SCO cytochrome c oxidase assembly protein 1

Overview
NameSCO cytochrome c oxidase assembly protein 1
Smed IDSMED30007928
Length (bp)2487
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCO cytochrome c oxidase assembly protein 1 (SMED30007928) t-SNE clustered cells

Violin plots show distribution of expression levels for SCO cytochrome c oxidase assembly protein 1 (SMED30007928) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCO cytochrome c oxidase assembly protein 1 (SMED30007928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCO cytochrome c oxidase assembly protein 1 (SMED30007928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007928

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30007928SMESG000067101.1 SmedASXL_001571SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30007928 SmedASXL_072876SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007928 SmedASXL_072876SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30007928SMESG000067103.1 dd_Smed_v4_2747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30007928SMESG000067101.1 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007928SMESG000067101.1 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO1 (SCO cytochrome c oxidase assembly protein 1 [Source:HGNC Symbol;Acc:HGNC:10603])

HSP 1 Score: 133.265 bits (334), Expect = 4.845e-34
Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            ++ PLF+S+DPERDT E + +Y+KEFS K++GLTG+ E++  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  164 DLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHM 263          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO1 (SCO cytochrome c oxidase assembly protein 1 [Source:HGNC Symbol;Acc:HGNC:10603])

HSP 1 Score: 133.265 bits (334), Expect = 1.042e-33
Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            ++ PLF+S+DPERDT E + +Y+KEFS K++GLTG+ E++  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  195 DLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHM 294          

HSP 2 Score: 76.2554 bits (186), Expect = 2.760e-14
Identity = 36/108 (33.33%), Postives = 60/108 (55.56%), Query Frame = 3
Query:  306 SSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S+ P +    S  +L  +   G   +AG  +    + + +   ++ +    +G PL+GG F L  H G   +  D+  +WLLIYFGF +CPDVCP+++EK++ VVD +
Sbjct:   84 STRPSKPGPVSWKSLAITFAIGGALLAGMKH----VKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEI 187          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 113.62 bits (283), Expect = 2.453e-27
Identity = 49/105 (46.67%), Postives = 76/105 (72.38%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            V P+F++VDPERD  E M  Y+++F  ++LGLTGS + +   S +YR+YY+ GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I+ S++ HM   ++V
Sbjct:  160 VQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSV 264          

HSP 2 Score: 80.4925 bits (197), Expect = 6.103e-16
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  417 EFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            E E+L  Q K  E +    +G GDFHL+DH G +    DFR +W+L+YFGF +CPD+CPD++EK+V VV +L
Sbjct:   81 EKERL-QQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQL 151          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 113.62 bits (283), Expect = 2.453e-27
Identity = 49/105 (46.67%), Postives = 76/105 (72.38%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            V P+F++VDPERD  E M  Y+++F  ++LGLTGS + +   S +YR+YY+ GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I+ S++ HM   ++V
Sbjct:  160 VQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSV 264          

HSP 2 Score: 80.4925 bits (197), Expect = 6.103e-16
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  417 EFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            E E+L  Q K  E +    +G GDFHL+DH G +    DFR +W+L+YFGF +CPD+CPD++EK+V VV +L
Sbjct:   81 EKERL-QQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQL 151          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 113.62 bits (283), Expect = 2.453e-27
Identity = 49/105 (46.67%), Postives = 76/105 (72.38%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            V P+F++VDPERD  E M  Y+++F  ++LGLTGS + +   S +YR+YY+ GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I+ S++ HM   ++V
Sbjct:  160 VQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSV 264          

HSP 2 Score: 80.4925 bits (197), Expect = 6.103e-16
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  417 EFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            E E+L  Q K  E +    +G GDFHL+DH G +    DFR +W+L+YFGF +CPD+CPD++EK+V VV +L
Sbjct:   81 EKERL-QQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQL 151          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Celegans
Match: sco-1 (SCO (Yeast Suppressor of Cytochrome Oxidase deficiency) homolog [Source:UniProtKB/TrEMBL;Acc:Q17557])

HSP 1 Score: 124.405 bits (311), Expect = 5.375e-31
Identity = 60/119 (50.42%), Postives = 86/119 (72.27%), Query Frame = 3
Query: 2136 LMDLILAQKKIN-VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPV--DKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQA 2483
            ++++I A+K    +VP+F+SVDPERD+   +K+Y  EFSNK+ G TG+ E ++ V+KT+R+Y+S+GP    +  DYIVDH +IMYLI P G+F +YYGQNR   EIA  I+  +LK QA
Sbjct:  184 VVEIIEAKKDATPIVPVFISVDPERDSVARVKEYCSEFSNKLRGFTGTTEQVNKVAKTFRVYHSQGPRTNKQEDDYIVDHTVIMYLIDPSGQFHDYYGQNRKAEEIANVIEMKVLKYQA 302          

HSP 2 Score: 81.6481 bits (200), Expect = 1.755e-16
Identity = 40/95 (42.11%), Postives = 55/95 (57.89%), Query Frame = 3
Query:  339 KMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVD 623
            K  L T    G+   A ++ KK R+DE EK   Q       G   IGG++ L++ +G      + R  WLL+YFGF NCPD+CPD+IEK+V VV+
Sbjct:   97 KTVLGTFAVGGTCLAALFYIKKIRLDEREKHRKQT-----AGKARIGGEWELMNTDGKMEGSQELRGNWLLMYFGFTNCPDICPDEIEKMVKVVE 186          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Fly
Match: Scox (gene:FBgn0262467 transcript:FBtr0079052)

HSP 1 Score: 126.331 bits (316), Expect = 3.914e-32
Identity = 56/95 (58.95%), Postives = 73/95 (76.84%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSI 2456
            V P+F++VDPERD+ E++  Y+KEFS K+LGLTG+VE I  V K +R+Y+S GP D+  DYIVDH IIMYL+ P+GEFV+YYGQNR   +   SI
Sbjct:  140 VQPIFITVDPERDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASI 234          

HSP 2 Score: 72.4034 bits (176), Expect = 1.088e-13
Identity = 41/108 (37.96%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  306 SSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S+  K    +  +A+  ++ AG +      Y K   DE      Q +L    G   IGG + LVD  G      DF  KWLLIYFGF +CPD+CPD++EK+  VVD +
Sbjct:   30 STKGKGPISWRSLAVIGALGAGGVGF--MLYVKSEKDEARMKERQRQL----GKAAIGGSWELVDSQGAVRKSEDFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEV 131          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 127.872 bits (320), Expect = 7.276e-32
Identity = 53/87 (60.92%), Postives = 71/87 (81.61%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNR 2429
            +V PL +S+DPERDTPE +  Y+K+FS K++GLTG+   I  VS+ YR+YYS+GP D+  DYIVDH IIMYL+GP+G+F+EYYGQN+
Sbjct:  212 DVTPLLISIDPERDTPEALAAYVKDFSPKLIGLTGTTAQIEQVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGQFLEYYGQNK 298          

HSP 2 Score: 83.1889 bits (204), Expect = 8.769e-17
Identity = 36/92 (39.13%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  354 TSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            T    G + +A  ++K+ + + FEK     +  + +G P +GG F L+DHN       DF  +WLLIYFGF +CPD+CPD++EK++  VD +
Sbjct:  118 TFALGGGLLLAMKYFKREKEELFEK-----ERTKSIGKPALGGPFSLLDHNNKPSRSEDFLGRWLLIYFGFTHCPDICPDELEKMIEAVDEI 204          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 127.487 bits (319), Expect = 9.405e-32
Identity = 53/87 (60.92%), Postives = 71/87 (81.61%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNR 2429
            +V PL +S+DPERDTPE +  Y+K+FS K++GLTG+   I  VS+ YR+YYS+GP D+  DYIVDH IIMYL+GP+G+F+EYYGQN+
Sbjct:  212 DVTPLLISIDPERDTPEALAAYVKDFSPKLIGLTGTTAQIEQVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGQFLEYYGQNK 298          

HSP 2 Score: 83.1889 bits (204), Expect = 8.529e-17
Identity = 36/92 (39.13%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  354 TSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            T    G + +A  ++K+ + + FEK     +  + +G P +GG F L+DHN       DF  +WLLIYFGF +CPD+CPD++EK++  VD +
Sbjct:  118 TFALGGGLLLAMKYFKREKEELFEK-----ERTKSIGKPALGGPFSLLDHNNKPSRSEDFLGRWLLIYFGFTHCPDICPDELEKMIEAVDEI 204          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 110.923 bits (276), Expect = 2.085e-26
Identity = 47/100 (47.00%), Postives = 73/100 (73.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            +V PLF++VDPERD    M  Y+K+F  +++GLTGS E++    + +R+Y S GP D+ GDYIVDH+I++YL+ P+G F++YY + ++  +IA SI+ HM
Sbjct:  171 SVQPLFITVDPERDDVSAMARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDEDGDYIVDHSIVIYLVNPDGLFIDYYNRMKNDTQIAESIRNHM 270          

HSP 2 Score: 77.0258 bits (188), Expect = 5.732e-15
Identity = 44/117 (37.61%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  294 RRFCSSN-PKQDSKYSKMALK-------TSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVV 620
            R F S N PK  +  S   +K       T +F G I    ++  +    E EK I   +L +     L  GDFHL+DH G   +  DF   W+L+YFGF +CPD+CPD++EK+  VV
Sbjct:   48 RAFYSQNSPKTPNPGSSAGIKLRTRLVVTLLFGGGIIGTWWYVHQ----EKEKRIQMQRLEQLRKVALGQGDFHLLDHTGQRRTKRDFLGHWVLLYFGFTHCPDICPDELEKLTSVV 160          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 110.923 bits (276), Expect = 2.085e-26
Identity = 47/100 (47.00%), Postives = 73/100 (73.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            +V PLF++VDPERD    M  Y+K+F  +++GLTGS E++    + +R+Y S GP D+ GDYIVDH+I++YL+ P+G F++YY + ++  +IA SI+ HM
Sbjct:  171 SVQPLFITVDPERDDVSAMARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDEDGDYIVDHSIVIYLVNPDGLFIDYYNRMKNDTQIAESIRNHM 270          

HSP 2 Score: 77.0258 bits (188), Expect = 5.732e-15
Identity = 44/117 (37.61%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  294 RRFCSSN-PKQDSKYSKMALK-------TSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVV 620
            R F S N PK  +  S   +K       T +F G I    ++  +    E EK I   +L +     L  GDFHL+DH G   +  DF   W+L+YFGF +CPD+CPD++EK+  VV
Sbjct:   48 RAFYSQNSPKTPNPGSSAGIKLRTRLVVTLLFGGGIIGTWWYVHQ----EKEKRIQMQRLEQLRKVALGQGDFHLLDHTGQRRTKRDFLGHWVLLYFGFTHCPDICPDELEKLTSVV 160          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Match: sirt4 (sirtuin 4 [Source:Xenbase;Acc:XB-GENE-948981])

HSP 1 Score: 132.109 bits (331), Expect = 5.904e-34
Identity = 57/100 (57.00%), Postives = 77/100 (77.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N+ PLF+++DPERD+ + + +Y+KEFS K++GLTGS E I  V+K YR+Y+S GP D+  DYIVDH IIMYL+ P+G FV+YYGQN+   EI+ SI  HM
Sbjct:  145 NLTPLFITIDPERDSKDAVANYVKEFSPKLIGLTGSSEQIEKVAKAYRVYFSSGPKDEDNDYIVDHTIIMYLLAPDGSFVDYYGQNKRNAEISSSIASHM 244          

HSP 2 Score: 85.1149 bits (209), Expect = 9.870e-18
Identity = 38/96 (39.58%), Postives = 62/96 (64.58%), Query Frame = 3
Query:  345 ALKTSIFAGSIFIAGYFY-KKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +L  ++  G   +AG  Y KK + D+ E+     +    +G PL+GG F L+DHNG   +  D+  +W+L+YFGF +CPD+CP++IEK+++VVD +
Sbjct:   47 SLALTVALGGALMAGMKYLKKEKEDKLEQ-----ERKRSLGKPLLGGPFSLIDHNGQPKTDKDYLGQWVLLYFGFTHCPDICPEEIEKMILVVDEI 137          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Match: sec24a (SEC24 homolog A, COPII coat complex component [Source:Xenbase;Acc:XB-GENE-987688])

HSP 1 Score: 112.464 bits (280), Expect = 6.559e-27
Identity = 48/100 (48.00%), Postives = 73/100 (73.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            +V+P+F++VDPERD+   +  Y+ +F  ++LGLTGS E +  V+K YR+YYS GP D+  DYIVDH I++YL+ P+G F +YY + ++  EIA S++ HM
Sbjct:  166 HVLPVFITVDPERDSVAALAKYVSDFHPRLLGLTGSTEQVKEVAKAYRVYYSTGPKDEDNDYIVDHTIMIYLLNPDGLFTDYYSRGKTDQEIADSVRRHM 265          

HSP 2 Score: 67.0106 bits (162), Expect = 2.033e-11
Identity = 44/129 (34.11%), Postives = 63/129 (48.84%), Query Frame = 3
Query:  264 NRLFNSVKFGRRFCSSNPKQ-DSKYSKMALKTSIFAGSIFIAG-----YFYKKYRIDEFEKLI-VQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
             R+  S  F    C    +Q DS+   + L+  + A S  I G     + Y ++   E +KL  +Q      VG     GDF LVDH G   +    R  W+L+YFGF +CPD+CPD++EK+   V  L
Sbjct:   35 RRVPPSKAFSISPCHYQKQQSDSRPPSVPLRARV-AVSCIIGGAALGIWLYLRWEKQEQQKLQRIQQLQTLAVGQ----GDFSLVDHTGQPRTKSFLRDNWVLLYFGFTHCPDICPDELEKLSSAVSLL 158          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco1 (SCO1 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:106362])

HSP 1 Score: 135.576 bits (340), Expect = 7.427e-35
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N+ PLF+++DPERDT E +  Y+KEFS K++GLTG+ E+I  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  183 NLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHM 282          

HSP 2 Score: 86.2705 bits (212), Expect = 6.013e-18
Identity = 38/108 (35.19%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  306 SSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S  PK      K    T    GS+     ++KK +I+    L ++ + +  +G PL+GG F L  HNG   +  D+  +W+LIYFGF +CPD+CP+++EK++ VV+ +
Sbjct:   68 SHRPKPGPVSWKSLALTFAIGGSLLAGMKYFKKEKIESVSLLELEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEI 175          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco1 (SCO1 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:106362])

HSP 1 Score: 135.191 bits (339), Expect = 8.602e-35
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N+ PLF+++DPERDT E +  Y+KEFS K++GLTG+ E+I  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  178 NLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHM 277          

HSP 2 Score: 73.9442 bits (180), Expect = 8.644e-14
Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  450 NEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +  +G PL+GG F L  HNG   +  D+  +W+LIYFGF +CPD+CP+++EK++ VV+ +
Sbjct:  111 HRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEI 170          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco2 (SCO2 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:3818630])

HSP 1 Score: 113.62 bits (283), Expect = 1.210e-27
Identity = 50/99 (50.51%), Postives = 71/99 (71.72%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            V P+F++VDPERD    M  Y++EF  ++LGLTGS E +   S+ YR+YYS GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I  SI+ H+
Sbjct:  149 VQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHI 247          

HSP 2 Score: 79.337 bits (194), Expect = 8.739e-16
Identity = 38/105 (36.19%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  348 LKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKVL*IIQ 659
            L+T +   ++F AG  +        ++   Q +  E +    +G GDF L+DH G      DFR +W+L+YFGF +CPD+CPD++EK+V VV +L     L ++Q
Sbjct:   46 LRTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQ 150          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco2 (SCO2 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:3818630])

HSP 1 Score: 113.62 bits (283), Expect = 1.210e-27
Identity = 50/99 (50.51%), Postives = 71/99 (71.72%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            V P+F++VDPERD    M  Y++EF  ++LGLTGS E +   S+ YR+YYS GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I  SI+ H+
Sbjct:  149 VQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHI 247          

HSP 2 Score: 79.337 bits (194), Expect = 8.739e-16
Identity = 38/105 (36.19%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  348 LKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKVL*IIQ 659
            L+T +   ++F AG  +        ++   Q +  E +    +G GDF L+DH G      DFR +W+L+YFGF +CPD+CPD++EK+V VV +L     L ++Q
Sbjct:   46 LRTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQ 150          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|Q5SUC9|SCO1_MOUSE (Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.017e-34
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N+ PLF+++DPERDT E +  Y+KEFS K++GLTG+ E+I  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  178 NLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHM 277          

HSP 2 Score: 73.9442 bits (180), Expect = 6.046e-13
Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  450 NEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +  +G PL+GG F L  HNG   +  D+  +W+LIYFGF +CPD+CP+++EK++ VV+ +
Sbjct:  111 HRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEI 170          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|A1A4J8|SCO1_BOVIN (Protein SCO1 homolog, mitochondrial OS=Bos taurus OX=9913 GN=SCO1 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.830e-33
Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N+ PLF+++DPERDT E + +Y+KEFS K++GLTG+ E+I  V++ +R+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  199 NLTPLFITIDPERDTKEAIANYVKEFSPKLIGLTGTKEEIDQVARAFRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKNAEIAGSIAAHM 298          

HSP 2 Score: 73.1738 bits (178), Expect = 1.119e-12
Identity = 36/111 (32.43%), Postives = 63/111 (56.76%), Query Frame = 3
Query:  306 SSNPKQDSKYSKMALKT---SIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S +P + SK   ++ K+   +   G   +AG  Y      + +   ++ + +  +G PL+GG F L  H G   +  D+  +W+LIYFGF +CPD+CP+++EK++ VVD +
Sbjct:   85 SGDPMRPSKPGPVSWKSLAVTFAIGGALLAGMKY----FKKEKTEKLEKERHRSIGKPLLGGPFSLTTHTGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIQVVDEI 191          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|O75880|SCO1_HUMAN (Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 5.006e-33
Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            ++ PLF+S+DPERDT E + +Y+KEFS K++GLTG+ E++  V++ YR+YYS GP D+  DYIVDH IIMYLIGP+GEF++Y+GQN+   EIA SI  HM
Sbjct:  195 DLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHM 294          

HSP 2 Score: 76.2554 bits (186), Expect = 1.325e-13
Identity = 36/108 (33.33%), Postives = 60/108 (55.56%), Query Frame = 3
Query:  306 SSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S+ P +    S  +L  +   G   +AG  +    + + +   ++ +    +G PL+GG F L  H G   +  D+  +WLLIYFGF +CPDVCP+++EK++ VVD +
Sbjct:   84 STRPSKPGPVSWKSLAITFAIGGALLAGMKH----VKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEI 187          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|A6H784|SCO2_BOVIN (Protein SCO2 homolog, mitochondrial OS=Bos taurus OX=9913 GN=SCO2 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.952e-28
Identity = 53/105 (50.48%), Postives = 75/105 (71.43%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            V PLF++VDPERDT   M  Y+++F  ++LGLTGS E I  VS++YR+YYS GP D+  DYIVDH+I +YL+ P+G F +YY + RS  +I  S++ HM   ++V
Sbjct:  160 VQPLFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDEDQDYIVDHSIAIYLLSPDGLFTDYYSRARSAEQITDSVRRHMAAFRSV 264          

HSP 2 Score: 73.9442 bits (180), Expect = 3.674e-13
Identity = 37/114 (32.46%), Postives = 60/114 (52.63%), Query Frame = 3
Query:  300 FCSSNPKQDSKYSKM---ALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            F +  P    +  +     L+T +   ++  AG       +   ++   Q +  E +    +G GDF L+DH G      DFR +W+L+YFGF +CPD+CPD++EK+V VV +L
Sbjct:   38 FSTPGPADTGRQGQPQGPGLRTRLLVTALVGAGLGGAWLALRAEKERGRQQQRTEALRQAAVGQGDFSLLDHRGRVRCKADFRGQWVLLYFGFTHCPDICPDELEKLVQVVRQL 151          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|Q8VCL2|SCO2_MOUSE (Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 8.462e-27
Identity = 50/99 (50.51%), Postives = 71/99 (71.72%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            V P+F++VDPERD    M  Y++EF  ++LGLTGS E +   S+ YR+YYS GP D+  DYIVDH+I +YL+ P+G F +YYG++RS  +I  SI+ H+
Sbjct:  149 VQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHI 247          

HSP 2 Score: 79.337 bits (194), Expect = 6.113e-15
Identity = 38/105 (36.19%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  348 LKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKVL*IIQ 659
            L+T +   ++F AG  +        ++   Q +  E +    +G GDF L+DH G      DFR +W+L+YFGF +CPD+CPD++EK+V VV +L     L ++Q
Sbjct:   46 LRTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQ 150          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A3B4AMR6 (SCO cytochrome c oxidase assembly protein 1 OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.365e-35
Identity = 62/102 (60.78%), Postives = 82/102 (80.39%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLK 2474
            N+ P+ +++DPERDTPE M  Y+KEFS K++GLTGS++ I  VS++YR+YYS+GP D+  DYIVDH IIMYL+GP+G+FVEYYGQN+   EI+ SI  HM K
Sbjct:   84 NLTPILITIDPERDTPEAMAAYVKEFSPKLVGLTGSIDQIEQVSRSYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGQFVEYYGQNKRRAEISSSIASHMRK 185          

HSP 2 Score: 83.1889 bits (204), Expect = 2.090e-14
Identity = 31/66 (46.97%), Postives = 49/66 (74.24%), Query Frame = 3
Query:  432 IVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +++ + N+ +G PL+GG F LVDH+   V   DF  +W+LIYFGF +CPD+CPD++EK++ VV+ +
Sbjct:   11 MIERERNKSIGRPLLGGPFSLVDHHSKPVRSEDFLGQWILIYFGFTHCPDICPDELEKMIEVVEEI 76          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A0E9WG35 (Uncharacterized protein OS=Anguilla anguilla OX=7936 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.205e-34
Identity = 59/104 (56.73%), Postives = 81/104 (77.88%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQ 2480
            N+ PLF+++DP+RD+PE +  Y+KEFS K++GLTG+ E + AVS+ YR+YYS+GP D+  DYIVDH IIMYL+GP+G FVEY+GQN+   EI+  I  HM K +
Sbjct:   16 NLTPLFITIDPDRDSPEAISTYVKEFSPKMIGLTGTKEQVEAVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGRFVEYFGQNKKSAEISSCIASHMRKHR 119          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A0R3W9S5 (Thioredoxin domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7233 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.688e-34
Identity = 66/117 (56.41%), Postives = 87/117 (74.36%), Query Frame = 3
Query: 2124 ICNVLMDLILAQKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLK 2474
            + +V   L L  K  + VP+F++VDPERDTPE++ +Y+KEFS K++GLTGS E I   +K YRIYYSKGP D+ GDYIVDH ++MYL+ P+GEFVE+YGQ + V EI R I  HM +
Sbjct:  129 LVDVQERLALYGKDKDFVPIFITVDPERDTPEVVGEYVKEFSPKLVGLTGSPEQIQVTAKRYRIYYSKGPPDRDGDYIVDHTVVMYLLNPKGEFVEFYGQVKPVQEIVRRIMDHMKR 245          

HSP 2 Score: 87.0409 bits (214), Expect = 3.536e-15
Identity = 34/66 (51.52%), Postives = 47/66 (71.21%), Query Frame = 3
Query:  441 NKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYY 638
             +++   G   IGGDF L+D  G  V+L DFR KW+L+YFGFC CPD+CP+Q+E++V V +RL  Y
Sbjct:   74 QRISSNFGQIAIGGDFRLLDQTGMEVTLADFRGKWVLVYFGFCRCPDICPEQLERLVDVQERLALY 139          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A3B4WSR7 (SCO cytochrome c oxidase assembly protein 1 OS=Seriola lalandi dorsalis OX=1841481 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.777e-34
Identity = 61/102 (59.80%), Postives = 82/102 (80.39%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLK 2474
            N+ PL +++DP+RDTPE M  Y+KEFS K++GLTG++ DI  VS++YR+YYS+GP D+  DYIVDH IIMYL+GP+GEF+EY+GQN+   EI+ SI  HM K
Sbjct:  222 NLTPLLITIDPDRDTPEAMATYVKEFSPKLIGLTGTIADIEQVSRSYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGEFMEYFGQNKRSAEISSSIAAHMRK 323          

HSP 2 Score: 79.337 bits (194), Expect = 4.837e-12
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  450 NEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKVL 647
            N+ +G P +GG F L DHN       DF  +W+LIYFGF +CPD+CPD++EK++ VVD +   K L
Sbjct:  155 NKSIGKPALGGPFSLTDHNNKPAKSEDFLGQWVLIYFGFTHCPDICPDELEKMIEVVDEIDNIKSL 220          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A3P9L6Y6 (SCO cytochrome c oxidase assembly protein 1 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.821e-34
Identity = 65/108 (60.19%), Postives = 82/108 (75.93%), Query Frame = 3
Query: 2157 QKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQ 2480
            Q   N+ PL +++DPERDTPE M  Y+KEFS K++GLTG+V  I  VS+ YR+YYS+GP D+  DYIVDH IIMYLIGP+GEFVEY+GQN+   EI+ SI  HM K +
Sbjct:  172 QSLPNLTPLLITIDPERDTPEAMAAYVKEFSPKLIGLTGTVAQIEEVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLIGPDGEFVEYFGQNKRGVEISNSIAAHMRKHR 279          

HSP 2 Score: 80.1073 bits (196), Expect = 1.344e-12
Identity = 31/60 (51.67%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  450 NEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            N+ +G P +GG F LVDHN       DF  +W+L+YFGF +CPD+CPD+IEK++ VVD +
Sbjct:  109 NKSIGRPALGGPFSLVDHNNKPTKSQDFLGQWVLLYFGFTHCPDICPDEIEKMIEVVDEI 168          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 136.732 bits (343), Expect = 4.926e-35
Identity = 56/104 (53.85%), Postives = 80/104 (76.92%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQ 2480
            ++ PL +++DP+RDTPE +  Y+KEFS K++GLTG+   I   S+ YR+Y+S+GP D+  DYIVDH IIMYL+GP+G+FV+YYGQN+   EI+ SI  HM K++
Sbjct:  205 DLTPLLITIDPDRDTPEALAKYVKEFSPKLIGLTGTAAQIQEASRAYRVYFSQGPKDEDNDYIVDHTIIMYLVGPDGQFVDYYGQNKKATEISASIASHMRKQK 308          

HSP 2 Score: 78.9518 bits (193), Expect = 2.000e-15
Identity = 37/101 (36.63%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  345 ALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKVL 647
            +L  +   G  F+ G  Y K   +E    +++ +    VG   +GG F LVDHN       DF  +W+LIYFGF +CPD+CPD++EK+  VV  +   + L
Sbjct:  107 SLAITFAIGGTFLLGMKYFKKEKEE----MIERERTRSVGKAALGGPFSLVDHNNKPTKSDDFLGQWVLIYFGFTHCPDICPDELEKMAEVVKEIDSIRTL 203          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 116.701 bits (291), Expect = 1.591e-28
Identity = 52/99 (52.53%), Postives = 72/99 (72.73%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            V PLFV+VDPERD    M  Y+K+F  +++GLTG+ E++  V +TYR+Y S GP D  GDYIVDH II+YLI P+G F++YY + +S  +IA S++ HM
Sbjct:  172 VQPLFVTVDPERDDTATMAKYVKDFHPRLIGLTGTPEEVKEVGQTYRVYASAGPKDDDGDYIVDHTIIIYLINPDGLFLDYYNRAKSATQIAESVRNHM 270          

HSP 2 Score: 74.3294 bits (181), Expect = 3.838e-14
Identity = 38/119 (31.93%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  276 NSVKFGRRFCSSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIG-GDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            N  +F     S+ P Q    ++M LK  +    +F  G+    + +   ++  +  +  E +    +G GDF L DH G   S  D+R  W+L+YFGF +CPD+CP+++EK+  VV+ L
Sbjct:   45 NQQRFTSSQGSNQPPQRGSSAQMKLKYRLAVTLLFGGGFMGIWWYVHREKQQKLHMQRIEQLKKVAVGQGDFSLTDHTGKRRSKKDYRGSWVLMYFGFTHCPDICPEELEKMASVVNLL 163          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Sea Lamprey
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 89.7373 bits (221), Expect = 1.057e-20
Identity = 45/92 (48.91%), Postives = 62/92 (67.39%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFG-DYIVDHAIIMYLIGPEGEFVEYYGQNRSVPE 2441
             V P+FV++DP+RD    +  Y+K+F  +++GLTGS E I A+SK YR+Y   GP D    +Y+VDH+II YLI P G  +E+Y  NRSV E
Sbjct:   98 RVQPVFVTIDPQRDDVAAVAQYIKDFHPRLVGLTGSPEQISAISKAYRVYAQPGPRDPTDQEYVVDHSIITYLICPHGAVLEFY--NRSVEE 187          

HSP 2 Score: 55.4546 bits (132), Expect = 7.229e-9
Identity = 36/100 (36.00%), Postives = 49/100 (49.00%), Query Frame = 3
Query:  345 ALKTSIFA----GSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFR-SKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +L+T I      GS F   + Y +Y        IV      G+G    G  F L D +G  V   D    +W L+YFGF +CPDVCP+++EKV  V+  L
Sbjct:    1 SLRTRILVTAGIGSAFFGWWVYLRYEKQGLNDHIV------GLG----GVKFELTDQSGRKVKGHDLLVGRWSLLYFGFTHCPDVCPEEMEKVSGVIHTL 90          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Match: SCO1 (Copper-binding protein of mitochondrial inner membrane; required for cytochrome c oxidase activity and respiration; may function to deliver copper to cytochrome c oxidase; similar to thioredoxins; SCO1 has a paralog, SCO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000241])

HSP 1 Score: 96.2857 bits (238), Expect = 2.457e-22
Identity = 42/99 (42.42%), Postives = 68/99 (68.69%), Query Frame = 3
Query: 2133 VLMDLILAQKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFG-DYIVDHAIIMYLIGPEGEFVEYYGQN 2426
            + ++ + ++  I + PLF++ DP RD+P ++K+YL +F   ILGLTG+ +++    K YR+Y+S  P  K G DY+VDH+I  YL+ PEG+FV+  G+N
Sbjct:  161 LWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGQFVDALGRN 259          

HSP 2 Score: 65.0846 bits (157), Expect = 7.950e-12
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 3
Query:  390 YFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            +F ++ R  E +K   + + N G G P +GG FHL D  G   +  +   K+ +IYFGF NCPD+CPD+++K+ + ++ L
Sbjct:   90 FFNREKRRLETQK---EAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTL 166          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Match: SCO2 (Protein anchored to mitochondrial inner membrane; may have a redundant function with Sco1p in delivery of copper to cytochrome c oxidase; interacts with Cox2p; SCO2 has a paralog, SCO1, that arose from the whole genome duplication [Source:SGD;Acc:S000000228])

HSP 1 Score: 93.5893 bits (231), Expect = 2.280e-21
Identity = 45/110 (40.91%), Postives = 72/110 (65.45%), Query Frame = 3
Query: 2166 INVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSK-GPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQN----RSVPEIARSIQGHMLKKQ 2480
            I + PLF+S DP RDTP+++K+YL +F   I+GLTG+ + + +V K Y++Y+S    V    DY+VDH+I  YLI PEG+F++  G+N      + +I   IQ ++ K++
Sbjct:  178 IKIQPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPNQDYLVDHSIFFYLIDPEGQFIDALGRNYDEQSGLEKIREQIQAYVPKEE 287          

HSP 2 Score: 60.8474 bits (146), Expect = 2.267e-10
Identity = 26/81 (32.10%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  387 GYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
             Y  +K R+ E EK   +   N   G+  +GG F+L D NG   +  + + K+ ++YFGF +CPD+CP++++++   +  L
Sbjct:   95 AYLSRKRRLLETEK---EADANRAYGSVALGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISEL 172          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Match: EDO49876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY8])

HSP 1 Score: 132.88 bits (333), Expect = 2.501e-35
Identity = 60/99 (60.61%), Postives = 76/99 (76.77%), Query Frame = 3
Query: 2178 PLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLK 2474
            PLF+SVDP+RDT E + +Y+KEF  K+LGLTG VE +  V K YR+Y+S GP D+  DYIVDH II YL+ P+GEF+EY+GQN++  EIA SI  HMLK
Sbjct:  108 PLFISVDPKRDTVEAVAEYVKEFHPKLLGLTGPVEKVQEVCKAYRVYFSAGPADEDNDYIVDHTIIQYLVSPDGEFMEYFGQNKNAEEIAASITNHMLK 206          

HSP 2 Score: 73.559 bits (179), Expect = 9.781e-15
Identity = 28/55 (50.91%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  459 VGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVD 623
            +G   +GG F L+DH+G   +  DFR KWLL+YFGF +CPD+CPD++EK+   +D
Sbjct:   41 IGKVALGGPFDLIDHHGKPKTDKDFRGKWLLLYFGFTHCPDICPDELEKMAEAID 95          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Match: EDO25395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWL6])

HSP 1 Score: 53.5286 bits (127), Expect = 5.974e-9
Identity = 31/94 (32.98%), Postives = 46/94 (48.94%), Query Frame = 3
Query: 2181 LFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGD--YIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSI 2456
            +FVSVDPERDT E +  Y+  F    LG+TG  + +  ++      Y K P     D  Y+VDH   + L+ P G F   +    +   IA+ +
Sbjct:    4 IFVSVDPERDTLEKLAQYIPYFHPTFLGVTGEHDQLTQLAHNLGAMYLKLPAAAENDENYLVDHTGSILLVNPAGHFHAVFTSPHNAQAIAKDL 97          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Match: sco1 (protein SCO1 homolog, mitochondrial [Source:NCBI gene;Acc:101175404])

HSP 1 Score: 142.124 bits (357), Expect = 2.606e-37
Identity = 65/108 (60.19%), Postives = 81/108 (75.00%), Query Frame = 3
Query: 2157 QKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQ 2480
            Q   N+ PL +++DPERDTPE M  Y+KEFS K++GLTGS   I  VS+ YR+YYS+GP D+  DYIVDH IIMYLIGP+GEFVEY+GQN+   EI+ SI  HM K +
Sbjct:  172 QSLPNLTPLLITIDPERDTPEAMAAYVKEFSPKLIGLTGSTAQIEEVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLIGPDGEFVEYFGQNKRGVEISNSIAAHMRKHR 279          

HSP 2 Score: 80.1073 bits (196), Expect = 5.106e-16
Identity = 31/60 (51.67%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  450 NEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            N+ +G P +GG F LVDHN       DF  +W+L+YFGF +CPD+CPD+IEK++ VVD +
Sbjct:  109 NKSIGRPALGGPFSLVDHNNKPTKSQDFLGQWVLLYFGFTHCPDICPDEIEKMIEVVDEI 168          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 107.842 bits (268), Expect = 9.143e-26
Identity = 47/105 (44.76%), Postives = 74/105 (70.48%), Query Frame = 3
Query: 2172 VVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            V PLF++VDPERD    +  Y+K+F  +++GLTG+ E++    + YR+Y S GP D+ GDYIVDH+I++YL+ P+G F++YY + +S  +IA S++ HM   Q +
Sbjct:  151 VQPLFITVDPERDGVPALARYVKDFHPRLIGLTGTPEEVKHAGRDYRVYASPGPKDQDGDYIVDHSILIYLLSPDGLFLDYYNRMKSSEQIADSVRNHMRSYQRL 255          

HSP 2 Score: 61.6178 bits (148), Expect = 6.352e-10
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  417 EFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVV 620
            E ++   Q +  +     L  G F LVDH G   +  DF   W+L+YFGF +CPD+CPD+++K+   V
Sbjct:   72 EKQQRRWQQRTEQLRKVALGQGTFSLVDHTGRRRTKQDFLGSWVLLYFGFTHCPDICPDELDKLSAAV 139          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Match: SMESG000067103.1 (SMESG000067103.1)

HSP 1 Score: 258.455 bits (659), Expect = 2.973e-80
Identity = 123/128 (96.09%), Postives = 126/128 (98.44%), Query Frame = 3
Query:  261 FNRLFNSVKFGRRFCSSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYKV 644
            F+RLFNSVKFGRRFCSSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL + K+
Sbjct:    4 FSRLFNSVKFGRRFCSSNPKQDSKYSKMALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLAHKKI 131          

HSP 2 Score: 226.868 bits (577), Expect = 1.936e-68
Identity = 110/112 (98.21%), Postives = 110/112 (98.21%), Query Frame = 3
Query: 2151 LAQKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAV 2486
            LA KKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQA 
Sbjct:  126 LAHKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHMLKKQAA 237          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Match: SMESG000073891.1 (SMESG000073891.1)

HSP 1 Score: 123.635 bits (309), Expect = 8.380e-32
Identity = 53/100 (53.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query: 2169 NVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 2468
            N++P+FVSVDP+RDTP  +  Y+KEFS K++GLTG   +I  ++++Y+++Y  G  D++GDY+VDHAIIMYLIGP+G+F++YYG  +S+ EI  SI   M
Sbjct:  106 NIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKAGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEM 205          

HSP 2 Score: 92.8189 bits (229), Expect = 4.829e-21
Identity = 43/89 (48.31%), Postives = 62/89 (69.66%), Query Frame = 3
Query:  372 SIFIAGYF-YKKYRIDEFEKLI--VQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRL 629
            S FI G   YK  + +E  KLI  + +  N   G P IGGDF LVDH G   + +DF++KWLL+YFG+C+CPD+CP+Q+EK+ ++VD++
Sbjct:   10 SFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKI 98          
The following BLAST results are available for this feature:
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCO14.845e-3459.00SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
SCO11.042e-3359.00SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
SCO22.453e-2746.67SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
SCO22.453e-2746.67SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
SCO22.453e-2746.67SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sco-15.375e-3150.42SCO (Yeast Suppressor of Cytochrome Oxidase defici... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scox3.914e-3258.95gene:FBgn0262467 transcript:FBtr0079052[more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sco17.276e-3260.92SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco19.405e-3260.92SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco22.085e-2647.00SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
sco22.085e-2647.00SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sirt45.904e-3457.00sirtuin 4 [Source:Xenbase;Acc:XB-GENE-948981][more]
sec24a6.559e-2748.00SEC24 homolog A, COPII coat complex component [Sou... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sco17.427e-3560.00SCO1 cytochrome c oxidase assembly protein [Source... [more]
Sco18.602e-3560.00SCO1 cytochrome c oxidase assembly protein [Source... [more]
Sco21.210e-2750.51SCO2 cytochrome c oxidase assembly protein [Source... [more]
Sco21.210e-2750.51SCO2 cytochrome c oxidase assembly protein [Source... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SUC9|SCO1_MOUSE6.017e-3460.00Protein SCO1 homolog, mitochondrial OS=Mus musculu... [more]
sp|A1A4J8|SCO1_BOVIN1.830e-3359.00Protein SCO1 homolog, mitochondrial OS=Bos taurus ... [more]
sp|O75880|SCO1_HUMAN5.006e-3359.00Protein SCO1 homolog, mitochondrial OS=Homo sapien... [more]
sp|A6H784|SCO2_BOVIN9.952e-2850.48Protein SCO2 homolog, mitochondrial OS=Bos taurus ... [more]
sp|Q8VCL2|SCO2_MOUSE8.462e-2750.51Protein SCO2 homolog, mitochondrial OS=Mus musculu... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4AMR65.365e-3560.78SCO cytochrome c oxidase assembly protein 1 OS=Per... [more]
A0A0E9WG351.205e-3456.73Uncharacterized protein OS=Anguilla anguilla OX=79... [more]
A0A0R3W9S53.688e-3456.41Thioredoxin domain-containing protein OS=Taenia as... [more]
A0A3B4WSR74.777e-3459.80SCO cytochrome c oxidase assembly protein 1 OS=Ser... [more]
A0A3P9L6Y65.821e-3460.19SCO cytochrome c oxidase assembly protein 1 OS=Ory... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sco14.926e-3553.85SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco21.591e-2852.53SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sco21.057e-2048.91SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SCO12.457e-2242.42Copper-binding protein of mitochondrial inner memb... [more]
SCO22.280e-2140.91Protein anchored to mitochondrial inner membrane; ... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498762.501e-3560.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253955.974e-932.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sco12.606e-3760.19protein SCO1 homolog, mitochondrial [Source:NCBI g... [more]
sco29.143e-2644.76SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067103.12.973e-8096.09SMESG000067103.1[more]
SMESG000073891.18.380e-3253.00SMESG000073891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007928 ID=SMED30007928|Name=SCO cytochrome c oxidase assembly protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2487bp
GAAACGAATAGTCCAGTTGCTTAGACGGAATGAATTTAAATCGATAATAT
TTCCAGCCAATCACAATTTGATACTATTTCAACAACAATCACGTGGCTCA
AAAATAGATATGAGTCATCATGAAGGACATAACTATTTCCGTAGTTAAAT
AAATGTAACATTGAGTTTTTAAGTTTTTGTAATTTTATCATAATAATAAT
CGACAATTTGTGATGAAATTTTAAACTGCAAAATTAATTTCGATCTAAAA
AATTGTTTAATTCAATCGACTATTTAATTCTGTTAAATTTGGAAGGAGAT
TCTGCTCAAGCAATCCTAAACAGGATAGCAAATATTCCAAAATGGCGCTA
AAAACCAGTATTTTTGCTGGCTCTATATTTATTGCTGGATACTTCTATAA
AAAATATAGAATAGATGAATTTGAGAAATTAATTGTTCAAAATAAACTAA
ATGAAGGAGTGGGAACACCTTTGATTGGTGGTGATTTTCATCTTGTTGAT
CACAACGGCACTTCAGTATCTTTACTCGATTTCAGAAGCAAATGGCTGTT
GATTTATTTCGGATTTTGTAATTGCCCTGATGTTTGCCCAGATCAAATTG
AAAAAGTAGTAATGGTTGTTGACAGATTGGGTTATTATAAAGTTTTATAA
ATTATACAATATTTTTATAATTATTATTTTTTTCACTTTTAATGATGATG
ATTTCAATGGGTAAATGGTTAATTTGTAGATTCATAAAAACTTAAAGCTT
TATGTTGATATAGAATTAAATGGGCGACAATGAGATAATTATTGTATTGT
GAATATTATATAATGATTATAAAGCAATAACATATTTAATATTTACAAAT
CTTTTTTTTTTGGTGGATTGTTATCAAATTATTAAAATGGATTCCTAATC
ACAGGGTTTTGTGGATTATTGATTATTCTCTTTTCTTTGGATTTCGCTAT
TAACATGTTTTTAGAGTTGGATTTGAATTAGTTTTAAGGCGCTAGTTAGT
TTGGCTTTGCTTTTTTCTTGGTTTGGAATTCTATATCTAACAGCATTGAA
GGAATTTGTTACAGTTATCGGGATTGCAGTTCTTTATGTCTTTAGTGCTC
CTCGGTTGTTATTGTTGAACCTTACTGTTCCAATGATTCCTGCTTGCTTA
TTTTTGATCAATTTATTTGAATATTTATCGCTATAGAAACATCTGTATCA
ATTTCGCTTATAGCCCTAATGTTCTCTATGTGACGGTTGAGGATTATCTA
TTTATTGCCTATTTAAAGTCCAAATAATCACAATTCTATGCTAAGTGAGT
TACAAATCCTATTAACGGCGGTTCTGAATGTTTTGGCGCGTTATTATAAT
GGGGGGGGGCGGTTGGAGGGTATTGTGGATTTATTACTAAAATCAATTAT
GTAATTCGGTGGGATAGGCAAAGTCAACATCAATTGAGTAGTACTGATAG
AAGGGAAACTACACAAATGATAACAAGAACGAATTCGCTTTGATGTAAAT
AAAAGGTCCTCTAGAAGCTCTGGAAAGCTAAAATCTATTTTTTAAACAAA
TATCCAATGGCAAGGAATGAAGCGAGCGGAATTTCGATCAGAATGTATTA
GAAGTTTCGGGGGTGGAAGAGAAGGATATAGAATTGAATACAGTTTGCAG
TGTGGATATAGGATAACAATGAGACATGGGCGGTAGGTATGTGAGAGGAA
GCTAGATTGGCCAGACCATGGAGCAAATGATTTTTGAACCTATAAATAAT
AAAGCTAAGGTCAGACAGGGACGGTATTGTATTTAATTAATCGCTTCTAT
TCTCTAAGCTCCGCTCATTCAGTTCCTTCGTATATCCTTCATTACACCGC
TAAAGGGTTCTCGTAAGCATAGATTGTTGAATTAATATTTTAATTAATTA
TTTAAAAACATTTTTATTAATATTTTAATTTGACAATTATTAATTTTGCA
ATCGATTTAAATATAAATTGCATTGGAAAATTAATTTTTGAAATAGTTTA
AGTATTTTAATTCCAAAAATGAGGATAATTGGGGTACTTACAAGCCTGAT
TTAGTGAGTTAGCATAGTTTTAATAAAAGCTGCAAAATCGCTCATCATTT
GAGCGATTATTTATGCAATGGTTATCTGCAATGTCTTGATGGATTTAATT
CTAGCCCAAAAGAAGATCAACGTTGTCCCATTATTCGTCAGTGTTGATCC
TGAAAGGGATACTCCGGAAATTATGAAGGATTATTTAAAAGAATTCTCCA
ACAAAATCCTTGGATTGACAGGAAGTGTAGAAGATATCCATGCTGTCTCT
AAGACATATCGTATTTATTATAGCAAAGGTCCAGTTGATAAATTCGGGGA
TTATATTGTGGACCATGCAATAATTATGTATCTGATTGGGCCAGAAGGTG
AGTTTGTTGAATATTACGGCCAAAATAGGTCTGTGCCGGAGATTGCGCGA
AGTATTCAAGGTCACATGCTAAAGAAGCAAGCTGTTT
back to top

protein sequence of SMED30007928-orf-1

>SMED30007928-orf-1 ID=SMED30007928-orf-1|Name=SMED30007928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MALKTSIFAGSIFIAGYFYKKYRIDEFEKLIVQNKLNEGVGTPLIGGDFH
LVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLGYYK
VL*
back to top

protein sequence of SMED30007928-orf-2

>SMED30007928-orf-2 ID=SMED30007928-orf-2|Name=SMED30007928-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MVICNVLMDLILAQKKINVVPLFVSVDPERDTPEIMKDYLKEFSNKILGL
TGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYY
GQNRSVPEIARSIQGHMLKKQAV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005507copper ion binding
GO:0046872metal ion binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0072492host cell mitochondrial intermembrane space
GO:0005739mitochondrion
GO:0030016myofibril
Vocabulary: biological process
TermDefinition
GO:0006825copper ion transport
GO:0008535respiratory chain complex IV assembly
GO:1901799negative regulation of proteasomal protein catabolic process
GO:0006878cellular copper ion homeostasis
GO:0033617mitochondrial respiratory chain complex IV assembly
GO:0045454cell redox homeostasis
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR003782SCO1/SenC
IPR012336Thioredoxin-like_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003782Copper chaperone SCO1/SenCPFAMPF02630SCO1-SenCcoord: 12..96
e-value: 8.8E-26
score: 90.4
IPR003782Copper chaperone SCO1/SenCPANTHERPTHR12151SCO1/SENCcoord: 18..119
IPR003782Copper chaperone SCO1/SenCCDDcd02968SCOcoord: 3..101
e-value: 6.58389E-38
score: 123.097
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 4..122
e-value: 1.5E-34
score: 121.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 13..115
NoneNo IPR availablePANTHERPTHR12151:SF4PROTEIN SCO1 HOMOLOG, MITOCHONDRIALcoord: 18..119