SMED30007917

Overview
NameSMED30007917
Smed IDSMED30007917
Length (bp)1679
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007917 (SMED30007917) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007917 (SMED30007917) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007917 (SMED30007917) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007917 (SMED30007917) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007917

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30007917SMESG000070256.1 dd_Smed_v4_410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30007917SMESG000070256.1 dd_Smed_v4_410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007917SMESG000070256.1 dd_Smed_v4_410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007917SMESG000070256.1 dd_Smed_v4_410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007917SMESG000070256.1 Contig53630newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007917SMESG000070256.1 Contig53630uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30007917SMESG000070256.1 dd_Smed_v6_410_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007917 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007285:5633..9720 -8271
Homology
BLAST of SMED30007917 vs. Ensembl Human
Match: AP006333.1 (fibronectin leucine rich transmembrane protein 1 [Source:NCBI gene;Acc:23769])

HSP 1 Score: 50.447 bits (119), Expect = 8.776e-6
Identity = 84/332 (25.30%), Postives = 137/332 (41.27%), Query Frame = 2
Query:  113 CKTTKNIMDCKGKGLTDCPA-ANKSVTVLILDENNL------TDLRTK-----------NCKNWTNLMSLSVRKNKLKN-------SLTFETFKVLGFLDLSENQLSSLALSGD------QLXXXXXXXXFLSGLEVNLPNVLQ-LIASNNRMGKLNFGNLILDLHKSP---SLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFN---------YFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWM---IKHKAIVVNPQNTMCKYPSKIRIFEVK 964
            C+     + C  +GLT  PA      T L L  N +       DL+TK           +   +   +  S+R+  L++         +     +L  L L +N +S++++  D      QL ++ +S N LS +   LP+ L+ L   +NR+  +        LH      SL  L +  N + +  +   TF+  +NLT ++L RN L+    N         Y  DN I    +  +N +A +          LD SNN L+ +     D   NL  +    NP  C CN     + W+   +K +A VVN +  MC+ P K+R   +K
Sbjct:   58 CRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTI-------PLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAIS---HIPYNTLAKMR-----ELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCN-----LMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIK 369          
BLAST of SMED30007917 vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0075614)

HSP 1 Score: 51.2174 bits (121), Expect = 2.732e-6
Identity = 68/278 (24.46%), Postives = 123/278 (44.24%), Query Frame = 2
Query:  200 LDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVL---GFLDLSENQLSSLALSGDQLXXXXXXXXF-------LSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSF---NRIADIDIDSKLH---FGYLDFSNNQLSKVNGEKLDLFV-----NLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQ 970
            L EN +T +     K   NL  L +  N L+N +T  TF+ L     L+L+ N+++ +     +++    +          ++GL  N+P++L L  S+NR+   ++G      H   +L  LD+ +NR++SL       +  K  T+++S NQL  +       + I  +I   F   N I  +D D+ +H      +D   NQ++ ++ + L +        L       NP +C CN     I+W+ K   I      T  +YP  + +  + C+
Sbjct:  526 LGENMITVMEDSAFKGLGNLYGLRLIGNYLEN-ITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDNRLESFDYG------HVPSTLQWLDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQLQRIG-----PSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-----IDWLQKINHI------TSRQYPRIMDLETIYCK 780          
BLAST of SMED30007917 vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0306307)

HSP 1 Score: 51.2174 bits (121), Expect = 2.732e-6
Identity = 68/278 (24.46%), Postives = 123/278 (44.24%), Query Frame = 2
Query:  200 LDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVL---GFLDLSENQLSSLALSGDQLXXXXXXXXF-------LSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSF---NRIADIDIDSKLH---FGYLDFSNNQLSKVNGEKLDLFV-----NLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQ 970
            L EN +T +     K   NL  L +  N L+N +T  TF+ L     L+L+ N+++ +     +++    +          ++GL  N+P++L L  S+NR+   ++G      H   +L  LD+ +NR++SL       +  K  T+++S NQL  +       + I  +I   F   N I  +D D+ +H      +D   NQ++ ++ + L +        L       NP +C CN     I+W+ K   I      T  +YP  + +  + C+
Sbjct:  526 LGENMITVMEDSAFKGLGNLYGLRLIGNYLEN-ITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDNRLESFDYG------HVPSTLQWLDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQLQRIG-----PSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-----IDWLQKINHI------TSRQYPRIMDLETIYCK 780          
BLAST of SMED30007917 vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0306308)

HSP 1 Score: 51.2174 bits (121), Expect = 2.732e-6
Identity = 68/278 (24.46%), Postives = 123/278 (44.24%), Query Frame = 2
Query:  200 LDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVL---GFLDLSENQLSSLALSGDQLXXXXXXXXF-------LSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSF---NRIADIDIDSKLH---FGYLDFSNNQLSKVNGEKLDLFV-----NLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQ 970
            L EN +T +     K   NL  L +  N L+N +T  TF+ L     L+L+ N+++ +     +++    +          ++GL  N+P++L L  S+NR+   ++G      H   +L  LD+ +NR++SL       +  K  T+++S NQL  +       + I  +I   F   N I  +D D+ +H      +D   NQ++ ++ + L +        L       NP +C CN     I+W+ K   I      T  +YP  + +  + C+
Sbjct:  526 LGENMITVMEDSAFKGLGNLYGLRLIGNYLEN-ITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDNRLESFDYG------HVPSTLQWLDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQLQRIG-----PSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-----IDWLQKINHI------TSRQYPRIMDLETIYCK 780          
BLAST of SMED30007917 vs. Ensembl Zebrafish
Match: lrrtm1 (leucine rich repeat transmembrane neuronal 1 [Source:ZFIN;Acc:ZDB-GENE-050506-80])

HSP 1 Score: 50.8322 bits (120), Expect = 2.999e-6
Identity = 68/298 (22.82%), Postives = 116/298 (38.93%), Query Frame = 2
Query:   32 ITYSMRTMKSFRLIVLGLCVSLI--AGGPC----KTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLK--NSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDS---KLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIK 889
            + + +R      L  LG+ + ++   GG C    +     + C+G  LTD P    S   L L ENN+++LR  N    + L  L +  N ++      FE  + +  LDLS N++ S                        LPN                          P+L +LD+S NR+ SL  DL  F+  + LT ++L  N L ++    F D +    ++  +N++  +  +S         L   +N+L KVN       ++L  +    N  +   N  E   +++ K
Sbjct:   10 LKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIES------------------------LPNG--------------------TFRPLPNLRILDLSYNRLQSLEPDL--FHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEK 261          
BLAST of SMED30007917 vs. Ensembl Zebrafish
Match: lrrtm1 (leucine rich repeat transmembrane neuronal 1 [Source:ZFIN;Acc:ZDB-GENE-050506-80])

HSP 1 Score: 50.8322 bits (120), Expect = 3.306e-6
Identity = 68/298 (22.82%), Postives = 116/298 (38.93%), Query Frame = 2
Query:   32 ITYSMRTMKSFRLIVLGLCVSLI--AGGPC----KTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLK--NSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDS---KLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIK 889
            + + +R      L  LG+ + ++   GG C    +     + C+G  LTD P    S   L L ENN+++LR  N    + L  L +  N ++      FE  + +  LDLS N++ S                        LPN                          P+L +LD+S NR+ SL  DL  F+  + LT ++L  N L ++    F D +    ++  +N++  +  +S         L   +N+L KVN       ++L  +    N  +   N  E   +++ K
Sbjct:   12 LKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIES------------------------LPNG--------------------TFRPLPNLRILDLSYNRLQSLEPDL--FHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEK 263          
BLAST of SMED30007917 vs. Ensembl Zebrafish
Match: lrch4 (leucine-rich repeats and calponin homology (CH) domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-060503-749])

HSP 1 Score: 50.447 bits (119), Expect = 5.402e-6
Identity = 57/198 (28.79%), Postives = 92/198 (46.46%), Query Frame = 2
Query:  185 VTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN-SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSK--LHFGYLDFSNNQL 769
            +T   L +N L ++  + C+ + +L +LS+  N +++ +L+    + L +L+LS NQLSSL  S  Q                 LP +  LI SNN++  L        +H    L  LDVS N + SLPV+L      ++L  NL RNQL+       +       ++ S NRI+ + +  +   H   +   NN L
Sbjct:   54 ITHADLSKNRLCEVPEEVCQ-FVSLETLSLYHNCVRSLTLSLCQLQALTYLNLSRNQLSSLPPSVCQ-----------------LPLLRVLIVSNNKLSALPAS-----IHTLTHLRQLDVSCNELPSLPVELGQLEGLRDL--NLRRNQLT--TLPEELSELPLVRLDVSCNRISHVPVCYRHLRHLQSIILDNNPL 224          
BLAST of SMED30007917 vs. Ensembl Zebrafish
Match: lrch4 (leucine-rich repeats and calponin homology (CH) domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-060503-749])

HSP 1 Score: 50.447 bits (119), Expect = 5.702e-6
Identity = 53/180 (29.44%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  185 VTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN-SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDI 721
            +T   L +N L ++  + C+ + +L +LS+  N +++ +L+    + L +L+LS NQLSSL  S  Q                 LP +  LI SNN++  L        +H    L  LDVS N + SLPV+L      ++L  NL RNQL+       +       ++ S NRI+ + +
Sbjct:   56 ITHADLSKNRLCEVPEEVCQ-FVSLETLSLYHNCVRSLTLSLCQLQALTYLNLSRNQLSSLPPSVCQ-----------------LPLLRVLIVSNNKLSALPAS-----IHTLTHLRQLDVSCNELPSLPVELGQLEGLRDL--NLRRNQLT--TLPEELSELPLVRLDVSCNRISHVPV 208          
BLAST of SMED30007917 vs. Ensembl Zebrafish
Match: lrch4 (leucine-rich repeats and calponin homology (CH) domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-060503-749])

HSP 1 Score: 50.0618 bits (118), Expect = 6.510e-6
Identity = 53/180 (29.44%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  185 VTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN-SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDI 721
            +T   L +N L ++  + C+ + +L +LS+  N +++ +L+    + L +L+LS NQLSSL  S  Q                 LP +  LI SNN++  L        +H    L  LDVS N + SLPV+L      ++L  NL RNQL+       +       ++ S NRI+ + +
Sbjct:   54 ITHADLSKNRLCEVPEEVCQ-FVSLETLSLYHNCVRSLTLSLCQLQALTYLNLSRNQLSSLPPSVCQ-----------------LPLLRVLIVSNNKLSALPAS-----IHTLTHLRQLDVSCNELPSLPVELGQLEGLRDL--NLRRNQLT--TLPEELSELPLVRLDVSCNRISHVPV 206          
BLAST of SMED30007917 vs. Ensembl Xenopus
Match: ENSXETT00000045305.1 (toll-like receptor22 [Source:NCBI gene;Acc:100485706])

HSP 1 Score: 50.8322 bits (120), Expect = 6.250e-6
Identity = 72/300 (24.00%), Postives = 127/300 (42.33%), Query Frame = 2
Query:   74 VLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILD------LHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKH-KAIVVNPQNTMCKYPSKIR 949
            VL L  + +   P  T  ++   +   L     AN S+T +  + + +T L+  N  NW NL  L++R+N L              LD+S   L  L L G+ L+  +      + L++NLP  +        + +++ GNL L          +P L  LD+S N I  L  D   F N  +LT +++S+ ++  ++F                     + + +  H   L   ++QL+    ++     +L  +D   NPL+C C +++ FI+W+    K  V++     C YP   R
Sbjct:  271 VLDLSHNRLHSAPGSTFHHLASIRELSL-----ANNSLTAIPDNFSFITSLQKLNLSNW-NLQDLNLRENYL--------------LDISLGSLLELQLFGNYLNYDSS-----NYLDINLP--INFFEGLLALERIHAGNLALSSIDSRTFSYTPQLRELDISENPIKIL--DPFLFRNVPHLTELHISKTRMESLDF---------------------LILSNLTHLKLLRAVDSQLNSFTSQQGAALPSLRFLDLRNNPLTCIC-DNQWFIDWVHNDTKTQVLHFYEYTCAYPPVAR 519          
BLAST of SMED30007917 vs. Ensembl Xenopus
Match: amigo1 (adhesion molecule with Ig-like domain 1 [Source:NCBI gene;Acc:779983])

HSP 1 Score: 50.0618 bits (118), Expect = 7.803e-6
Identity = 43/153 (28.10%), Postives = 75/153 (49.02%), Query Frame = 2
Query:  518 SPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDID-----SKL-HFGYLDFSNNQLSKVNGEKLDLFVNL--NGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNT-MCKYPSKIR 949
            +P L  LD+S N++NSL  ++ +  +   + + L +NQ+  ++   F D  +   I  S NR+    ++      KL     LD S+N+L  +   +L +      NGI    NPL+C C+    F NW ++  A V++ Q   +C+  S+ R
Sbjct:   88 TPQLRYLDLSCNKLNSLEENVFSALHRLEVLL-LFQNQIERIDRTAFDDITLLQKIYLSHNRVTRFPLELVKDGEKLPELVLLDLSSNRLKNLPVHQLKILPAWLSNGIYLHGNPLTCDCDLYGLFWNWHVRQLASVMDFQEELLCQLYSQPR 239          
BLAST of SMED30007917 vs. Ensembl Mouse
Match: Lrch4 (leucine-rich repeats and calponin homology (CH) domain containing 4 [Source:MGI Symbol;Acc:MGI:1917193])

HSP 1 Score: 50.0618 bits (118), Expect = 7.492e-6
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 2
Query:  185 VTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN-SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDI 721
            +T   L  N   ++    C+   +L  LS+  N LK  +        L +L+LS NQLSSL               ++  L + +     LI SNN++G L       D+    SL  LDVS N + SLPV+L +  + ++L  N+ RNQLS +  +   D  +   ++FS NRI+ I +
Sbjct:   70 ITQADLSRNRFPEVPEAACQ-LVSLEGLSLYHNCLKCLNPALGNLTALTYLNLSRNQLSSLP-------------PYICQLPLRV-----LIISNNKLGALPP-----DISTLGSLRQLDVSSNELQSLPVELCSLRSLRDL--NVRRNQLSTLP-DELGDLPL-VRLDFSCNRISRIPV 221          
BLAST of SMED30007917 vs. Ensembl Mouse
Match: Lrch4 (leucine-rich repeats and calponin homology (CH) domain containing 4 [Source:MGI Symbol;Acc:MGI:1917193])

HSP 1 Score: 49.6766 bits (117), Expect = 8.548e-6
Identity = 58/192 (30.21%), Postives = 88/192 (45.83%), Query Frame = 2
Query:  149 KGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN-SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDI 721
             G  DC       T+  L  N   ++    C+   +L  LS+  N LK  +        L +L+LS NQLSSL               ++  L + +     LI SNN++G L       D+    SL  LDVS N + SLPV+L +  + ++L  N+ RNQLS +  +   D  +   ++FS NRI+ I +
Sbjct:   11 PGTGDC-------TMTDLSRNRFPEVPEAACQ-LVSLEGLSLYHNCLKCLNPALGNLTALTYLNLSRNQLSSLP-------------PYICQLPLRV-----LIISNNKLGALPP-----DISTLGSLRQLDVSSNELQSLPVELCSLRSLRDL--NVRRNQLSTLP-DELGDLPL-VRLDFSCNRISRIPV 167          
BLAST of SMED30007917 vs. TrEMBL
Match: Q32QP6 (Variable lymphocyte receptor A OS=Eptatretus stoutii OX=7765 GN=VLRA PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.046e-7
Identity = 75/281 (26.69%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  104 GGPC---KTTKNIMDCKGKGLTDCPAANKSVT-VLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN--SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMC 928
            GG C     TKN+ DC  KGLT  P+   + T  L LD N L+ L +K   + + L  L++  N+L+   +  F+  K L  L LS+NQL +L L                G+   L N+  L    N++  L  G  + D  K   LT LD+  N++ SLP  +               ++L+ +   Y  +N++       F+++ D+          L+   NQL +V     D  V ++ +   +NP  C C +     NW+ + K  V N +   C
Sbjct:   31 GGVCTCNDQTKNV-DCSSKGLTAIPSNIPTDTDRLELDYNKLSSLPSKAFHHLSKLTYLTLSTNQLQALPAGVFDQLKNLETLWLSQNQLQALPL----------------GVFDQLVNLADLRLYQNQLTSLPEG--VFD--KPTKLTRLDLDYNQLKSLPSGVF--------------DKLTLLEKLYLQNNQLQRLPEGVFDKLTDLKT--------LNLQINQLRRVPEGAFDSLVKISEVQLQENPWDCSCRDILYLSNWIREKKGTVSNIEAAEC 268          
BLAST of SMED30007917 vs. TrEMBL
Match: D2KXI6 (Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri OX=7764 GN=VLRA PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.558e-6
Identity = 80/281 (28.47%), Postives = 119/281 (42.35%), Query Frame = 2
Query:  113 CKTTKNIMDCKGKGLTDCPAANKSVTV-LILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN--SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSK 943
            C   KN +DC  K LT  P+   + T  L LD N L+ L +K  +++T L  LS+  N+L+   +  F+    L  L +++NQL SL                 +G+   L  + +L   NN +  L  G  I D  K  +L  L +  N++ SLP  +  F+    LT + LS NQL  +    F                     D+      LD  NNQL +V     D  +NLN +D S NP  C CN+      W+ + +  V N +   C   +K
Sbjct:   17 CNNNKNSVDCSSKRLTAIPSNIPTDTENLKLDYNKLSSLLSKAFQSFTKLTFLSLNNNQLQTLPASVFDQLVTLEMLRVNDNQLQSLP----------------NGVFDKLTQLQKLWLYNNDLKSLPSG--IFD--KLTNLKELWLRNNKLQSLPNGV--FDKLTQLTKLYLSYNQLQSLPNGVF---------------------DNLAKLTRLDLQNNQLPRVPEGVFDSLLNLNTLDLSINPWDCSCNDILYLSKWIREKQGNVSNIEAAECAVGNK 254          
BLAST of SMED30007917 vs. TrEMBL
Match: F2U349 (Uncharacterized protein OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) OX=946362 GN=PTSG_02730 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.965e-6
Identity = 68/246 (27.64%), Postives = 111/246 (45.12%), Query Frame = 2
Query:  131 IMDCKGKGLTDCPAANK-SVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLK--NSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRI---ADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCF 850
            ++DC+  GL   PA    + T+L L  N +T L  +  +N TNL +L +  N L+  ++  F     L  L + +N LS L               FL+ L   LP +  L   +NR+  ++ G    D+    +L  L++  NRI  L  D M F++     ++LS N LS++    F D      ++ S NRI   A   +D+  +  +LD S N L+++     D    L  +  + N L+ F
Sbjct:   70 VVDCRSHGLAAVPAHIPINTTILSLSNNKITSLPGRAMQNLTNLHTLYLDDNGLETVDAGAFAGLHNLAILSIVDNALSKLP--------------FLAEL---LP-LRTLDLEHNRLTFVDMGQFT-DMF---TLATLNLGHNRITGL--DDMAFDHANLRALDLSHNDLSFIAPLAFSDAPHLSELDLSSNRISVLAPSVLDALHNLTHLDLSANDLTELPPTLFDTQTRLASLRLADNRLASF 291          
BLAST of SMED30007917 vs. TrEMBL
Match: F2U351 (Uncharacterized protein OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) OX=946362 GN=PTSG_11912 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.092e-6
Identity = 68/246 (27.64%), Postives = 112/246 (45.53%), Query Frame = 2
Query:  131 IMDCKGKGLTDCPAANK-SVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLK--NSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRI---ADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCF 850
            ++DC+  GL   PA    + T+L L  N +T L  +  +N TNL +L +  N L+  ++  F     L  L + +N LS L               FL+ L   LP +  L   +NR+  ++ G    D+    +L  L++  NRI  L  D M F++     ++LS N LS++    F D      ++ S NRI   A   +D+  +  +LD S+N L+++     D    L  +  + N L+ F
Sbjct:   71 VVDCRSHGLAAVPAHIPINTTILSLSNNKITSLPGRAMQNLTNLHTLYLDDNGLETVDAGAFAGLHNLAILSIVDNALSKLP--------------FLAEL---LP-LRTLDLEHNRLTFVDMGQFT-DMF---TLATLNLGHNRITGL--DDMAFDHANLRALDLSHNDLSFIAPLAFSDAPHLSELDLSSNRISVLAPSVLDALHNLTHLDLSDNDLTELPPTLFDTQTRLASLRLADNRLASF 292          
BLAST of SMED30007917 vs. TrEMBL
Match: W5NNH1 (LRRCT domain-containing protein OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.124e-6
Identity = 81/329 (24.62%), Postives = 133/329 (40.43%), Query Frame = 2
Query:  113 CKTTKNIM--DCKGKGLTDCPA-ANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN--SLTFETFKVLGFLDLSENQLSSLA--------------LSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSL----------------------PVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSF-NRIADID---IDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEV 961
            C T+  I+  DC G+ L   P      V VLIL  N+L  L      N+T L +L ++ N+L++     F     L  L L  NQL+ L               L+G+ L      S F   L  +LP +  L+ + NR+  L+ G+         SLTVL +S N + SL                       V    F   ++L+ ++L+RN +  +  + F   + G    +++ N++  I+   ++  +H   LD   N L ++     D   NL  +    NP  C C +      W+I ++ +   P   +C  P  +R   V
Sbjct:   26 CHTSDGILTVDCAGRALHGLPQDIPGDVGVLILKNNSLDRLPASAFHNFTQLQALHLQSNRLESLPEDLFLPLPQLTHLYLYGNQLTRLPDRIFAPLQNLERLHLNGNHL------SRFSDALFSSLPRLKTLVLARNRLESLSPGS----FRNLQSLTVLSLSSNGLASLHPGLFSGLQALRVCALYDNKLSAVPAAVFRGLRSLSWLSLARNAVRQLPASLF--QQTGLQHLYAYDNQLQTIEAKMLEPLVHLKTLDLRQNSLEQLPEGLFDNASNLTTVRLQGNPWQCDC-KVRYLRQWLISNRQLADQP---LCMSPPAVRNLPV 338          
BLAST of SMED30007917 vs. Ensembl Cavefish
Match: tpbga (trophoblast glycoprotein-like [Source:NCBI gene;Acc:103044163])

HSP 1 Score: 52.373 bits (124), Expect = 7.774e-7
Identity = 80/306 (26.14%), Postives = 125/306 (40.85%), Query Frame = 2
Query:   65 RLIVLGL-CV------SLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTV-LILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKN--SLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNG--IDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKI 946
            R++VL L CV      S   G  C      + C  K L   PA   + T  L +  N ++ +  ++ +   N+ +LS+  N++    S TF + + L  LDLS NQL+ +      +    +    LS    N   V  L A++ R   L        LH       LD+S N +  LP  +  F+       NL R QL+        +N I    N +F+ +  ++         LD S N L     E L    +L G  +   QNP +C C   E F  W+   +  VV+ +  +C YP ++
Sbjct:    7 RVLVLALLCVQPARSSSCPPGCECSEAAQTVKCVSKELRSVPAGIPAYTRNLFITGNRISRIGPESFRGLDNVTTLSLSNNRISEVESHTFSSLRSLRSLDLSSNQLALIHPEAFTVQSRMLKELNLSRALYNHSAVTDL-ATSFRWSGLE------GLHG------LDLSSNGLVYLPPQIF-FHLG-----NLRRLQLA--------NNSIVSIYNETFSGLGQLE--------ELDLSLNALKTFREEGLMELEHLPGAKLHLRQNPYTCTCG-IEPFAIWLNASRERVVDAERLVCVYPVEL 276          
BLAST of SMED30007917 vs. Ensembl Cavefish
Match: lrrtm1 (leucine rich repeat transmembrane neuronal 1 [Source:NCBI gene;Acc:103046915])

HSP 1 Score: 51.6026 bits (122), Expect = 1.680e-6
Identity = 64/262 (24.43%), Postives = 107/262 (40.84%), Query Frame = 2
Query:   32 ITYSMRTMKSFRLIVLGLCVSLI----AGGP--CKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLK--NSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLT-INLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDS---KLHFGYLDFSNNQLSKVN 781
            + + +R      L  LG+ + ++    A  P  C+    ++ C+G  LTD P    S T L L ENN+++LR  +    + L  L +  N ++      FE  + +  LDLS N++ +L                                SN     L            P+L +LD+S NR+ SL  DL  F+  + LT ++L  N L +V    F D +    ++  +N++  +  +S         L   +N+L KVN
Sbjct:   12 LKWPLRKPPGLILCSLGIFLKMVPLVGASCPRLCRCDSKLLYCEGLNLTDIPRNLSSATGLSLRENNISELREGHFVGLSQLTWLYLDHNNIEFVEESAFERLRRVKELDLSTNRIETL--------------------------------SNGTFRPL------------PNLRILDLSYNRLQSLEPDL--FHGLRKLTNLHLRYNALKFVPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVN 227          
BLAST of SMED30007917 vs. Ensembl Cavefish
Match: lrtm1 (leucine rich repeats and transmembrane domains 1 [Source:NCBI gene;Acc:103038094])

HSP 1 Score: 50.447 bits (119), Expect = 3.093e-6
Identity = 39/144 (27.08%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  437 PNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSL-PVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADID---IDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCN 856
            P+  +L   +NR+  L      +   + P L VLD++ N I  L P  L+   + K   +NL+ N +  V+  +    +    ++FS+N IA +     DS  H  +L   NN+L+K++   L+   N+  +    NP  C C 
Sbjct:   50 PDTQELYLQDNRIRGLGS----MAFREVPQLRVLDLANNTITMLSPSALLGLRSLK--ILNLANNSIREVDRRFLGSIRNLTQLDFSYNSIAGLPGALADSFHHLTHLSLHNNRLTKLDRSHLEALGNMEVLHLRGNPWKCDCQ 187          
BLAST of SMED30007917 vs. Ensembl Medaka
Match: ENSORLT00000036623.1 (carboxypeptidase N subunit 2-like [Source:NCBI gene;Acc:105353900])

HSP 1 Score: 52.7582 bits (125), Expect = 9.270e-7
Identity = 66/275 (24.00%), Postives = 123/275 (44.73%), Query Frame = 2
Query:  158 TDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLN---FGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADID---IDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVK 964
            TD  +  K + VL + +N LT +     KN+ NL  + ++ N++  SL    F         +N+L+ L L  + L+ +        G  V  P +  L  + N++  L    FG +       P LT L +  N +++LP  + +    K   ++LS+N    ++ +YF+  +   ++N   N+I  +D    ++      L  SNN L  + G   +  V L+ +D S NP  C CN  +    W+  +   +  P   +C++P  ++  E++
Sbjct:  106 TDWFSDLKKLKVLRIYDNQLTTIPEDLLKNFPNLEEVGLQGNQI-TSLPPNLFP-------HKNKLTKLYLDNNLLTGLP------EGYFVGFPKLKVLTLNKNKLNSLPSVLFGEM-------PKLTELSLQLNNLSTLPTGIFS-PLKKVKKLDLSKNHFVTLSADYFLGPEKLTDLNLQHNQIKTLDANLFENLQSLTSLKLSNNNLHALPGNIFEPLVKLSKLDLSNNPWHCDCNLKD-LHGWIRDNSEKLKPP--VVCEHPELLKGQEIR 355          
BLAST of SMED30007917 vs. Planmine SMEST
Match: SMESG000070256.1 (SMESG000070256.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 428/432 (99.07%), Postives = 429/432 (99.31%), Query Frame = 2
Query:   44 MRTMKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQXXXXXXXXXXXXXXXXXNGKSSTSPVXXXXXXXXXXXXXXXXXXXXXXHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKXXXXXXXXXXXXXXXFVCYWTFCRRSNNYRRLYEQNHS 1339
            MRTMKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNL+SLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLSVVNVSSNFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLD FVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQSSTTTGKSSTSTV TSTNGKSSTSPVSTSTNGKSSTSQSSASTKFTTTHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKIALGVILPIIGLIIIFVCYWTFCRRSNNYRRL EQNHS
Sbjct:    1 MRTMKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLISLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLSVVNVSSNFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDRFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQSSTTTGKSSTSTVSTSTNGKSSTSPVSTSTNGKSSTSQSSASTKFTTTHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKIALGVILPIIGLIIIFVCYWTFCRRSNNYRRLDEQNHS 432          
BLAST of SMED30007917 vs. Planmine SMEST
Match: SMESG000070256.1 (SMESG000070256.1)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 425/429 (99.07%), Postives = 426/429 (99.30%), Query Frame = 2
Query:   53 MKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQXXXXXXXXXXXXXXXXXNGKSSTSPVXXXXXXXXXXXXXXXXXXXXXXHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKXXXXXXXXXXXXXXXFVCYWTFCRRSNNYRRLYEQNHS 1339
            MKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNL+SLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLSVVNVSSNFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLD FVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQSSTTTGKSSTSTV TSTNGKSSTSPVSTSTNGKSSTSQSSASTKFTTTHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKIALGVILPIIGLIIIFVCYWTFCRRSNNYRRL EQNHS
Sbjct:    1 MKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLISLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLSVVNVSSNFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDRFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKCQSSTTTGKSSTSTVSTSTNGKSSTSPVSTSTNGKSSTSQSSASTKFTTTHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKIALGVILPIIGLIIIFVCYWTFCRRSNNYRRLDEQNHS 429          
BLAST of SMED30007917 vs. Planmine SMEST
Match: SMESG000015083.1 (SMESG000015083.1)

HSP 1 Score: 236.884 bits (603), Expect = 2.747e-73
Identity = 138/192 (71.88%), Postives = 154/192 (80.21%), Query Frame = 2
Query:   47 RTMKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLS 622
            RTMKSF LIV+G  VSLIAGGPCKTT NIMDCKGKGLTDCPAANKSVTVLILDENNL DLRTK+CKNWTNL+SLSVRKNKLKNSLTFETFKVL FLDLSENQLSSLALSG QLSVVNVS NFLSGL+VNLPN+ +L   NN+    N+  L    H      + + S++ ++S P  L+T   NK LTIN+S
Sbjct:    7 RTMKSFLLIVVGFFVSLIAGGPCKTTNNIMDCKGKGLTDCPAANKSVTVLILDENNLRDLRTKSCKNWTNLISLSVRKNKLKNSLTFETFKVLRFLDLSENQLSSLALSGGQLSVVNVSRNFLSGLDVNLPNLRKLFVDNNK----NY-ELFSSQHDYLLNELQNESKDWVDSAPTALVTVTRNKPLTINIS 193          

HSP 2 Score: 56.225 bits (134), Expect = 2.573e-8
Identity = 37/66 (56.06%), Postives = 46/66 (69.70%), Query Frame = 2
Query: 1145 NHSSTRIVTRSTKNH-TKSPKTQTKSWKXXXXXXXXXXXXXXXFVCYWTFCRRSNNYRRLYEQNHS 1339
            N+S+T   + STKNH TK P    + WKI + ++LP  GL IIFVCYWTFCR+ NNYR L E+N S
Sbjct:  256 NYSNTTKTSNSTKNHSTKPPNHNGEVWKIVVAILLPFFGLAIIFVCYWTFCRQKNNYRILNERNPS 321          
BLAST of SMED30007917 vs. Planmine SMEST
Match: SMESG000015083.1 (SMESG000015083.1)

HSP 1 Score: 232.646 bits (592), Expect = 1.065e-71
Identity = 136/190 (71.58%), Postives = 152/190 (80.00%), Query Frame = 2
Query:   53 MKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQLIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLS 622
            MKSF LIV+G  VSLIAGGPCKTT NIMDCKGKGLTDCPAANKSVTVLILDENNL DLRTK+CKNWTNL+SLSVRKNKLKNSLTFETFKVL FLDLSENQLSSLALSG QLSVVNVS NFLSGL+VNLPN+ +L   NN+    N+  L    H      + + S++ ++S P  L+T   NK LTIN+S
Sbjct:    1 MKSFLLIVVGFFVSLIAGGPCKTTNNIMDCKGKGLTDCPAANKSVTVLILDENNLRDLRTKSCKNWTNLISLSVRKNKLKNSLTFETFKVLRFLDLSENQLSSLALSGGQLSVVNVSRNFLSGLDVNLPNLRKLFVDNNK----NY-ELFSSQHDYLLNELQNESKDWVDSAPTALVTVTRNKPLTINIS 185          

HSP 2 Score: 55.8398 bits (133), Expect = 2.788e-8
Identity = 37/66 (56.06%), Postives = 46/66 (69.70%), Query Frame = 2
Query: 1145 NHSSTRIVTRSTKNH-TKSPKTQTKSWKXXXXXXXXXXXXXXXFVCYWTFCRRSNNYRRLYEQNHS 1339
            N+S+T   + STKNH TK P    + WKI + ++LP  GL IIFVCYWTFCR+ NNYR L E+N S
Sbjct:  248 NYSNTTKTSNSTKNHSTKPPNHNGEVWKIVVAILLPFFGLAIIFVCYWTFCRQKNNYRILNERNPS 313          
BLAST of SMED30007917 vs. Planmine SMEST
Match: SMESG000070311.1 (SMESG000070311.1)

HSP 1 Score: 171.4 bits (433), Expect = 2.319e-46
Identity = 120/305 (39.34%), Postives = 177/305 (58.03%), Query Frame = 2
Query:   68 LIVLGLCVSLI---AGGPCKTTKNIMDCKGKGLTDCPAANKSVTVLILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLSENQLSSLALSGDQLXXXXXXXXFLSGLEVNLPNVLQ-LIASNNRMGKLNFGNLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYVNFNYFVDNKIG-FNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKLDLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSKIRIFEVKC 967
            LI+ G+ + LI       C      M+C     TDCP  N+++  LILD+N L    + NCK W+NL  +SV+KNKLKN ++   +K+L  LDLS N +   +++  QL  +++S N +S ++    N L     +NN +   +  N+I  L + PSL VLD S N+ +SLP  LM+ N+N+ L+IN S NQLS ++FN F   KI  FN++ S N+I ++ I   +    L+FSNNQL+ ++ E L+   NL  ID S NPL+C C+ES SF+ WM  +   +VN   T CK P   R+ +V C
Sbjct:    3 LILFGILICLINFYELKDCSINGTTMNCARLNFTDCPTVNENILELILDDNLLETFSSVNCKTWSNLQRISVKKNKLKNFVSANVYKLLENLDLSYNNIKEFSVNEKQLLNIDISHNQISVVKYIEGNQLNYFYVNNNNIDNASLDNIIRILVRIPSLKVLDFSYNKFSSLPSSLMSLNSNQFLSINFSGNQLSKISFNIFSSFKINPFNLDISSNKITEVKIPEIIEIRNLNFSNNQLTTIDPEYLNNLENLINIDISHNPLNCLCSESMSFMEWMHNNSHKLVNKNETNCKTPPNTRVIDVDC 307          
The following BLAST results are available for this feature:
BLAST of SMED30007917 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AP006333.18.776e-625.30fibronectin leucine rich transmembrane protein 1 [... [more]
back to top
BLAST of SMED30007917 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007917 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Toll-62.732e-624.46gene:FBgn0036494 transcript:FBtr0075614[more]
Toll-62.732e-624.46gene:FBgn0036494 transcript:FBtr0306307[more]
Toll-62.732e-624.46gene:FBgn0036494 transcript:FBtr0306308[more]
back to top
BLAST of SMED30007917 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrtm12.999e-622.82leucine rich repeat transmembrane neuronal 1 [Sour... [more]
lrrtm13.306e-622.82leucine rich repeat transmembrane neuronal 1 [Sour... [more]
lrch45.402e-628.79leucine-rich repeats and calponin homology (CH) do... [more]
lrch45.702e-629.44leucine-rich repeats and calponin homology (CH) do... [more]
lrch46.510e-629.44leucine-rich repeats and calponin homology (CH) do... [more]
back to top
BLAST of SMED30007917 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000045305.16.250e-624.00toll-like receptor22 [Source:NCBI gene;Acc:1004857... [more]
amigo17.803e-628.10adhesion molecule with Ig-like domain 1 [Source:NC... [more]
back to top
BLAST of SMED30007917 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lrch47.492e-630.56leucine-rich repeats and calponin homology (CH) do... [more]
Lrch48.548e-630.21leucine-rich repeats and calponin homology (CH) do... [more]
back to top
BLAST of SMED30007917 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007917 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q32QP63.046e-726.69Variable lymphocyte receptor A OS=Eptatretus stout... [more]
D2KXI62.558e-628.47Variable lymphocyte receptor A (Fragment) OS=Eptat... [more]
F2U3492.965e-627.64Uncharacterized protein OS=Salpingoeca rosetta (st... [more]
F2U3513.092e-627.64Uncharacterized protein OS=Salpingoeca rosetta (st... [more]
W5NNH14.124e-624.62LRRCT domain-containing protein OS=Lepisosteus ocu... [more]
back to top
BLAST of SMED30007917 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpbga7.774e-726.14trophoblast glycoprotein-like [Source:NCBI gene;Ac... [more]
lrrtm11.680e-624.43leucine rich repeat transmembrane neuronal 1 [Sour... [more]
lrtm13.093e-627.08leucine rich repeats and transmembrane domains 1 [... [more]
back to top
BLAST of SMED30007917 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007917 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007917 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007917 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000036623.19.270e-724.00carboxypeptidase N subunit 2-like [Source:NCBI gen... [more]
back to top
BLAST of SMED30007917 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070256.10.000e+099.07SMESG000070256.1[more]
SMESG000070256.10.000e+099.07SMESG000070256.1[more]
SMESG000015083.12.747e-7371.88SMESG000015083.1[more]
SMESG000015083.11.065e-7171.58SMESG000015083.1[more]
SMESG000070311.12.319e-4639.34SMESG000070311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007917 ID=SMED30007917|Name=SMED30007917|organism=Schmidtea mediterranea sexual|type=transcript|length=1679bp
ATTAAGGTCATCATTAAATTCAATTCATTAAATAACTTATTCAATGAGAA
CAATGAAATCGTTTCGCCTTATTGTTTTGGGCTTGTGTGTGAGCTTGATA
GCCGGGGGCCCCTGCAAAACAACCAAAAACATCATGGATTGCAAAGGGAA
AGGTCTCACCGACTGTCCAGCAGCAAACAAATCAGTAACAGTTCTCATTC
TAGATGAGAATAATTTGACGGACTTGCGAACGAAAAACTGCAAAAATTGG
ACAAATTTGATGTCATTAAGCGTTCGAAAGAATAAGCTGAAAAACTCTTT
GACATTTGAAACGTTCAAAGTTTTAGGATTTTTGGATCTTAGTGAGAATC
AGTTGAGCAGTCTAGCATTATCTGGCGATCAACTGTCGGTTGTTAACGTT
TCCAGCAACTTTCTCTCGGGATTGGAAGTGAATTTACCGAATGTTTTGCA
GCTAATCGCAAGCAATAACCGAATGGGTAAATTGAATTTCGGTAATTTAA
TATTGGACCTCCATAAATCTCCTTCACTGACAGTTCTGGATGTCAGCAGA
AACCGGATCAATTCTCTGCCAGTTGACTTAATGACATTTAATAACAACAA
AAATCTAACAATAAACCTCTCCAGGAATCAGCTGAGTTATGTCAATTTCA
ACTACTTCGTTGACAACAAAATCGGCTTCAATATCAACTTTTCTTTCAAT
CGGATTGCTGACATTGATATCGATAGCAAACTCCATTTCGGATATTTGGA
TTTCTCTAATAATCAATTATCGAAAGTCAATGGGGAAAAATTGGATCTGT
TTGTCAATCTGAATGGAATTGATTTTTCTCAAAATCCTCTCAGTTGTTTT
TGCAATGAATCGGAATCGTTTATCAATTGGATGATCAAGCACAAAGCTAT
CGTTGTTAATCCCCAGAACACAATGTGCAAATATCCATCGAAGATCAGGA
TATTTGAAGTCAAATGTCAGTCATCAACAACGACTGGGAAATCATCAACT
TCGACAGTTTTAACTTCAACCAATGGGAAATCATCAACTTCGCCAGTTTC
AACTTCAACCAATGGGAAATCGTCAACTTCGCAATCATCAGCATCTACAA
AATTCACAACGACGCATTATTCAACTAAGAAAGCTAAAACAACAAACCAC
TCTTCAACGAGAATCGTTACCAGGTCAACAAAAAATCACACGAAATCACC
CAAAACTCAAACAAAATCATGGAAAATTGCATTGGGAGTAATTTTACCAA
TAATAGGATTAATAATCATTTTCGTGTGCTACTGGACTTTCTGTCGACGC
AGCAACAACTATCGAAGACTTTATGAACAAAACCATTCGTAAAAAGATAC
GATTTATTATTTTTTATATACAACTATTTGTATGATTTTCCATATTGATT
GATTCTCATAAATATTGATTTTGAATATCGATTGAATTTTTGAATTCAAA
TATATTATTGATTATTTTATTGTAATAAATGATATGAATGGCGATATATG
TGAGGATACTGGACTTACGTCTTTAATTCTCGTTTTGGGGGGGGCTTTTG
GGTGTTTTTTTAATTATATCAAAAAGTATTTTCCTTGAAAATGTTTTTTG
TGACTGGAGCCAGATCATTTTATTTCACGGGATGTTTTGTGACTAAAAAT
GATGCTATTGATTTTAGAGTGCAAAAGAG
back to top

protein sequence of SMED30007917-orf-1

>SMED30007917-orf-1 ID=SMED30007917-orf-1|Name=SMED30007917-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MRTMKSFRLIVLGLCVSLIAGGPCKTTKNIMDCKGKGLTDCPAANKSVTV
LILDENNLTDLRTKNCKNWTNLMSLSVRKNKLKNSLTFETFKVLGFLDLS
ENQLSSLALSGDQLSVVNVSSNFLSGLEVNLPNVLQLIASNNRMGKLNFG
NLILDLHKSPSLTVLDVSRNRINSLPVDLMTFNNNKNLTINLSRNQLSYV
NFNYFVDNKIGFNINFSFNRIADIDIDSKLHFGYLDFSNNQLSKVNGEKL
DLFVNLNGIDFSQNPLSCFCNESESFINWMIKHKAIVVNPQNTMCKYPSK
IRIFEVKCQSSTTTGKSSTSTVLTSTNGKSSTSPVSTSTNGKSSTSQSSA
STKFTTTHYSTKKAKTTNHSSTRIVTRSTKNHTKSPKTQTKSWKIALGVI
LPIIGLIIIFVCYWTFCRRSNNYRRLYEQNHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
Vocabulary: biological process
TermDefinition
GO:0002224toll-like receptor signaling pathway
GO:0002376immune system process
GO:0002755MyD88-dependent toll-like receptor signaling pathway
GO:0006954inflammatory response
GO:0006955immune response
GO:0007165signal transduction
GO:0034130toll-like receptor 1 signaling pathway
GO:0042116macrophage activation
GO:0042495detection of triacyl bacterial lipopeptide
GO:0045087innate immune response
GO:0050707regulation of cytokine secretion
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 20..193
e-value: 3.8E-20
score: 73.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 194..326
e-value: 1.1E-12
score: 49.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..387
NoneNo IPR availablePANTHERPTHR46473:SF6LEUCINE-RICH REPEAT-CONTAINING PROTEIN 52coord: 23..108
NoneNo IPR availablePANTHERPTHR46473:SF6LEUCINE-RICH REPEAT-CONTAINING PROTEIN 52coord: 120..306
NoneNo IPR availablePANTHERPTHR46473FAMILY NOT NAMEDcoord: 23..108
coord: 120..306
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.801
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 28..268
NoneNo IPR availableTMHMMTMhelixcoord: 395..417