++G L + GK   + KIPL+TVR F I    +  ++ +I+ S P V++ +E +C  K+ED+L     + + HS+QP  PLIRL +DYSGGFE F+++RFSQ+++  + NPKD++   R+RE   R  +   +D    + S+V +  G +  RVED++K++F   + N +L LL+E+ +   ++  +DK++K+ +  LV  ++++   HL   ++   + I EE++   E+ ++ +  D
Sbjct:    7 KHSATNYIPEHFLYSFLDLVVWGHEHECLIKPMRNEQRLFYVTQPGSSVVTSLSPGEAVAKHVGILHVHGKRMNLQKIPLKTVRQFYI--QDVVLQDTTINPSHPKVTQMIENYCSEKVEDMLEQAAAERSGHSKQPDRPLIRLRIDYSGGFEPFNTLRFSQKFVEHVGNPKDIIHFFRQREMKARTVSGDEMD-FGQAFSHVAH--GENTLRVEDLVKEYFKSAEKNVQLALLTERGMGAAVQEFVDKEEKEAISELVKVQLTKTQEHLKKTEVSSVDTIDEEVRHFRESCKKNMQED 300          
BLAST of mre11-like protein vs. Ensembl Yeast
Match: MRE11 (Nuclease subunit of the MRX complex with Rad50p and Xrs2p; complex functions in repair of DNA double-strand breaks and in telomere stability; Mre11p associates with Ser/Thr-rich ORFs in premeiotic phase; nuclease activity required for MRX function; widely conserved; forms nuclear foci upon DNA replication stress [Source:SGD;Acc:S000004837])

HSP 1 Score: 329.331 bits (843), Expect = 1.223e-103
Identity = 189/523 (36.14%), Postives = 296/523 (56.60%), Query Frame = 2
Query:  140 DEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIK-GKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTL-----PLIRLAVDYSG--------GFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFI----VEEIKRKVEALER 1654
            D DT++I+++TDNH+G+NE DPI G+DS+ TF E++ ++K    D ++  GDLFH NKPS  SL++  + +R     + P + +++SD +  F+  E F + N+ D N N+ IP+F I GNHDD    S LC +D+ HATGL+N FGK    + I + P+L QKG+TKLALYGL A+R+ERL R F+   VTF  P      WF++  +HQN   H    ++PE F+P F+D+VIWGHEH+C  +  +N  + F V QPGSSVATSL + E+  KY+  L IK G+  K+  IPL+T+R F +  I L+D            S+ + +     + D    TK+++ +  +   +     PLIRL VDYS          +++ +  RFS  ++G++AN  +++  ++KR    R + +  ++   +S  +V          +E     + +    +L LL E  L+  ++  +DKD+K  L   +  EIS  +G L TN   E F+     EE+K  ++ ++R
Sbjct:    5 DPDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDMVVQSGDLFHVNKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYDE-FTNVNYEDPNFNISIPVFGISGNHDDASGDSLLCPMDILHATGLINHFGKVIESDKIKVVPLLFQKGSTKLALYGLAAVRDERLFRTFKDGGVTFEVPTMREGEWFNLMCVHQNHTGHTNTAFLPEQFLPDFLDMVIWGHEHECIPNLVHNPIKNFDVLQPGSSVATSLCEAEAQPKYVFILDIKYGEAPKMTPIPLETIRTFKMKSISLQDVPHLRPHDKDATSKYLIEQVEEMIRDANEETKQKLADDGEGDMVAELPKPLIRLRVDYSAPSNTQSPIDYQVENPRRFSNRFVGRVANGNNVVQFYKKRSPVTRSKKSG-INGTSISDRDVEKLFSESGGELEVQTLVNDLLNKMQLSLLPEVGLNEAVKKFVDKDEKTALKEFISHEISNEVGILSTN---EEFLRTDDAEEMKALIKQVKR 522          
BLAST of mre11-like protein vs. Ensembl Nematostella
Match: EDO36351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW1])

HSP 1 Score: 459.529 bits (1181), Expect = 4.410e-153
Identity = 246/538 (45.72%), Postives = 350/538 (65.06%), Query Frame = 2
Query:  146 DTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEY--NTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIK-GKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTN--HSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVL--LSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLG--TNKIKENFIVEEIKRKVEALERMIMIDXXXXXXXIGSYQEGRNVVETD 1732
            +TL I+++TD HLG+ EKD +RGNDSF+TFEE L I+K++  DF+LLGGDL+HENKPS  +L     L R++   +   + + +SDQ+INF  +  F   N+ D NLNV IP+F+IHGNHDDP  + NLCALDL    GLVN FG+  SV+ I + P+L+QKG TKLALYGLG++R+ERLHR F   KV   RP+++ ++WF+ FV+HQNR KH   NYIPE F+ +F+DLV+WGHEH+C IDP    +TS  F+++QPGS+VATSLS GES +K++G L I+  K FK+ K+PLQTVRPF +     ED   S +   P    ++  F   K+E L++  +++     H ++P+ PLIRL VDYSGGF+ FS++RF Q+++ ++ANPKD+L+ HRK+ Q    QA     ++   + ++R +  LD  R+ED++K +    +  L L  LSE R++  LR  +DKD+KD +  LV  ++     HL    N   EN  +EE  +K   L R    D+EEE++      E R+ V  D
Sbjct:   49 NTLSILIATDVHLGYAEKDQVRGNDSFVTFEETLQIAKKRNVDFILLGGDLYHENKPSRRTLHASMALFRKFCMGDRVCEVEFLSDQSINFANNR-FPWVNYEDPNLNVSIPVFSIHGNHDDPAGEGNLCALDLLSVCGLVNYFGRPASVDDITVSPLLLQKGATKLALYGLGSVRDERLHRTFVNNKVKMLRPKEDPDSWFNAFVLHQNRAKHGHTNYIPEKFLDTFLDLVVWGHEHECLIDPRQSDDTSLPFWITQPGSTVATSLSPGESKQKHVGILEIRPDKAFKMTKVPLQTVRPFYM-----EDIILSDTDLDPADEERIYAFLTDKVEQLISRAEDEHAGNIHPRKPSKPLIRLRVDYSGGFQSFSTLRFGQQFVDRVANPKDILLFHRKKVQ----QAKGIRPDIDEKLLHLRPEA-LDNTRMEDLVKDYLRSKDNALDLQILSENRMAQALREFVDKDEKDAIQTLVSWQLEVTQKHLKQRNNVTAEN--IEEAAQKYTELRRQKEGDQEEEEQIKKVLAESRSQVHDD 573          
BLAST of mre11-like protein vs. Ensembl Medaka
Match: mre11a (MRE11 homolog, double strand break repair nuclease [Source:NCBI gene;Acc:101163100])

HSP 1 Score: 484.567 bits (1246), Expect = 1.010e-162
Identity = 239/487 (49.08%), Postives = 333/487 (68.38%), Query Frame = 2
Query:  131 TMSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEK--LVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHL 1585
            T+ DEDT KI+++TD HLG+ EK+ IRGND++ TFEEIL  +K K  DF+LLGGDLFH+NKPS  SL  C+ L+R+Y   ++P+ F I+SDQ  NF  ++ F   N+ DENLN+ IP+F+IHGNHDDP     LCALDL  A GLVN FG SNSVE I I PIL+QKGNTKLAL+GLG+I +ERL+R+F  K+V+  RP+++ ++WF++F IHQNR KH   NYIPE F+  F+DLV+WGHEH+C I P  N  Q FYV+QPGSSVATSLS GE+ KK+IG L +KG+   + KIPL+TVR F    ++L D E+  +  +  V+++VE  C+ K+ +++   + +       P  PLIRL VDYSGGFE FS+ RFSQ+++  +ANPKD++   R+REQ    +     D V +  S +     ++  RVED++KQ+F    +K  L LL+E+ +   ++  +DKD+KD +  L+  ++ +   HL
Sbjct:    6 TLDDEDTFKILIATDVHLGYLEKNAIRGNDTYQTFEEILQCAKDKKVDFILLGGDLFHDNKPSRRSLHICTTLLRKYCMGDSPVTFNILSDQTTNFNTTQ-FPWVNYQDENLNISIPVFSIHGNHDDPTGAEGLCALDLLSAAGLVNHFGHSNSVERIEISPILMQKGNTKLALFGLGSIPDERLYRMFVNKQVSMLRPKEDQDDWFNLFTIHQNRSKHGPTNYIPEQFLDDFLDLVVWGHEHECLITPTRNEQQHFYVTQPGSSVATSLSPGEATKKHIGLLRVKGRKMNLQKIPLKTVRQFITQDVVLADYEDLFTPDTHQVTKKVEDLCYAKVTEMIEEAERERLGCPLTPEKPLIRLRVDYSGGFEAFSTSRFSQKFVDCVANPKDIIHFMRRREQKVDFK-----DEVNVDYSKLVKTVAVEGLRVEDLVKQYFEAAEQKVQLSLLTEQGMGKAIQEFVDKDEKDAIEELIRYQLEKTQRHL 486          
BLAST of mre11-like protein vs. Planmine SMEST
Match: SMESG000014105.1 (SMESG000014105.1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 522/550 (94.91%), Postives = 532/550 (96.73%), Query Frame = 2
Query:  134 MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFAIGKXXXXXXXXXXXXXXPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKRKVEALERMIMIDXXXXXXXIGSYQEGRNVVETDPKPKKKQNKGISETSGI 1783
            M+ EDTLKIILSTDNHLG+NEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSEL+RRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPF IGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKRKVEALERMIMIDEEEEQEEIGSYQ     ++  P  +K + +G  +   +
Sbjct:    1 MNGEDTLKIILSTDNHLGYNEKDPIRGNDSFITFEEILSISKQKAPDFMLLGGDLFHENKPSISSLFKCSELIRRYSFNNNPIKFKIISDQAINFYQSEYFKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGKSNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEYNTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVRPFVIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHSQQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQTNREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSEKRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKRKVEALERMIMIDEEEEQEEIGSYQGVGLSLKLIPNQRKNKIRGFPKRQAL 550          

HSP 2 Score: 84.7297 bits (208), Expect = 6.265e-17
Identity = 42/49 (85.71%), Postives = 45/49 (91.84%), Query Frame = 3
Query: 1692 LGRIKRVGMSLKLIPNPRKNKIRGFPKRQALIAIFMSLIATVSTRISLT 1838
            +G  + VG+SLKLIPN RKNKIRGFPKRQALIAIFMSLIATVSTRISLT
Sbjct:  520 IGSYQGVGLSLKLIPNQRKNKIRGFPKRQALIAIFMSLIATVSTRISLT 568          
The following BLAST results are available for this feature:
BLAST of mre11-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRE115.490e-16247.33MRE11 homolog, double strand break repair nuclease... [more]
MRE118.062e-16247.33MRE11 homolog, double strand break repair nuclease... [more]
MRE119.095e-16247.33MRE11 homolog, double strand break repair nuclease... [more]
MRE114.265e-16147.61MRE11 homolog, double strand break repair nuclease... [more]
MRE114.815e-8555.76MRE11 homolog, double strand break repair nuclease... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mre-115.196e-10542.72Double-strand break repair protein mre-11 [Source... [more]
mre-115.196e-10542.72Double-strand break repair protein mre-11 [Source... [more]
mre-115.196e-10542.72Double-strand break repair protein mre-11 [Source... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mre112.917e-12040.70gene:FBgn0020270 transcript:FBtr0080213[more]
back to top
BLAST of mre11-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mre11a3.716e-16148.12MRE11 homolog A, double strand break repair nuclea... [more]
mre11a8.416e-16148.12MRE11 homolog A, double strand break repair nuclea... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mre117.082e-16347.63MRE11 homolog , double strand break repair nucleas... [more]
mre111.400e-16247.63MRE11 homolog , double strand break repair nucleas... [more]
mre112.350e-16247.63MRE11 homolog , double strand break repair nucleas... [more]
mre111.061e-16147.15MRE11 homolog , double strand break repair nucleas... [more]
mre111.404e-16147.43MRE11 homolog , double strand break repair nucleas... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mre11a1.513e-16347.55MRE11A homolog A, double strand break repair nucle... [more]
Mre11a1.434e-15045.60MRE11A homolog A, double strand break repair nucle... [more]
Mre11a1.029e-7657.07MRE11A homolog A, double strand break repair nucle... [more]
Mre11a5.477e-2540.50MRE11A homolog A, double strand break repair nucle... [more]
Mre11a2.784e-1356.86MRE11A homolog A, double strand break repair nucle... [more]
back to top
BLAST of mre11-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JIM0|MRE11_RAT2.837e-16346.97Double-strand break repair protein MRE11 OS=Rattus... [more]
sp|Q61216|MRE11_MOUSE1.058e-16247.55Double-strand break repair protein MRE11 OS=Mus mu... [more]
sp|P49959|MRE11_HUMAN3.872e-16147.33Double-strand break repair protein MRE11 OS=Homo s... [more]
sp|Q60HE6|MRE11_MACFA4.183e-16146.88Double-strand break repair protein MRE11 OS=Macaca... [more]
sp|Q9W6K1|MRE11_XENLA2.185e-16047.34Double-strand break repair protein MRE11 OS=Xenopu... [more]
back to top
BLAST of mre11-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJU20.000e+099.79Mre11-like protein (Fragment) OS=Schmidtea mediter... [more]
A0A0X9SLY90.000e+099.77Putative MRE11 (Fragment) OS=Schmidtea mediterrane... [more]
V3ZT047.681e-17050.10Double-strand break repair protein OS=Lottia gigan... [more]
K1PK707.795e-16850.30Double-strand break repair protein OS=Crassostrea ... [more]
A0A210QGS18.206e-16849.10Double-strand break repair protein OS=Mizuhopecten... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mre11a6.485e-16548.32MRE11 homolog, double strand break repair nuclease... [more]
mre11a6.485e-16548.32MRE11 homolog, double strand break repair nuclease... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007314.15.776e-6439.46pep scaffold:Pmarinus_7.0:GL477468:25444:77105:1 g... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MRE111.223e-10336.14Nuclease subunit of the MRX complex with Rad50p an... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO363514.410e-15345.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mre11-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mre11a1.010e-16249.08MRE11 homolog, double strand break repair nuclease... [more]
back to top
BLAST of mre11-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000014105.16.265e-1794.91SMESG000014105.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007929
GenBankACT98279.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007929 ID=SMED30007929|Name=mre11-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2028bp
TAAAAATCCAATTTTTTAAAAATTAAGCTTTGTATAAATTTTTAATTATA
CATTGAAATAAGATTTTAATAAAGATTATCTAGTTGATGAAACTTCGTAA
AGCACTATTTTAAAAATAATCCGTCAAATTACAATGAGTGATGAAGACAC
TTTGAAGATAATTTTATCAACAGATAATCATCTTGGTTTTAATGAAAAAG
ATCCAATTAGAGGAAATGATTCATTCATTACATTTGAAGAAATTCTTTCA
ATATCTAAACAAAAAGCTCCAGATTTTATGTTATTAGGTGGCGATCTATT
TCACGAAAACAAACCTTCGATTTCATCGTTATTTAAATGTTCCGAGCTAG
TAAGAAGATATTCATTCAATAACAATCCAATTAAATTCAAAATAATCAGC
GATCAGGCCATTAATTTTTATCAAAGCGAATATTTCAAGCACGCTAATTT
CAATGATGAAAATCTCAACGTCGGTATTCCAATATTTACAATTCACGGCA
ATCACGATGATCCAATCGACCAATCTAATCTTTGTGCTCTGGATTTATTT
CACGCAACCGGCTTAGTTAATCTATTTGGAAAATCAAACTCTGTTGAATC
AATTATCATTCAACCTATTTTAATACAAAAAGGCAATACAAAACTCGCGC
TTTACGGCCTCGGAGCAATACGAAACGAAAGATTGCATCGATTATTTGAG
CAGAAAAAAGTTACATTCTTTCGACCAGAACAAGAATCAGAGAATTGGTT
TTCAATTTTCGTAATCCACCAAAACCGTGTCAAGCATGCAGCGAAGAATT
ACATCCCTGAATCCTTCATTCCGTCTTTCATCGATCTCGTTATCTGGGGT
CATGAACACGATTGCCGAATCGATCCCGAGTACAACACTAGCCAACAGTT
TTACGTTTCCCAACCCGGCAGTTCCGTCGCTACATCGCTGTCGGATGGAG
AATCTCTCAAGAAATATATTGGTTTCCTTTCAATCAAAGGGAAAGATTTC
AAAATCGATAAAATCCCCCTGCAAACTGTTCGGCCTTTCGCCATTGGGAA
AATTATCCTCGAAGATGAAGAAGAATCGATTTCGTTGTCGAGTCCAAATG
TCTCGCGACAAGTGGAGAAATTTTGCCACGGGAAAATGGAAGACCTGCTG
GCTACGACTAAGGAACAGGTGACGAATCACTCACAACAGCCGACTCTGCC
ATTGATCCGATTGGCTGTTGATTACAGTGGCGGATTCGAAATGTTCAGTT
CGATGAGATTCAGCCAGGAATATATCGGGAAAATTGCCAATCCGAAAGAC
CTGTTGATGTTGCATCGAAAGCGAGAGCAAACAAATCGGGAACAGGCTAA
CAAAACCGTTGACAATGTCATTTTGAGTGTGTCGAATGTCCGAAACGATT
GCGGACTCGATCGGAACCGAGTGGAAGATATGATCAAACAGCATTTCATG
AAAACCAATGAGAAATTGGTGTTGCTGAGTGAGAAACGTTTGTCAAATGG
GCTGAGGCTGTCAATCGACAAGGATGACAAAGATCGGTTGTTTGGGCTAG
TTGATAGGGAAATCAGTGAAATGATTGGACATTTAGGGACGAATAAGATT
AAGGAGAATTTTATTGTCGAGGAAATCAAACGGAAAGTCGAGGCATTGGA
AAGGATGATAATGATCGATGAGGAGGAGGAACAAGAGGAAATTGGGTCGT
ATCAAGAGGGTAGGAATGTCGTTGAAACTGATCCCAAACCCAAGAAAAAA
CAAAATAAGGGGATTTCCGAAACGTCAGGCATTGATTGCGATATTTATGT
CGTTAATAGCGACAGTGTCGACTCGAATTTCACTGACACCGGTGTGAGTT
CCCGTAAGCGTAAACTGAACCCCACAATTGATGATGACGATGATGGCAAA
GGAAAAAAGAAATCAAAAAATACTCGCAAAAAAAAATTAAATTTTTAAAT
GTTTATTAATAAAATTGTTTCGTTGTCTTGGTAGCTGTTGTCGTCGTCGT
CGTCATTCTAGATTGTCTTCACGCTCGT
back to top

protein sequence of SMED30007929-orf-1

>SMED30007929-orf-1 ID=SMED30007929-orf-1|Name=SMED30007929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=605bp
MSDEDTLKIILSTDNHLGFNEKDPIRGNDSFITFEEILSISKQKAPDFML
LGGDLFHENKPSISSLFKCSELVRRYSFNNNPIKFKIISDQAINFYQSEY
FKHANFNDENLNVGIPIFTIHGNHDDPIDQSNLCALDLFHATGLVNLFGK
SNSVESIIIQPILIQKGNTKLALYGLGAIRNERLHRLFEQKKVTFFRPEQ
ESENWFSIFVIHQNRVKHAAKNYIPESFIPSFIDLVIWGHEHDCRIDPEY
NTSQQFYVSQPGSSVATSLSDGESLKKYIGFLSIKGKDFKIDKIPLQTVR
PFAIGKIILEDEEESISLSSPNVSRQVEKFCHGKMEDLLATTKEQVTNHS
QQPTLPLIRLAVDYSGGFEMFSSMRFSQEYIGKIANPKDLLMLHRKREQT
NREQANKTVDNVILSVSNVRNDCGLDRNRVEDMIKQHFMKTNEKLVLLSE
KRLSNGLRLSIDKDDKDRLFGLVDREISEMIGHLGTNKIKENFIVEEIKR
KVEALERMIMIDEEEEQEEIGSYQEGRNVVETDPKPKKKQNKGISETSGI
DCDIYVVNSDSVDSNFTDTGVSSRKRKLNPTIDDDDDGKGKKKSKNTRKK
KLNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007281Mre11_DNA-bd
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
IPR003701Mre11
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0030870Mre11 complex
Vocabulary: molecular function
TermDefinition
GO:0004519endonuclease activity
GO:0030145manganese ion binding
GO:0016787hydrolase activity
GO:00084083'-5' exonuclease activity
GO:0004518nuclease activity
GO:0004527exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006302double-strand break repair
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0051321meiotic cell cycle
GO:0090305nucleic acid phosphodiester bond hydrolysis