C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30007927
Length (bp)2609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30007927) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30007927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30007927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30007927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007927SMESG000032739.1 SmedASXL_019450SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007927SMESG000032739.1 SmedASXL_019450SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007927SMESG000032739.1 dd_Smed_v4_3827_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A183ADN5 (C2H2-type domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5070 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.716e-38
Identity = 74/116 (63.79%), Postives = 92/116 (79.31%), Query Frame = 3
Query:  627 SGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRR 974
            + +NG+  + W + KV VG+D+TRKGERSLV+DG+KFTKSRDG  +RVFWRCSRRECKATAVTV DRVEH+RA+H H+PP+AAEFF      + RC+ QEVRFN +A+  R R RR
Sbjct:   89 TAKNGE--KKWNLVKVHVGFDVTRKGERSLVIDGYKFTKSRDGMGDRVFWRCSRRECKATAVTVSDRVEHIRAVHTHQPPVAAEFFAEN---TVRCE-QEVRFNNTASYPRSRVRR 198          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A0X3Q5R0 (C2H2-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR139982 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.055e-38
Identity = 69/106 (65.09%), Postives = 85/106 (80.19%), Query Frame = 3
Query:  657 WTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRR 974
            W + KV+VG+D+TRKGERSLV+DG+KFTKSRDG ++RVFWRCSRRECKATAVTV DRVEHVR +H H+PP+A EFF    G     +LQ VRFN + ++ +PR RR
Sbjct:  127 WNLMKVRVGFDVTRKGERSLVIDGYKFTKSRDGMSDRVFWRCSRRECKATAVTVSDRVEHVRTLHTHKPPLAGEFFVESAG---GAKLQTVRFNYAPSSTKPRARR 229          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A504YTF3 (Zinc finger FLYWCH type OS=Fasciola gigantica OX=46835 GN=FGIG_11096 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.206e-38
Identity = 73/114 (64.04%), Postives = 89/114 (78.07%), Query Frame = 3
Query:  633 RNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRR 974
            +N D  + W + KV+VG+D+TRKGERSLV+DG+KFTKSRDG  +RVFWRCSRRECKATAVTV D+VEH+RA+H+H+PP+AAEFF      S+    QEVRFN SA   R R RR
Sbjct:   88 KNAD--KKWNLVKVRVGFDVTRKGERSLVIDGYKFTKSRDGIGDRVFWRCSRRECKATAVTVADKVEHIRAMHSHQPPVAAEFFADNPARSE----QEVRFNNSATYSRSRVRR 195          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4E0RDP2 (Zinc finger FLYWCH type OS=Fasciola hepatica OX=6192 GN=D915_004690 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.764e-37
Identity = 72/114 (63.16%), Postives = 89/114 (78.07%), Query Frame = 3
Query:  633 RNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRR 974
            +N D  + W + KV+VG+D+TRKGERSLV+DG+KFTKSRDG  +RVFWRCSRRECKATAVTV D+VEH+RA+H+H+PP+AAEFF      S+    QEVRFN +A   R R RR
Sbjct:   88 KNAD--KKWNLVKVRVGFDVTRKGERSLVIDGYKFTKSRDGIGDRVFWRCSRRECKATAVTVADKVEHIRAMHSHQPPVAAEFFADNPARSE----QEVRFNNAATYSRSRVRR 195          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A183TAY0 (C2H2-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13628 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 6.770e-37
Identity = 69/106 (65.09%), Postives = 86/106 (81.13%), Query Frame = 3
Query:  657 WTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRR 974
            W + KV+VG+D+TRKGERSLV+DG+KFTKSRDG ++RVFWRCSRRECKATAVTV DRVEHVR +H H+PP+A EFF    G +   +LQ VRFN + ++ +PR RR
Sbjct:  182 WNLMKVRVGFDVTRKGERSLVIDGYKFTKSRDGMSDRVFWRCSRRECKATAVTVSDRVEHVRTLHTHKPPLAGEFFVESAGGA---KLQTVRFNYAPSSTKPRARR 284          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000032739.1 (SMESG000032739.1)

HSP 1 Score: 955.666 bits (2469), Expect = 0.000e+0
Identity = 492/495 (99.39%), Postives = 492/495 (99.39%), Query Frame = 3
Query:  474 MSEVNYTSMESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVXXXXXXXXXXXXXVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTNTTPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVXXXXXXXXXXXXXXKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPELHAPSGVSCAG 1958
            MSEVNYTSMESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVSGSEGGNAEESSSVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTN TPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVNQLNLEQIIQILLNKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPEL AP GVSCAG
Sbjct:    1 MSEVNYTSMESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVSGSEGGNAEESSSVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTNPTPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVNQLNLEQIIQILLNKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPELRAPPGVSCAG 495          

HSP 2 Score: 115.546 bits (288), Expect = 1.376e-26
Identity = 59/80 (73.75%), Postives = 61/80 (76.25%), Query Frame = 2
Query: 1907 CVMLAGIACSVWSEL--------CWRFGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV 2122
            C  + G+  S   EL           FGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV
Sbjct:  471 CNTMIGLGASCLPELRAPPGVSCAGGFGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV 550          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000032739.1 (SMESG000032739.1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 484/487 (99.38%), Postives = 484/487 (99.38%), Query Frame = 3
Query:  498 MESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVXXXXXXXXXXXXXVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTNTTPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVXXXXXXXXXXXXXXKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPELHAPSGVSCAG 1958
            MESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVSGSEGGNAEESSSVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTN TPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVNQLNLEQIIQILLNKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPEL AP GVSCAG
Sbjct:    1 MESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQSSIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNRVFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQLQEVRFNTSAANMRPRYRRSTVSGSEGGNAEESSSVKDISNSNGIKIEKKPANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVRDFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTNPTPLNSANSATGSTIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKSKTNSDCSGVNQLNLEQIIQILLNKNGPNRHRSSSDSEWMAGNSSSTVSYEHESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRESESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPELRAPPGVSCAG 487          

HSP 2 Score: 115.546 bits (288), Expect = 1.331e-26
Identity = 59/80 (73.75%), Postives = 61/80 (76.25%), Query Frame = 2
Query: 1907 CVMLAGIACSVWSEL--------CWRFGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV 2122
            C  + G+  S   EL           FGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV
Sbjct:  463 CNTMIGLGASCLPELRAPPGVSCAGGFGAGIYSCNGCGSIKRAVLIPQFIPPDNHSQTDGSHAKAVIRIVSRGSRRPGSV 542          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183ADN51.716e-3863.79C2H2-type domain-containing protein OS=Echinostoma... [more]
A0A0X3Q5R03.055e-3865.09C2H2-type domain-containing protein OS=Schistoceph... [more]
A0A504YTF36.206e-3864.04Zinc finger FLYWCH type OS=Fasciola gigantica OX=4... [more]
A0A4E0RDP21.764e-3763.16Zinc finger FLYWCH type OS=Fasciola hepatica OX=61... [more]
A0A183TAY06.770e-3765.09C2H2-type domain-containing protein OS=Schistoceph... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032739.11.376e-2699.39SMESG000032739.1[more]
SMESG000032739.11.331e-2699.38SMESG000032739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007927 ID=SMED30007927|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2609bp
GATGTACAGTACACACCATACACCATTGCATTTGTCAATGACAGTGTGTG
TGCTAGCGTGTCTGGGTGTGCCTGTCAGCTCTCAGATGGGTTTGCTACGT
AACCGTGTAGTAGTACGTAGTTGACATAGAAAACATGAGGACACAATTTC
TCTGCCCAAATATCATGACGCACCGTTATTAATGCGATTGGTGGGAAGCA
ATCGTCACGAGCTGAGCAAATATATTCATCCTCAGTAGACTAAGCAATTG
TAGCCATCGTGAAATAAGGTCACACTGGTAGTAATAGGCCTTGTGTAACA
CAACTGATAAGCAGCCATTCATTTTCTGCGATTCTCATTGGTCGGTTCAT
TTTCAAATCACTGTTAACCTAGCGAGCTGTAACAAAGACTGCTGTCAGAA
TTGCGCTTTTTCAAACAATTCTACATAGACGACGATTGTACAAACAAAAT
TTGTGCTGATTAGTGCCATGTTTATGTCCGAGGTCAATTATACGTCAATG
GAATCTTCACCGCAAGAGGAAATTTCTAACTCTGATGTGGAAAATGTTGC
CATGAGTCCTGATAATAATCGGATTGATGTTGTTAGCGTTGAACAGTTGC
CTTTTGATGATCAATCATCTATTAAAAGCGGTCGAAATGGAGATTGTTCT
CGCAGTTGGACTATGGAGAAAGTTCAAGTTGGATATGATATCACTCGCAA
AGGAGAACGAAGTCTAGTAGTTGATGGATTTAAATTTACGAAATCCAGAG
ATGGAACTAACAATCGAGTGTTTTGGAGATGTTCAAGACGAGAATGCAAA
GCCACGGCGGTTACTGTATGTGATCGTGTAGAACATGTGAGAGCAATTCA
TGCTCATGAGCCCCCTATGGCTGCTGAATTTTTTGGAAGTCAAGAAGGAG
TATCTCAAAGATGTCAGTTGCAAGAAGTTCGATTCAATACAAGTGCAGCA
AACATGCGGCCCAGATATCGAAGGTCAACAGTTTCGGGATCAGAAGGTGG
CAATGCCGAAGAATCATCTTCTGTTAAAGACATATCCAATTCAAATGGTA
TCAAAATCGAAAAGAAGCCTGCTAATCAAAATGTAACAAATCCTAAGCCC
TTGATCAGTTTGGTATCAGCACAACCAGTCTTCCAAATCCACAGCGCCGA
CAAAAAGCATTCGTATTCGTCGTGCAGTGGATTACAAAAAACCCCATCAG
TCAAGGAACAAGTTCGAGATTTTATTCTCCGAAATTCAAACATTCAGCCC
CAGAGTCAGACGGAAAACAACCTATCTGTTGCTCAATTCCTGATTTCACC
AGCTTCCCAAACGCAATTTATTCAAACTAACACAACTCCCCTTAATTCTG
CAAACAGCGCAACTGGATCAACAATATTCAATTTTAGTACAATGCAGATC
AACGCATCTCCAAATACAGGATCAGATTCGACAAGTGAGGCGCCGAGTCA
CAAATCAACGCCAGGAGGACTCATGAATCTGCCGACGACTCCCCATGACG
AGACCCAGTACAAAAGCAAAACAAATAGTGACTGTTCCGGTGTAAATCAA
CTGAATCTCGAGCAAATCATTCAAATCTTATTGAACAAAAATGGACCAAA
CCGACACCGTTCAAGTTCCGACAGCGAATGGATGGCCGGCAACTCGAGTA
GCACTGTGTCCTATGAGCATGAATCGCATGAGTTGTCTCCTTGTGCAATG
CCCGCGCCTCCGCTGTCTGCTGATGAGCAGAGCTACGTTGCCACTGGCGT
TGTCCATCAATCTGCACCAACTCCAACGCGACTGATTCACTGGAAAAAGG
AGAAATTGCGGGAATCCGAGTCATCAGACGAATTGTTCCGTCGTGAACGC
AAGCGACGCCACGAAGATATCAACAGTAATAATTGCAATACAATGATCGG
ACTTGGTGCGTCATGCTTGCCGGAATTGCATGCTCCGTCTGGAGTGAGCT
GTGCTGGAGATTCGGTGCCGGTATCTACAGCTGCAACGGCTGCGGCAGCA
TCAAACGAGCTGTTCTCATTCCTCAATTCATTCCGCCCGACAATCACTCA
CAAACTGATGGGAGTCATGCAAAAGCTGTCATCAGAATTGTGTCCAGAGG
AAGCCGTCGCCCAGGAAGTGTTTGAGAAGTGCACAGCAATCAAGACCTGC
CTGGAAACATTAGAGAAATTGCATTCTCTCATGAGCTGCTGAATTGAACA
ATTCTATTTTTGCATTGGGTGCCTTGTTGATAGGAATGTTGACTTTATTT
TTATACGCTCTTATTACTATTATTATTACTATTACAATAATTATTATCCT
GACCTTGACGTTCACTCGTCCTACTCTCTCTCTCTCTCTCCCTCTCTCTC
TCTGTCTCTCTCGTAATGCCCGTAATGATCACTCTGGACTTCCTCTTTCT
GCATTTACTGCCTTTTGTACATACTTTTACATTTGTTATAACGGCTATTT
TTCAGATCAGGCCCCCCGATGCCGGGTGGCGCAGTCGTTTATTATTTTTG
TACTGACTTTTTGATGAAGTTTTGTACGGTTTTGTTTATTTAGGGGTTTT
TTTATTTATAATTCCATTGTTATTATGAATATATATAAATATTCGTTTTT
ATAAAAAAA
back to top

protein sequence of SMED30007927-orf-1

>SMED30007927-orf-1 ID=SMED30007927-orf-1|Name=SMED30007927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=575bp
MFMSEVNYTSMESSPQEEISNSDVENVAMSPDNNRIDVVSVEQLPFDDQS
SIKSGRNGDCSRSWTMEKVQVGYDITRKGERSLVVDGFKFTKSRDGTNNR
VFWRCSRRECKATAVTVCDRVEHVRAIHAHEPPMAAEFFGSQEGVSQRCQ
LQEVRFNTSAANMRPRYRRSTVSGSEGGNAEESSSVKDISNSNGIKIEKK
PANQNVTNPKPLISLVSAQPVFQIHSADKKHSYSSCSGLQKTPSVKEQVR
DFILRNSNIQPQSQTENNLSVAQFLISPASQTQFIQTNTTPLNSANSATG
STIFNFSTMQINASPNTGSDSTSEAPSHKSTPGGLMNLPTTPHDETQYKS
KTNSDCSGVNQLNLEQIIQILLNKNGPNRHRSSSDSEWMAGNSSSTVSYE
HESHELSPCAMPAPPLSADEQSYVATGVVHQSAPTPTRLIHWKKEKLRES
ESSDELFRRERKRRHEDINSNNCNTMIGLGASCLPELHAPSGVSCAGDSV
PVSTAATAAAASNELFSFLNSFRPTITHKLMGVMQKLSSELCPEEAVAQE
VFEKCTAIKTCLETLEKLHSLMSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007588Znf_FLYWCH