Tetratricopeptide repeat protein 23

Overview
NameTetratricopeptide repeat protein 23
Smed IDSMED30007920
Length (bp)1624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 23 (SMED30007920) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 23 (SMED30007920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat protein 23 (SMED30007920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 23 (SMED30007920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007920

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007920SMESG000010977.1 SmedASXL_009225SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007920SMESG000010977.1 dd_Smed_v6_15795_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007920SMESG000010977.1 dd_Smed_v4_15795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 85.1149 bits (209), Expect = 2.755e-17
Identity = 72/263 (27.38%), Postives = 128/263 (48.67%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            P ++L Q  K      +     ++ +  IR   LS I++  +HWK ++   +LA+ YL L G    A  ++HA+ A  +L        + KE  E L+ L+  +Y L  A L+  +  E+  N+ KA  N+ +L++L      EL      LTLA G+  L + +L  A  Y+      +  ++G+ + +LI +Y+   +IEQ      NH +AI+Y  +AH++    +   S +  + S  +A AY++ G  + + + E Y 
Sbjct:   66 PKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAYGYLTLRGLPVQA--KKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRGREAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAIGDVIAAKGDRTSDLISLYEEAAQIEQLR---RNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMSALLAKAYAMSGEAQHRDAVEIYF 323          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 84.7297 bits (208), Expect = 3.306e-17
Identity = 72/263 (27.38%), Postives = 128/263 (48.67%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            P ++L Q  K      +     ++ +  IR   LS I++  +HWK ++   +LA+ YL L G    A  ++HA+ A  +L        + KE  E L+ L+  +Y L  A L+  +  E+  N+ KA  N+ +L++L      EL      LTLA G+  L + +L  A  Y+      +  ++G+ + +LI +Y+   +IEQ      NH +AI+Y  +AH++    +   S +  + S  +A AY++ G  + + + E Y 
Sbjct:   66 PKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAYGYLTLRGLPVQA--KKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRGREAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAIGDVIAAKGDRTSDLISLYEEAAQIEQLR---RNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMSALLAKAYAMSGEAQHRDAVEIYF 323          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 84.7297 bits (208), Expect = 5.291e-17
Identity = 72/263 (27.38%), Postives = 128/263 (48.67%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            P ++L Q  K      +     ++ +  IR   LS I++  +HWK ++   +LA+ YL L G    A  ++HA+ A  +L        + KE  E L+ L+  +Y L  A L+  +  E+  N+ KA  N+ +L++L      EL      LTLA G+  L + +L  A  Y+      +  ++G+ + +LI +Y+   +IEQ      NH +AI+Y  +AH++    +   S +  + S  +A AY++ G  + + + E Y 
Sbjct:   66 PKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAYGYLTLRGLPVQA--KKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRGREAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAIGDVIAAKGDRTSDLISLYEEAAQIEQLR---RNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMSALLAKAYAMSGEAQHRDAVEIYF 323          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Match: TTC23 (tetratricopeptide repeat domain 23 [Source:HGNC Symbol;Acc:HGNC:25730])

HSP 1 Score: 76.2554 bits (186), Expect = 3.504e-14
Identity = 108/413 (26.15%), Postives = 198/413 (47.94%), Query Frame = 1
Query:  382 YDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQ---SNKAISIGNNKPPFSATSRPK*TFLSFAN 1611
            +  P ++L    + A+  + +++ ++++   +R  AL+ I Y  +HWK+++  V+LA  YL L G    A  ++HA +A + L+   V  ++E   ++  +  I   + + RA L L+K +E+  N+ KA     +L +   + +EE   I  ++ L+  ++    +K   A ++Y      ++ S+GE S E +PI + L  +EQ+   L  H  +I ++L+AH +      S   +   S+  VA A    G +E    AE Y +E +  L  + G        I  +    L  + +K  A S L+ +L+ + E FG +S  V  T +LLG   L+ G+   A K  K+ L I+ L  GP  K   + ++++  +++    ++K       K  F  TS P+ T L  A 
Sbjct:   38 FQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQA--KQHAEKARQILANSIVPPYSE--NTDVFKFSIELFHTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECVPILRELAGVEQA---LGLHDVSINHFLQAHLIILSRSPSQV-EAADSAHIVAHAAVASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAF-CTSIPQDTLLGKAR 441          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Match: TTC23 (tetratricopeptide repeat domain 23 [Source:HGNC Symbol;Acc:HGNC:25730])

HSP 1 Score: 76.2554 bits (186), Expect = 3.504e-14
Identity = 108/413 (26.15%), Postives = 198/413 (47.94%), Query Frame = 1
Query:  382 YDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQ---SNKAISIGNNKPPFSATSRPK*TFLSFAN 1611
            +  P ++L    + A+  + +++ ++++   +R  AL+ I Y  +HWK+++  V+LA  YL L G    A  ++HA +A + L+   V  ++E   ++  +  I   + + RA L L+K +E+  N+ KA     +L +   + +EE   I  ++ L+  ++    +K   A ++Y      ++ S+GE S E +PI + L  +EQ+   L  H  +I ++L+AH +      S   +   S+  VA A    G +E    AE Y +E +  L  + G        I  +    L  + +K  A S L+ +L+ + E FG +S  V  T +LLG   L+ G+   A K  K+ L I+ L  GP  K   + ++++  +++    ++K       K  F  TS P+ T L  A 
Sbjct:   38 FQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQA--KQHAEKARQILANSIVPPYSE--NTDVFKFSIELFHTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECVPILRELAGVEQA---LGLHDVSINHFLQAHLIILSRSPSQV-EAADSAHIVAHAAVASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAF-CTSIPQDTLLGKAR 441          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Zebrafish
Match: ttc23 (tetratricopeptide repeat domain 23 [Source:ZFIN;Acc:ZDB-GENE-050419-126])

HSP 1 Score: 64.6994 bits (156), Expect = 1.331e-10
Identity = 106/424 (25.00%), Postives = 196/424 (46.23%), Query Frame = 1
Query:  340 ADINIDEIAGNENGYD----TPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSG-QVIQSSRAVATAYSIIGTNESKKS---AESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAIN-----SQSNKAISIGNNKPPFSA 1572
            AD  I  I+  E+G +    TP+++L    + A   A++ + +  ++  IR  ALS ++Y   H+ +++ +  LA  YL   G  +A   +EHAS+A + LS+       ++E    L   +S H     A L L    E++ +  KA + L  +       +E+      ++     ++  R  +   A + +     L+   Q E    +  +Y+ +  IEQ+ G L +   AIE+ LKAH++A    +S  G +  Q + ++A AYS   T+E + +   A  Y +E I +     G  + L      D +  LL + +        + +L  +K  FG+ S  V  T QL+G ++++ G ++ A +  K+   I+ L  GP  K  ++ + S++ ++     S+  KA  +   +PPF A
Sbjct:   44 ADSTI--ISQKEDGKNYSMITPAEKLSLCERRAHSFADSEEYDPCIQELIRCLALSRLVYGNEHFAVAQAQSRLAKAYLQYKG--WAHQAQEHASQAHEVLSL-----CQQEERLSCLNCFLSIHQTHGSAALHLGNLAEAESSFQKAEIVLGDIVAQEATGKEDRLATEYEIFTNLARVYQRQGRPEKALSQFERTLELLH--QEEQLSRICFVYRNMAAIEQTQGHLDS---AIEHLLKAHSIAVS--QSAGGLEGAQITHSLALAYS--STSEPQHNVDLAARYFEESISAYRSALGPQDKLTLSAQDDFSHFLLLTGQHERCAEIQRESLSLKKSTFGELSTEVAETLQLIGGVEMTQGHMRHAHRTLKKCFEIQSLLYGPQHKKTKATQRSVDMLSQSPEVSEKRKASRV-ETRPPFCA 448          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Xenopus
Match: TTC23L (tetratricopeptide repeat domain 23-like [Source:NCBI gene;Acc:100379864])

HSP 1 Score: 107.842 bits (268), Expect = 9.020e-25
Identity = 90/329 (27.36%), Postives = 163/329 (49.54%), Query Frame = 1
Query:  271 RDPLDNNLNKDIDFIEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNE-KEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTE----EELFPISLKLT-----LAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNP 1227
            R P+   +  ++D        E AD  + EI+   +    P+++L     +AEH  + NK  ++ R  I+  ALS I+Y   HW+I++   +L + YL L      A    HA E+ K++ ++ V++    +E  E + +L++ +Y L  A L+    ++S  ++ K            ++ E    +E   I+LK++     LA G+ CL   K  +A NY+    + I +SQG+ + ELI +YQ + + E    K SN  +AIE+ L+AH+++  +Y S S +  QS   +A AY+    +E  ++A  +  E + +     G ++P
Sbjct:   24 RPPIVLPIPTELDMSISSRSGE-ADTGMKEISRYSDPDSPPAEKLANATIMAEHFMKENKCHKASRELIQCVALSRIVYGDGHWRIAQAHANLGYSYLTLRA--LPAQARTHA-ESAKNILLRGVDMAKSVEEKREIMASLVTIYYTLGMAHLMQNNGKDSYLSLQKVEK---------IIDELEDIQERKAITLKISEKDIALALGQACLLQTKASSAINYFEQAADSIISSQGDSASELISLYQDMARAEHMRKK-SN--RAIEHLLQAHSISQANYTSVSTEAAQSGLQLAKAYA---ASEYHEAAHRFFTESLGAYQTAAGPDDP 333          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Xenopus
Match: TTC23L (tetratricopeptide repeat domain 23-like [Source:NCBI gene;Acc:100379864])

HSP 1 Score: 107.457 bits (267), Expect = 1.600e-24
Identity = 90/329 (27.36%), Postives = 163/329 (49.54%), Query Frame = 1
Query:  271 RDPLDNNLNKDIDFIEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNE-KEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTE----EELFPISLKLT-----LAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNP 1227
            R P+   +  ++D        E AD  + EI+   +    P+++L     +AEH  + NK  ++ R  I+  ALS I+Y   HW+I++   +L + YL L      A    HA E+ K++ ++ V++    +E  E + +L++ +Y L  A L+    ++S  ++ K            ++ E    +E   I+LK++     LA G+ CL   K  +A NY+    + I +SQG+ + ELI +YQ + + E    K SN  +AIE+ L+AH+++  +Y S S +  QS   +A AY+    +E  ++A  +  E + +     G ++P
Sbjct:   24 RPPIVLPIPTELDMSISSRSGE-ADTGMKEISRYSDPDSPPAEKLANATIMAEHFMKENKCHKASRELIQCVALSRIVYGDGHWRIAQAHANLGYSYLTLRA--LPAQARTHA-ESAKNILLRGVDMAKSVEEKREIMASLVTIYYTLGMAHLMQNNGKDSYLSLQKVEK---------IIDELEDIQERKAITLKISEKDIALALGQACLLQTKASSAINYFEQAADSIISSQGDSASELISLYQDMARAEHMRKK-SN--RAIEHLLQAHSISQANYTSVSTEAAQSGLQLAKAYA---ASEYHEAAHRFFTESLGAYQTAAGPDDP 333          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Mouse
Match: Ttc23l (tetratricopeptide repeat domain 23-like [Source:MGI Symbol;Acc:MGI:1923027])

HSP 1 Score: 82.8037 bits (203), Expect = 2.020e-16
Identity = 74/292 (25.34%), Postives = 146/292 (50.00%), Query Frame = 1
Query:  316 EDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLK---LTLAAGKICLRLQKLVAASNYY-NMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            E++  ++ A + +D ++        P  +L Q  K       +    ++ +  IR   LS I++   HWK ++   +LA+ YL L G    A  ++HA +A  +L        ++K+  E L+TL+  +Y L  A L+    +++  ++ KA  N+ +L++   L    +  I +    LT+A G+  L + ++  A  Y+   +C++I   +G ++ ELI +Y+ + +IEQ      NH +AI+Y  +A+++    +   S Q  ++S  +A AY++ G +E + + E Y 
Sbjct:   43 EEDTAHQEAGMTVDCLS-------IPKKKLAQSQKKINQFINSKMSTKANKELIRCFILSQIVFGKEHWKCAQALANLAYGYLTLRG--LPAQAKKHAEKARNTLLTWKRNTTSDKDKKEILETLVRLYYTLGVAWLLQNHGKQAYIHLQKAERNMKELKE---LNNGNICGIQVSEKDLTIALGRASLAMHRMNLALAYFEKAICDVI-LDKGHNTSELISLYEEIAQIEQLR---KNHKQAIQYLQQAYSICVSSFSEVSPQTAEASALLAKAYAMSGASEYRDAVEIYF 318          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Mouse
Match: Ttc23l (tetratricopeptide repeat domain 23-like [Source:MGI Symbol;Acc:MGI:1923027])

HSP 1 Score: 82.4185 bits (202), Expect = 2.698e-16
Identity = 74/292 (25.34%), Postives = 146/292 (50.00%), Query Frame = 1
Query:  316 EDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLK---LTLAAGKICLRLQKLVAASNYY-NMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            E++  ++ A + +D ++        P  +L Q  K       +    ++ +  IR   LS I++   HWK ++   +LA+ YL L G    A  ++HA +A  +L        ++K+  E L+TL+  +Y L  A L+    +++  ++ KA  N+ +L++   L    +  I +    LT+A G+  L + ++  A  Y+   +C++I   +G ++ ELI +Y+ + +IEQ      NH +AI+Y  +A+++    +   S Q  ++S  +A AY++ G +E + + E Y 
Sbjct:   43 EEDTAHQEAGMTVDCLS-------IPKKKLAQSQKKINQFINSKMSTKANKELIRCFILSQIVFGKEHWKCAQALANLAYGYLTLRG--LPAQAKKHAEKARNTLLTWKRNTTSDKDKKEILETLVRLYYTLGVAWLLQNHGKQAYIHLQKAERNMKELKE---LNNGNICGIQVSEKDLTIALGRASLAMHRMNLALAYFEKAICDVI-LDKGHNTSELISLYEEIAQIEQLR---KNHKQAIQYLQQAYSICVSSFSEVSPQTAEASALLAKAYAMSGASEYRDAVEIYF 318          
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Match: sp|Q6PF05|TT23L_HUMAN (Tetratricopeptide repeat protein 23-like OS=Homo sapiens OX=9606 GN=TTC23L PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 1.323e-16
Identity = 72/263 (27.38%), Postives = 128/263 (48.67%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            P ++L Q  K      +     ++ +  IR   LS I++  +HWK ++   +LA+ YL L G    A  ++HA+ A  +L        + KE  E L+ L+  +Y L  A L+  +  E+  N+ KA  N+ +L++L      EL      LTLA G+  L + +L  A  Y+      +  ++G+ + +LI +Y+   +IEQ      NH +AI+Y  +AH++    +   S +  + S  +A AY++ G  + + + E Y 
Sbjct:   66 PKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAYGYLTLRGLPVQA--KKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRGREAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAIGDVIAAKGDRTSDLISLYEEAAQIEQLR---RNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMSALLAKAYAMSGEAQHRDAVEIYF 323          
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Match: sp|A6H6E9|TT23L_MOUSE (Tetratricopeptide repeat protein 23-like OS=Mus musculus OX=10090 GN=Ttc23l PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.413e-15
Identity = 74/292 (25.34%), Postives = 146/292 (50.00%), Query Frame = 1
Query:  316 EDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLK---LTLAAGKICLRLQKLVAASNYY-NMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYL 1179
            E++  ++ A + +D ++        P  +L Q  K       +    ++ +  IR   LS I++   HWK ++   +LA+ YL L G    A  ++HA +A  +L        ++K+  E L+TL+  +Y L  A L+    +++  ++ KA  N+ +L++   L    +  I +    LT+A G+  L + ++  A  Y+   +C++I   +G ++ ELI +Y+ + +IEQ      NH +AI+Y  +A+++    +   S Q  ++S  +A AY++ G +E + + E Y 
Sbjct:   43 EEDTAHQEAGMTVDCLS-------IPKKKLAQSQKKINQFINSKMSTKANKELIRCFILSQIVFGKEHWKCAQALANLAYGYLTLRG--LPAQAKKHAEKARNTLLTWKRNTTSDKDKKEILETLVRLYYTLGVAWLLQNHGKQAYIHLQKAERNMKELKE---LNNGNICGIQVSEKDLTIALGRASLAMHRMNLALAYFEKAICDVI-LDKGHNTSELISLYEEIAQIEQLR---KNHKQAIQYLQQAYSICVSSFSEVSPQTAEASALLAKAYAMSGASEYRDAVEIYF 318          
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Match: sp|A6H7D1|TT23L_BOVIN (Tetratricopeptide repeat protein 23-like OS=Bos taurus OX=9913 GN=TTC23L PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.369e-14
Identity = 70/251 (27.89%), Postives = 119/251 (47.41%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIG 1143
            P ++L Q  K      +  K  E+ +  IR   LS I++   HWK ++    LA+ YL L G    A  ++HA  A   L        ++KE  + L+TL+  +Y L    L+     E+  N+ K+  N+ +L +        L      LT+A G+  L   +L  A  Y+    + +  ++G+ + EL+ +YQ + +IEQ      NH +AI+Y  +AH++    Y   S Q  ++S  +A AY++ G
Sbjct:   64 PREKLAQSQKKIAQLIKGKKNIEANKELIRCVTLSRIIFGEEHWKCAQALATLAYGYLTLRG--LPAQAKKHAESAKNVLLTWKGTTTSDKEEKQILETLVMLYYTLGVVCLLQNHGREAYFNLQKSERNMKELRESYKGGTCGLQVSEKDLTVALGRASLANCRLNLALVYFEKAVDNVIANKGDSTSELVSLYQEIAQIEQLR---RNHEQAIQYLHQAHSICVSLYTEVSPQAAEASALLAKAYAMSG 309          
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Match: sp|Q2KHY7|TTC23_BOVIN (Tetratricopeptide repeat protein 23 OS=Bos taurus OX=9913 GN=TTC23 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.768e-14
Identity = 97/404 (24.01%), Postives = 188/404 (46.53%), Query Frame = 1
Query:  382 YDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQSN---KAISIGNNKPPFSATSRP 1584
            +  P ++L    + A+  A +++ +++L   +   AL+ I Y  +HWK+++  V+LA  YL L G    A  ++HA +A + L+      +++   ++  +  +   + L +A L L+K +E+  N+ KA +   ++ +   + +EE   I  ++ L+  ++    +K   A  +Y       + S+GE S+E +PI + L   EQ+   L  H  +I   ++AH +  +   S   +   S+ +VA A    G  E    AE Y ++ + +L    G+       I  D    L  + +  +A S  + +L+ +  +FG +S  V  T +LLG   L+ G+   A K  K+ L I+ L  GP  K   + +++++ ++       +       K  F A  RP
Sbjct:   38 FQPPREKLRLSEEKAKSYASSHEYKKALHELVHCMALTRICYGDSHWKLAEAHVNLAKGYLQLKGMSLRA--KQHAEKAKEILTSSVAPPYSD--NTDVFKCSVELFHTLGQALLSLQKFKEASKNLTKAEILSKEMLQCGKIIKEEWMEIQARIKLSFAQVYQGQKKSKEALPHYQEALEYTEISRGEKSLECVPILRELAAAEQA---LGFHDASINNLIQAHLIVLRGSPSRE-EAATSAHSVACAAIASGRPEHHDVAEQYFQDSMANLKDAEGKETAKFLSIQDDYCHFLQVTGQDEKATSIFRESLEAKVAVFGDFSPEVAETYRLLGVADLAQGNQTGAHKKLKKCLQIQTLLYGPQDKRTLATQQTMDILSKAPEVPARPRPSPGAKAAFCAGGRP 433          
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Match: sp|Q5W5X9|TTC23_HUMAN (Tetratricopeptide repeat protein 23 OS=Homo sapiens OX=9606 GN=TTC23 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.683e-13
Identity = 108/413 (26.15%), Postives = 198/413 (47.94%), Query Frame = 1
Query:  382 YDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQ---SNKAISIGNNKPPFSATSRPK*TFLSFAN 1611
            +  P ++L    + A+  + +++ ++++   +R  AL+ I Y  +HWK+++  V+LA  YL L G    A  ++HA +A + L+   V  ++E   ++  +  I   + + RA L L+K +E+  N+ KA     +L +   + +EE   I  ++ L+  ++    +K   A ++Y      ++ S+GE S E +PI + L  +EQ+   L  H  +I ++L+AH +      S   +   S+  VA A    G +E    AE Y +E +  L  + G        I  +    L  + +K  A S L+ +L+ + E FG +S  V  T +LLG   L+ G+   A K  K+ L I+ L  GP  K   + ++++  +++    ++K       K  F  TS P+ T L  A 
Sbjct:   38 FQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQA--KQHAEKARQILANSIVPPYSE--NTDVFKFSIELFHTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECVPILRELAGVEQA---LGLHDVSINHFLQAHLIILSRSPSQV-EAADSAHIVAHAAVASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAF-CTSIPQDTLLGKAR 441          
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Match: A0A2T7PSL2 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_03406 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 5.014e-38
Identity = 139/410 (33.90%), Postives = 217/410 (52.93%), Query Frame = 1
Query:  295 NKDIDFIEDEEPNEHADIN-------IDEIAGNENGYDT-----------PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNE-KEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNG 1467
            + DI   EDEE  E+  I+        D+ A     Y T           P   L    K A   +   K + ++   IR TAL+ I+Y   HWK+++  VDL   YLDL G  YA+  E HA E  KS+ +    +    +E +E    LI  +Y L RA  ++KK  E +  ++KA     +   L  +T +E     ++L LA  ++  R +K   +S  Y+   +LI+   G DS+ LI +    G++EQSNG+ SNH KAI  + +AH +A  +Y+  S + + ++ A+A AY+  G  E++ SAESYL EC+      HG ++P    +  +LARLL+R++R  EA++ LKS++  + ++FG YSE V  T +L+GS+ L+ GS + AL  +K+   IE+L  G
Sbjct:   70 DSDITLSEDEEDMENGHISEHRQASSPDDGASPRRQYKTVNGKKHIDMTPPDQLLSTAQKRARKLSVLRKADRAIYEYIRCTALTRIVYGSYHWKLAESHVDLGEAYLDLKG--YASQAEYHA-ETAKSIMLHGAHVSGSVEEKAEIYSVLIRMYYTLGRACTVMKKYSEGEQYLNKADRIAQERSHLDCVTNKECDKTDIQLFLAMARLYGRQKKHALSSEKYDKSISLIEKVYGPDSMRLIAVLHDYGRLEQSNGRYSNHEKAIGLFQQAHDIATVNYKQGSKETVDTALALAQAYANTGREEAEGSAESYLNECLAVCTTVHGPHHPRSLVVQDELARLLIRTNRHEEAMAILKSSVSPKCQVFGDYSEQVSDTYKLMGSVHLAQGSTEKALHCYKKCYTIEKLVLG 476          
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Match: A0A267GPS8 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032766g1 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.497e-37
Identity = 126/390 (32.31%), Postives = 218/390 (55.90%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFN----EKEGS----------EYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESH-SGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAI 1515
            P + LE+  +LA   A   +   ++R  +R TAL  ++Y P H+K ++   +LA  YLD  G  ++   EEHA  A K++ +   E F+    +  GS          E+L+  +  ++ L RAQ +LKK  +++ ++ KA   + +L KLS++  + L     K+  +  KI  +L K +A+ +YY       +   G+ S EL+P+YQ +G  EQ   +  NH KAIE YLKAH +A  H +   + +   ++R++ATAY+  G   ++ SAESY++EC+ + +  HG  +P VCE   +LA+LL+R+D+  E    L+ N+K + ++ G +S  VL + +LLGSL LS G ++ AL+  +    I E+ +GP  ++ + ++ +I+ +
Sbjct:  130 PDELLERAKRLATKFAARRQWNNAMRQLVRQTALCVLVYGPQHFKYAEAYTELAKGYLDYKGPSFSQQAEEHAEHA-KNILLGQQEAFDGAAVDVTGSGLAGSELTRLEFLKVSLVTYHTLGRAQSLLKKFPDAEQSLIKAEKVVQELSKLSIVKFDFLLEAKQKIWTSLAKISAKLNKPMASVSYYEQAIAACEKRYGKGSQELVPLYQGVGATEQCRPEFPNHEKAIEMYLKAHEIATAHAKGEFTEEAAGTARSLATAYAKCGDVAAQASAESYMQECLTAYLQLHGPEHPSVCEAQDELAKLLIRADKIDEGARLLQENVKVKAKVHGDFSPQVLDSYRLLGSLWLSQGRLEKALQDLQRAFDIAEVLHGPGCRICRELQPTIDTV 518          
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Match: A0A1I8JKN9 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.608e-36
Identity = 132/422 (31.28%), Postives = 231/422 (54.74%), Query Frame = 1
Query:  388 TPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFN----EKEGS----------EYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESH-SGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAI----NSQSNKAISIGNNKPPFSA----TSRP 1584
             P + LE+  +LA   A   +   ++R  +R TAL  ++Y P H+K ++   +LA  YLD  G  ++   EEHA  A K++ +   E F+    +  GS          E+L+  +  ++ L RAQ +LKK  +++ ++ KA   + +L KLS++  + L     K+  +  KI  +L K +A+ +YY       +   G+ S EL+P+YQ +G  EQS  +  NH KAIE YLKAH +A  H +   + +   ++R++ATAY+  G   ++ SAESY++EC+ + +  HG  +  VCE   +LA+LL+R+D+  E    L+ N+K + ++ G +S  VL + +LLGSL LS G ++ AL+  +    I E+ +GP  ++ + ++ +I+ +    + +  +A     N+P F+     +S+P
Sbjct:  113 APDELLERAKRLAAKFAARRQWNNAMRQLVRQTALCVLVYGPQHFKYAEAYTELAKGYLDYKGPSFSQQAEEHAEHA-KNILLGQQEAFDGAAVDVTGSGLAGSELTRLEFLKVSLVTYHTLGRAQSLLKKFPDAEQSLIKAEKVVQELSKLSIVKFDFLLEAKQKIWTSLAKISAKLNKPMASVSYYEQAIAACEKRYGKGSQELVPLYQGVGATEQSRPEFPNHEKAIEMYLKAHEIATAHAKGEFTEEAAGTARSLATAYAKCGDVAAQASAESYMQECLTACLQLHGPEHQSVCEAQDELAKLLIRADKIDEGARLLQENVKVKAKVHGDFSPQVLDSYRLLGSLWLSQGRLEKALQDLQRAFDIAEVLHGPGCRICRELQPTIDTVLKHPSMEGKQAGYEMKNRPRFNGIVARSSKP 533          
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Match: A0A267E9D2 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032766g2 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.620e-36
Identity = 126/390 (32.31%), Postives = 218/390 (55.90%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFN----EKEGS----------EYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESH-SGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAI 1515
            P + LE+  +LA   A   +   ++R  +R TAL  ++Y P H+K ++   +LA  YLD  G  ++   EEHA  A K++ +   E F+    +  GS          E+L+  +  ++ L RAQ +LKK  +++ ++ KA   + +L KLS++  + L     K+  +  KI  +L K +A+ +YY       +   G+ S EL+P+YQ +G  EQS  +  NH KAIE YLKAH +A  H +   + +   ++R++ATAY+  G   ++ SAESY++EC+ + +  HG  +  VCE   +LA+LL+R+D+  E    L+ N+K + ++ G +S  VL + +LLGSL LS G ++ AL+  +    I E+ +GP  ++ + ++ +I+ +
Sbjct:  130 PDELLERAKRLAAKFAARRQWNNAMRQLVRQTALCVLVYGPQHFKYAEAYTELAKGYLDYKGPSFSQQAEEHAEHA-KNILLGQQEAFDGAAVDVTGSGLAGSELTRLEFLKVSLVTYHTLGRAQSLLKKFPDAEQSLIKAEKVVQELSKLSIVKFDFLLEAKQKIWTSLAKISAKLNKPMASVSYYEQAIAACEKRYGKGSQELVPLYQGVGATEQSRPEFPNHEKAIEMYLKAHEIATAHAKGEFTEEAAGTARSLATAYAKCGDVAAQASAESYMQECLTACLQLHGPEHQSVCEAQDELAKLLIRADKIDEGARLLQENVKVKAKVHGDFSPQVLDSYRLLGSLWLSQGRLEKALQDLQRAFDIAEVLHGPGCRICRELQPTIDTV 518          
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Match: A0A267E5D5 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032766g3 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.786e-36
Identity = 126/390 (32.31%), Postives = 218/390 (55.90%), Query Frame = 1
Query:  391 PSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFN----EKEGS----------EYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESH-SGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAI 1515
            P + LE+  +LA   A   +   ++R  +R TAL  ++Y P H+K ++   +LA  YLD  G  ++   EEHA  A K++ +   E F+    +  GS          E+L+  +  ++ L RAQ +LKK  +++ ++ KA   + +L KLS++  + L     K+  +  KI  +L K +A+ +YY       +   G+ S EL+P+YQ +G  EQS  +  NH KAIE YLKAH +A  H +   + +   ++R++ATAY+  G   ++ SAESY++EC+ + +  HG  +  VCE   +LA+LL+R+D+  E    L+ N+K + ++ G +S  VL + +LLGSL LS G ++ AL+  +    I E+ +GP  ++ + ++ +I+ +
Sbjct:  130 PDELLERAKRLAAKFAARRQWNNAMRQLVRQTALCVLVYGPQHFKYAEAYTELAKGYLDYKGPSFSQQAEEHAEHA-KNILLGQQEAFDGAAVDVTGSGLAGSELTRLEFLKVSLVTYHTLGRAQSLLKKFPDAEQSLIKAEKVVQELSKLSIVKFDFLLEAKQKIWTSLAKISAKLNKPMASVSYYEQAIAACEKRYGKGSQELVPLYQGVGATEQSRPEFPNHEKAIEMYLKAHEIATAHAKGEFTEEAAGTARSLATAYAKCGDVAAQASAESYMQECLTACLQLHGPEHQSVCEAQDELAKLLIRADKIDEGARLLQENVKVKAKVHGDFSPQVLDSYRLLGSLWLSQGRLEKALQDLQRAFDIAEVLHGPGCRICRELQPTIDTV 518          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Sea Lamprey
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 79.7221 bits (195), Expect = 5.992e-17
Identity = 71/256 (27.73%), Postives = 126/256 (49.22%), Query Frame = 1
Query:  457 ESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENN 1224
            E++   IR  ALS I++   HW++++   +LAH YL L G    A       +A+   +  +     E+  +  L+TL + +  L +A       +E++  + +A    N+L K  ++ E E   + +++T A G++ ++ +K   A         L+Q S GEDS ELIP YQ L   E +     NH +AIE  L+AH++A   Y + S +  +++  +A A +     E +  AE Y  E + S  + +G ++
Sbjct:    1 EAMTELIRCVALSRIVFGDEHWQVAQAYANLAHGYLSLRGLAPQAKLHCETGQAIMLTAPHSPSSPGER--TNILKTLFTIYCTLGKA----NTHKEAEQGLLRAEQIANELSKTGMVLEREQGDMDVEVTQALGRLSIQQEKPALAVERLKKTLKLLQLSVGEDSPELIPAYQDLAHAEDAR---QNHQQAIENLLQAHSIALASYTTDSKEAAETAHIMAKACAAAKDEEFEGLAEKYFVESLNSYELVYGSDS 247          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Sea Lamprey
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 75.485 bits (184), Expect = 9.625e-16
Identity = 65/224 (29.02%), Postives = 112/224 (50.00%), Query Frame = 1
Query:  457 ESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATA 1128
            E++   IR  ALS I++   HW++++   +LAH YL L G    A       +A+   +  +     E+  +  L+TL + +  LA   L     +E++  + +A    N+L K  ++ E E   + +++T A G++ ++ +K   A         L+Q S GEDS ELIP YQ L   E +     NH +AIE  L+AH++A   Y + S +  +++  +A A
Sbjct:    1 EAMTELIRCVALSRIVFGDEHWQVAQAYANLAHGYLSLRGLAPQAKLHCETGQAIMLTAPHSPSSPGER--TNILKTLFTIYCTLAICCLTNITLKEAEQGLLRAEQIANELSKTGMVLEREQGDMDVEVTQALGRLSIQQEKPALAVERLKKTLKLLQLSVGEDSPELIPAYQDLAHAEDAR---QNHQQAIENLLQAHSIALASYTTDSKEAAETAHIMAKA 219          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Sea Lamprey
Match: TTC23L (tetratricopeptide repeat domain 23 like [Source:HGNC Symbol;Acc:HGNC:26355])

HSP 1 Score: 63.1586 bits (152), Expect = 4.180e-11
Identity = 90/356 (25.28%), Postives = 172/356 (48.31%), Query Frame = 1
Query:  457 ESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPIS--LKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAIN 1518
            E++   IR  ALS I++   HW++++   +LAH YL L G    A       +A+   +  +     E+  +  L+TL + +  L +A            N    L  ++       ++E      +  L + L A ++ ++ +K   A         L+Q S GEDS ELIP YQ L   E +     NH +AIE  L+AH++A   Y + S +  +++  +A A +     E +  AE Y  E + S  + +G ++     +  DL  LL+R+ R  EA+ +L+ +L  +  +FG++S+ +  T  L+G ++++ G ++ A K+  + L ++ +  G   K  +S +++++ ++
Sbjct:    1 EAMTELIRCVALSRIVFGDEHWQVAQAYANLAHGYLSLRGLAPQAKLHCETGQAIMLTAPHSPSSPGER--TNILKTLFTIYCTLGKA------------NTHGMLGLIHLWMIRLSMSEMHCILAAHLLGVCLVAIRLSIQQEKPALAVERLKKTLKLLQLSVGEDSPELIPAYQDLAHAEDAR---QNHQQAIENLLQAHSIALASYTTDSKEAAETAHIMAKACAAAKDEEFEGLAEKYFVESLNSYELVYGSDSTEWLCVQDDLCHLLVRAKRHQEAIIRLQISLNVKASVFGEFSKELAETHHLMGGIRMAEGQLEKAYKHLNKCLDVQTILYGAQHKKTKSTQKTLDMLS 339          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Nematostella
Match: EDO28658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5V2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.665e-7
Identity = 69/277 (24.91%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  316 EDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQ-----TLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPIS-LKLTLAAGKICLRLQKLVAASNYY---NMVCNLIQTSQ-------------------GEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTL 1062
            E E  NE  D N+        G   P   L++  K A   A     EES+  RIR  AL+ I+Y   HW+++K    LA+ Y  L G    A+  +HA  A  +L   A +   ++    Y +      L   +  + +A   LK  ++++ N+ KA L   + E    + +    P   +K+ +A GK+ ++L K+  A +      + C LI+  +                   G+ S EL   +Q +G I     K      A+++++KA+T+
Sbjct:   85 EFESANEPEDENL-----GAPGLTPPEVLLKRMRKRARELAAQGAGEESVFDRIRCVALTRIVYGDYHWQLAKAYSKLAYAYFHLRGLAPQAL--KHAENARDTL--LAADDMRQQYRQHYTREDIVPVLQLTYLTMGQAHAALKHFQKAEQNLKKAELVSQERED---MQQGHRNPDRYIKVLMALGKVAMKLNKVGYAMDCLEKDELCCLLIRQGRLDEALSLLKKLITAKSEIHGDPSNELATAHQLMGSIRLKQAKTEV---ALKHFMKAYTM 346          
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Nematostella
Match: EDO46524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ9])

HSP 1 Score: 49.2914 bits (116), Expect = 2.775e-6
Identity = 72/265 (27.17%), Postives = 115/265 (43.40%), Query Frame = 1
Query:  316 EDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQ-----TLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPIS-LKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSG 1092
            E E  NE  D N+        G   P   L++  K A   A     EES+  RIR  AL+ I+Y   HW+++K    LA+ Y  L G    A+  +HA  A  +L   A +   ++    Y +      L   +  + +A   LK  ++++ N+ KA L   + E    + +    P   +K+ +A GK+ ++L K+      Y M C      + EDSVE+      +     S G++ +  KA E     HT  + + E HSG
Sbjct:   85 EFESANEPEDENL-----GAPGLTPPEVLLKRMRKRARELAAQGAGEESVFDRIRCVALTRIVYGDYHWQLAKAYSKLAYAYFHLRGLAPQAL--KHAENARDTL--LAADDMRQQYRQHYTREDIVPVLQLTYLTMGQAHAALKHFQKAEQNLKKAELVSQERED---MQQGHRNPDRYIKVLMALGKVAMKLNKV-----GYAMDC-----LEKEDSVEVADSAFMVSLAYLSTGEVEDEEKASELL---HTTIDIYME-HSG 323          
BLAST of Tetratricopeptide repeat protein 23 vs. Planmine SMEST
Match: SMESG000010977.1 (SMESG000010977.1)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 475/475 (100.00%), Postives = 475/475 (100.00%), Query Frame = 1
Query:  163 MATIKIPGTIHIDKIDTEYSEDESIYEHITIEELHERDPLDNNLNKDIDFIEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKAXXXXXXXXXXSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINXXXXXXXXXXXXKFEAXXXXXXXXXXXXXXFGQYSEPVLTTCXXXXXXXXXXXXIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQSNKAISIGNNKPPFSATSRPK 1587
            MATIKIPGTIHIDKIDTEYSEDESIYEHITIEELHERDPLDNNLNKDIDFIEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKALLNLNKLEKLSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINSDLARLLLRSDRKFEALSKLKSNLKKEKELFGQYSEPVLTTCQLLGSLQLSSGSIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQSNKAISIGNNKPPFSATSRPK
Sbjct:    1 MATIKIPGTIHIDKIDTEYSEDESIYEHITIEELHERDPLDNNLNKDIDFIEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEESLRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHASEALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNIDKALLNLNKLEKLSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYNMVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTLANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINHGENNPLVCEINSDLARLLLRSDRKFEALSKLKSNLKKEKELFGQYSEPVLTTCQLLGSLQLSSGSIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINAINSQSNKAISIGNNKPPFSATSRPK 475          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC23L2.755e-1727.38tetratricopeptide repeat domain 23 like [Source:HG... [more]
TTC23L3.306e-1727.38tetratricopeptide repeat domain 23 like [Source:HG... [more]
TTC23L5.291e-1727.38tetratricopeptide repeat domain 23 like [Source:HG... [more]
TTC233.504e-1426.15tetratricopeptide repeat domain 23 [Source:HGNC Sy... [more]
TTC233.504e-1426.15tetratricopeptide repeat domain 23 [Source:HGNC Sy... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc231.331e-1025.00tetratricopeptide repeat domain 23 [Source:ZFIN;Ac... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TTC23L9.020e-2527.36tetratricopeptide repeat domain 23-like [Source:NC... [more]
TTC23L1.600e-2427.36tetratricopeptide repeat domain 23-like [Source:NC... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ttc23l2.020e-1625.34tetratricopeptide repeat domain 23-like [Source:MG... [more]
Ttc23l2.698e-1625.34tetratricopeptide repeat domain 23-like [Source:MG... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PF05|TT23L_HUMAN1.323e-1627.38Tetratricopeptide repeat protein 23-like OS=Homo s... [more]
sp|A6H6E9|TT23L_MOUSE1.413e-1525.34Tetratricopeptide repeat protein 23-like OS=Mus mu... [more]
sp|A6H7D1|TT23L_BOVIN2.369e-1427.89Tetratricopeptide repeat protein 23-like OS=Bos ta... [more]
sp|Q2KHY7|TTC23_BOVIN4.768e-1424.01Tetratricopeptide repeat protein 23 OS=Bos taurus ... [more]
sp|Q5W5X9|TTC23_HUMAN1.683e-1326.15Tetratricopeptide repeat protein 23 OS=Homo sapien... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PSL25.014e-3833.90Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267GPS82.497e-3732.31TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A1I8JKN91.608e-3631.28TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A267E9D21.620e-3632.31TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A267E5D51.786e-3632.31TPR_REGION domain-containing protein OS=Macrostomu... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TTC23L5.992e-1727.73tetratricopeptide repeat domain 23 like [Source:HG... [more]
TTC23L9.625e-1629.02tetratricopeptide repeat domain 23 like [Source:HG... [more]
TTC23L4.180e-1125.28tetratricopeptide repeat domain 23 like [Source:HG... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO286581.665e-724.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465242.775e-627.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 23 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010977.10.000e+0100.00SMESG000010977.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007920 ID=SMED30007920|Name=Tetratricopeptide repeat protein 23|organism=Schmidtea mediterranea sexual|type=transcript|length=1624bp
CTCATCATTGCTCAAAACGTCTACAATATATGTTGAGCAAAAATATTTTA
TTCTTCTATTCCATTCTGAGTTATTAGTAAAACGAATATGGGAAATACGA
TTATTTTATAGACTAATACTTGTTTTAATAATTCGAATACATAGTCATTA
GTAACATTATAAATGGCAACTATTAAAATTCCTGGTACAATTCATATTGA
TAAAATTGATACTGAATATAGTGAAGATGAGTCTATCTATGAACACATTA
CTATTGAAGAATTACATGAAAGAGATCCGTTAGATAATAATCTCAATAAA
GATATAGATTTTATTGAAGATGAAGAACCAAACGAGCACGCAGATATTAA
TATAGACGAAATTGCAGGAAATGAAAATGGTTATGATACACCTTCTGATA
GACTTGAACAGGAGATAAAATTAGCTGAACATGATGCCGAAAATAATAAA
ATAGAAGAAAGTCTTAGACATAGAATAAGAATAACTGCTCTGAGTAATAT
ATTATATTCGCCTAATCATTGGAAAATTTCAAAATTCAGAGTTGATTTGG
CTCATTGCTATCTCGATTTAATGGGTTCAAGATATGCAGCAATTTGCGAA
GAACATGCAAGCGAGGCCTTAAAATCTCTATCTATGCAGGCAGTGGAAAT
TTTTAATGAAAAAGAAGGTTCGGAATATCTTCAAACCTTAATATCTGCTC
ATTATGCACTTGCGCGGGCACAATTAATTTTAAAAAAATGCGAAGAAAGT
CAACATAATATAGATAAGGCTTTGTTGAACTTAAATAAATTGGAAAAGTT
ATCCGTGTTGACAGAAGAAGAACTATTTCCTATTTCTTTAAAGTTGACAT
TGGCTGCTGGCAAAATTTGTTTACGCTTACAAAAATTAGTAGCAGCTTCA
AATTATTATAATATGGTATGCAACCTTATCCAAACAAGCCAAGGTGAAGA
TTCAGTGGAATTAATTCCTATATACCAATTTTTAGGAAAGATAGAGCAAA
GCAATGGAAAATTATCAAATCATCCTAAAGCAATTGAATATTATTTAAAG
GCACACACACTTGCTAATAAACACTATGAAAGCCACAGTGGCCAAGTCAT
ACAAAGTTCTCGAGCCGTTGCAACAGCGTATTCAATAATTGGAACAAATG
AATCGAAAAAATCTGCTGAAAGTTACTTGAAAGAATGTATTCAATCCTTG
ATAATTAATCACGGTGAAAATAATCCTCTAGTCTGTGAAATAAATTCTGA
CTTAGCGCGATTATTACTGAGATCTGATCGAAAATTTGAAGCTCTCTCTA
AACTGAAGTCAAATTTAAAAAAAGAAAAGGAGTTGTTTGGTCAATATTCC
GAACCTGTCCTTACTACATGTCAGTTACTTGGTTCTTTGCAGTTGTCTTC
TGGCAGCATTAAAGACGCTTTAAAGTATTTTAAAGAAGGCCTTATAATTG
AAGAATTGCAAAATGGCCCCAACAGTAAAGTTGCTCAAAGCATTAAAGAA
AGTATAAATGCAATTAATTCACAATCAAATAAGGCCATTTCGATAGGAAA
CAATAAGCCACCCTTCAGTGCAACTTCGCGTCCTAAATAAACATTTTTAT
CTTTTGCAAATATAATAATTGTGA
back to top

protein sequence of SMED30007920-orf-1

>SMED30007920-orf-1 ID=SMED30007920-orf-1|Name=SMED30007920-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MATIKIPGTIHIDKIDTEYSEDESIYEHITIEELHERDPLDNNLNKDIDF
IEDEEPNEHADINIDEIAGNENGYDTPSDRLEQEIKLAEHDAENNKIEES
LRHRIRITALSNILYSPNHWKISKFRVDLAHCYLDLMGSRYAAICEEHAS
EALKSLSMQAVEIFNEKEGSEYLQTLISAHYALARAQLILKKCEESQHNI
DKALLNLNKLEKLSVLTEEELFPISLKLTLAAGKICLRLQKLVAASNYYN
MVCNLIQTSQGEDSVELIPIYQFLGKIEQSNGKLSNHPKAIEYYLKAHTL
ANKHYESHSGQVIQSSRAVATAYSIIGTNESKKSAESYLKECIQSLIINH
GENNPLVCEINSDLARLLLRSDRKFEALSKLKSNLKKEKELFGQYSEPVL
TTCQLLGSLQLSSGSIKDALKYFKEGLIIEELQNGPNSKVAQSIKESINA
INSQSNKAISIGNNKPPFSATSRPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042621TTC23/TTC23L
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 78..98
NoneNo IPR availableCOILSCoilCoilcoord: 193..220
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 211..465
e-value: 5.2E-15
score: 57.2
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 287..429
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 177..308
IPR042621Tetratricopeptide repeat protein TTC23/TTC23LPANTHERPTHR14485TETRATRICOPEPTIDE REPEAT PROTEIN 23coord: 46..458