slc6a-2

Overview
Nameslc6a-2 (AKN21422.1)
Smed IDSMED30007903
Length (bp)1891
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-2 (SMED30007903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-2 (SMED30007903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007903SMESG000009904.1 Contig6494newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007903SMESG000009904.1 Contig6494uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007903SMESG000062685.1 Contig6494newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007903SMESG000062685.1 Contig6494uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30007903SMESG000009904.1 SmedASXL_014082SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30007903SMESG000009904.1 SmedASXL_014082SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30007903SMESG000009904.1 dd_Smed_v4_21305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007903SMESG000009904.1 dd_Smed_v4_21305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007903SMESG000009904.1 dd_Smed_v6_21305_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30007903SMESG000009904.1 Contig47208newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007903SMESG000009904.1 Contig47208uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-2 vs. Ensembl Human
Match: SLC6A6 (solute carrier family 6 member 6 [Source:HGNC Symbol;Acc:HGNC:11052])

HSP 1 Score: 516.924 bits (1330), Expect = 8.713e-177
Identity = 272/561 (48.48%), Postives = 380/561 (67.74%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNS-----TNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  D+       R+KW +K+DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +   G+P+F LE+ +GQ+ + GGI  W  I PL  GIGYASVV++ +LN YY VILAWA YYL  SF   + W+HCN++WNT  C  D  + +     T SS     P IE+WE  VL L+ GI++ G++K DL  CLL  W+V +FCIWKG++++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC  I + YG       + +M G+  G      W  +TP+  +  FI S + Y  L Y     N  Y +P+W++ +GW++A S ++ VP++  I + +  GP + R+K LL P+
Sbjct:   28 TRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTY-----NKTYVYPNWAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPR 583          
BLAST of slc6a-2 vs. Ensembl Human
Match: SLC6A6 (solute carrier family 6 member 6 [Source:HGNC Symbol;Acc:HGNC:11052])

HSP 1 Score: 518.464 bits (1334), Expect = 7.220e-176
Identity = 272/561 (48.48%), Postives = 380/561 (67.74%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNS-----TNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  D+       R+KW +K+DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +   G+P+F LE+ +GQ+ + GGI  W  I PL  GIGYASVV++ +LN YY VILAWA YYL  SF   + W+HCN++WNT  C  D  + +     T SS     P IE+WE  VL L+ GI++ G++K DL  CLL  W+V +FCIWKG++++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC  I + YG       + +M G+  G      W  +TP+  +  FI S + Y  L Y     N  Y +P+W++ +GW++A S ++ VP++  I + +  GP + R+K LL P+
Sbjct:  129 TRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTY-----NKTYVYPNWAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPR 684          
BLAST of slc6a-2 vs. Ensembl Human
Match: SLC6A13 (solute carrier family 6 member 13 [Source:HGNC Symbol;Acc:HGNC:11046])

HSP 1 Score: 510.375 bits (1313), Expect = 1.767e-174
Identity = 252/546 (46.15%), Postives = 360/546 (65.93%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC----STDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGS-RXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            R  W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPY + +   GIP+F LE  +GQ+ ++GG+  W  I P+ +GIGYAS +++ +LN YY ++LAWA++YL +SF   + W  C + WNT  C     T+   N T+ +A    P IE+WE RVL ++ GI+++G ++ +L  CLL AW++ YFCIWKG+K++G+V+YFTAT PY++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFS++I +G L ALGSYN +H+N  RDC+    +NSGTSF+AGF IF  LGFMS+  G+PI  V  SGPGLAF+ YP+A+  +P + LW+  FF M++LLG+DSQFV VE  +T+  D++P    K   +++ I  V +++F +GL M+T GGMYVFQLFDYY  S   ++ +A+ E L + + YG KRF  N+ +M G+    +    W  LTP      F+ S I Y+ L Y     N  Y +P W   +GW +A S +V +P  +   +    GP  ERI++L+ P
Sbjct:   32 RGHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQMIVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENA--TSPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLILGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNIEDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTY-----NKKYTYPWWGDALGWLLALSSMVCIPAWSLYRLGTLKGPFRERIRQLMCP 570          
BLAST of slc6a-2 vs. Ensembl Human
Match: SLC6A12 (solute carrier family 6 member 12 [Source:HGNC Symbol;Acc:HGNC:11045])

HSP 1 Score: 507.294 bits (1305), Expect = 4.338e-173
Identity = 262/547 (47.90%), Postives = 366/547 (66.91%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKID----PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            R +W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPYFI   + GIP+F LEV +GQ+ ++G +  W  I PL +GIG ASVV+   LN YY +ILAWA++YL +SF   + W+ CNN WNT  C TD   +S   +    +    P +E+WE RVLG+  GI ++G+++ +L  CLL AW++ YFCIWKG+K++G+V+YFTAT PY++++ LLIR  TLPGA  G+ YYL P   RL   +VW+D+GTQIFFS++I  G L ALGSYN +H+N  +DC+    +NS TSF+AGFV+F  LGFMS+  G+PI  V  SGPGLAF+ +PKA+  MP++ LWS LFF M+I LG+DSQFV VE  +T+  D+FP  + K   +++ I  + +M + IGL +VT GGMY+FQLFDYY  S I ++ +++ E + I + YG  RF  N+ +M G+    +  I W  LTP   L  F+ S   Y+ L+Y     N VY +P W   +GW +A S +V VP+   I +L+  GP  +R+++L+ P 
Sbjct:   36 RGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHC-TDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKY-----NNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPD 576          
BLAST of slc6a-2 vs. Ensembl Human
Match: SLC6A12 (solute carrier family 6 member 12 [Source:HGNC Symbol;Acc:HGNC:11045])

HSP 1 Score: 507.294 bits (1305), Expect = 4.338e-173
Identity = 262/547 (47.90%), Postives = 366/547 (66.91%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKID----PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            R +W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPYFI   + GIP+F LEV +GQ+ ++G +  W  I PL +GIG ASVV+   LN YY +ILAWA++YL +SF   + W+ CNN WNT  C TD   +S   +    +    P +E+WE RVLG+  GI ++G+++ +L  CLL AW++ YFCIWKG+K++G+V+YFTAT PY++++ LLIR  TLPGA  G+ YYL P   RL   +VW+D+GTQIFFS++I  G L ALGSYN +H+N  +DC+    +NS TSF+AGFV+F  LGFMS+  G+PI  V  SGPGLAF+ +PKA+  MP++ LWS LFF M+I LG+DSQFV VE  +T+  D+FP  + K   +++ I  + +M + IGL +VT GGMY+FQLFDYY  S I ++ +++ E + I + YG  RF  N+ +M G+    +  I W  LTP   L  F+ S   Y+ L+Y     N VY +P W   +GW +A S +V VP+   I +L+  GP  +R+++L+ P 
Sbjct:   36 RGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHC-TDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKY-----NNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPD 576          
BLAST of slc6a-2 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 442.965 bits (1138), Expect = 2.237e-148
Identity = 242/588 (41.16%), Postives = 346/588 (58.84%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNY-PVSWSHCNNAWNTLQCSTDAFK------------------------------------NSTNSSALK---IDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGAL----TPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLK 1721
            R++W +  DF+++CIG+++GLGNVWRFPYLCY+NGGGAFLIPY IS+V  G P+F LE   GQ M+ GG+ ++ I P+ KG+G A+ V+ F LN YY V+L+WA  YL  SF    V W +C++AWNT  C ++  K                                    N T  SA     + P  E+W HRVLG++ G+EN G I+ DL   LL  WI+ Y CI+KG+K +G+V+Y TA+ PY+++  LLIR  TL GA +GLE+YL P + +LL  +VWVD+ TQ+FFSY + +G LVALGSYN F++N  +  +    VNSGTS  AGFVIF  +GFM+ +    +  V  +GPGL F+ YP  + ++P T  WS LFF M++ LG+DSQF  +EGF T+  D FP    K   ++IF+ V+C++++ IGLT VT GG YVFQLFD+Y  S   ++  +  EC++I +  GI R+  ++  M    +GY P  +W       TP     + +   I Y  L      D   Y +P W    GW ++ S ++ +P  A     +  G + E+IK L +P ++
Sbjct:   10 REQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSM----IGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRI----DAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIWIWFKTPGTVQEKIKLLCRPDIE 589          
BLAST of slc6a-2 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 424.861 bits (1091), Expect = 1.620e-140
Identity = 225/563 (39.96%), Postives = 343/563 (60.92%), Query Frame = 3
Query:   57 RIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASF----NYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNK--GIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVAS-GPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLK 1721
            R+      + +VRDKW  K++FLLA +G++V LGN+WRFP +CYK+GGGAFLIPYFI +++GG+PMF +E+ +GQF   G + +W  + PL +GIGY    +   +  +YN I+A A+Y+ + S     +  V W+ C N WNT +CS D     + +      P+ EY+ ++VL + K  G +++G +K  +  CLLA +I+VYF +WKG ++SG++++ TAT+PY+++  LLIR   LPGA+ GL YY+ P +E+L    VW  + TQIFFS     G L+AL SYNDF++N  RD V  S++N  TSF +G V+F TLG+MS  T  PI  VV      L F+VYP+ALA M  +  WS +FF M+I LGIDS F G+E FIT F D         KN++ F+ V+C++ + +    +++GG +V    D Y  S  ++ I   E +++C+FYG+ +FS+++  M GF  G    + W   +P+F+ +IFIM+    S    +  S    Y FP WSV +GW +    ++ +P+ A I +L   G + ER +  + P+ +
Sbjct:   88 RVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNVTISRNGTPLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRF---LSKNRKWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCW-TCSPVFISVIFIMTVYNSSFKPIQMAS----YTFPWWSVILGWFLRLLSVLAIPVFAIIYLLSGTGTLYERFRWAITPQQR 642          
BLAST of slc6a-2 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 414.461 bits (1064), Expect = 3.200e-137
Identity = 230/565 (40.71%), Postives = 331/565 (58.58%), Query Frame = 3
Query:   90 VRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC-----STD--AFKNSTNSS--ALKIDPAIEYWEHRVLGLN----------KGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILR-EGGPIIERIKKLLQPKLK 1721
             R++W  KLDFLL+ +GF+V LGN+WRFPYLC+KNGGG FLIPY I V+L G+P+F +E+ +GQ+  +G I  W  I PL KGIGY  ++  F ++ +YNVILAW ++YL  SF++ + W+ CNN++N+  C     S D  A   S N S  A KI  A EY+    LGL+          + + ++G ++ D+   L   +++ YF +WKGI TSG+V++FTA  PYV++  L IR  TLPG + G+EYYL P +E L    VW D+ TQ+FFS     G L+A  SYNDFH+N   D +  S +N  TSFL+GFVIF  LG+MS ++G PI+ V   GPGL FVVYP+AL+ MP    WSVLFF M++ LG+DS F G E  IT  +D FP+     KN+++F+  +      IG+ M T GG+ + +    Y  +  ++I    E + I Y YG+++F  ++ EM GF  G      W    P  LL +   + I Y  L Y+       Y +P+ +  +G   A S   F+P++     +   G  I E+ +++  P  K
Sbjct:   39 AREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILK---KNREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQD------YTYPTAANVIGIIFALSGASFIPLVGIYKFVNARGNTISEKWQRVTMPYRK 594          
BLAST of slc6a-2 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 399.438 bits (1025), Expect = 1.287e-131
Identity = 213/547 (38.94%), Postives = 312/547 (57.04%), Query Frame = 3
Query:   33 EIHIVSISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALK---------IDPAIE-YWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVP 1640
            E+     S  PD        R +W  K DFL++ + ++VGLGNVWRFPYLCYKNGGG+FL+ Y I   L  +P+F +EV VGQ++ +G +E+W + PL +G+G  +VV+ FM   Y+ VI+AWA++Y+++S  +   W  CNN WN   C T   +N T  + +K            ++E +WE RVL     I   G I+ +L F + AAW++VYF +WKGI  + + +YF A  PYVL+  LLIR  TL GA  G+ +YL P   RLL   VW D+GTQ+F+SY +  G L+ALGS+N F+HN  +D +    +N  TS  AGF +F  LG+MS      I  +V  G GLAF+ YP+  + +P+  +++VLFF MI +LG+DSQ   +EG  T+  D FP+     K K+  + + CL  F IG+ MVTH G +   LFD Y  S   ++  V  E + + Y +G     + L+EM G +L       W    P   L++F+   + Y  ++Y  G D     FP W+   GW +++  +V +P
Sbjct:   18 ELEQSQHSEEPD--------RGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGK-ENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILR---KYKKQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALHEMIGVTLPKGIEYVWKFCAPATSLVLFVFCVVYYHPVKYPDGKD-----FPFWANAFGWFLSSCSMVVIP 547          
BLAST of slc6a-2 vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 297.745 bits (761), Expect = 2.725e-91
Identity = 179/574 (31.18%), Postives = 309/574 (53.83%), Query Frame = 3
Query:   90 VRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCS----------------------TDAFKNSTNS---SALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNV-VASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIP--HIFWGAL----TPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  W NK D+LLA IGF+ G+G+ W+FP+L +++GG AFL+PY   + L  +PMF +E+ +GQF +   I VW +VPL KGIG+A V +      ++N+I AW ++YL+ SF++ + WS+C N+W+   C+                        A  N T       L   P+++Y+++ VL L+KG+++ GT+   L  C+LA WI V+ C+++G+K+SG+V+Y     P++++  LL R+ TL G+   + Y+L PKWE L+ + VW ++  Q F+S S   G L  + SY+ FH+N  +D  L  +V+   S +   + F  +GF      I +    +  G  L FV   +ALA + +  L++ LFF MI+L+   +Q   VE  ++S  D +P  +   +N++  +  VC +   + +      G++  +L   ++ +  +++IA LEC++I + YG+     N   +    +GY P  +IFW  L     P+  L I     + ++ ++Y+       Y+FP WS+   W +A+  L+ +PI+         G I ++  ++L P 
Sbjct:   63 IRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLR--RNRRHVLTTVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWI----VGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQYES------YQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPD 624          
BLAST of slc6a-2 vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 481.485 bits (1238), Expect = 5.129e-163
Identity = 254/583 (43.57%), Postives = 367/583 (62.95%), Query Frame = 3
Query:   39 HIVSISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCST----------DAFKNSTNS-----SALKI------DPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWG----ALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQ 1709
             +V I ++PD        R  W +K+DF+L+ +G ++GLGNVWRFPYLCYKNGGGAF++PY I++ L GIPMF +E+ +GQ +  GG+ V+ I P+ KGIGYA+ V+   +N YY VILAWA++Y   S    V W  CNN WNT+ C +          D   N T       SAL I      DP  E+WE R L ++ GIE +G I+ +L   LL  WI+ YFCIWKG+K +G+V+YFTA  PYVL+  LL+R  TLPGA  G+++Y+IP + +L   EVW+D+ TQIFFSY + +GTLVALGSYN F +N  +D ++   VNS TS  AGFVIF  +GFM+     P+ +V ASGPGLAF+VYP A+ ++P + +WS LFF M++L+G+DSQF  +EGFIT+  D +P  +   K K+IFIA+VC +++ +GLT +T GGMY+FQ+ D Y  S   ++  +  EC+SI + YG+ RF   + +M    +GY P ++W       TP   L +F  + + ++ ++Y      + Y +P W+   GW  A S ++++P+       R  G + E+I+ L++
Sbjct:   48 QLVKIEQLPD--------RGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVCSVSALNITSLELTDPVKEFWERRALQISHGIEEIGNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLR--KRKEIFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFYDGIKDM----IGYYPTVWWKFCWCVTTPAICLGVFFFNIVQWTPVKY------LDYSYPWWAHAFGWFTALSSMLYIPLYMFWLWKRTPGELSEKIRALVR 610          
BLAST of slc6a-2 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 459.914 bits (1182), Expect = 1.494e-154
Identity = 240/579 (41.45%), Postives = 344/579 (59.41%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST--------------------------NSSALKIDP----------AIEYWEHRVLGLNK--GIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            R+ W  K+DFLL+ IGF+V L NVWRFPYLCYKNGGGAFL+PY I +V+GGIP+F +E+ +GQ   +G I  W  +VPL KGIGYA V++ F ++ YYNVI+AW++ +  ASF   + W+ CNN WNT  C     +N++                          N S+L              A EY+   +L LN+  GI ++G IK D+  CLL  +++ YF +WKGI TSG+V++FTA  PY +++ LLIR  TLPG+ +G++YYL P +  +   EVWVD+ TQ+FFS     G L+A  SYN +H+N  +D +L S +NS TSF+AGFVIF  LG+M+   G+ I++V   GPGL FVVYP A+A MP ++ W+++FF M++ LG+DS F G E  IT+ +D FP      +N+++F+A +  + F +GL   T GG Y F L D Y     I++    E +++ + YG  RFS ++ +M GF  G    + W  + PIFLL I +   I Y  L Y        Y +PSW+  +GW +A S +V +P +A   +L   G + +R   L  P
Sbjct:   27 RETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFP---KIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYAD------YVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRFTILTTP 596          
BLAST of slc6a-2 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 459.914 bits (1182), Expect = 1.652e-154
Identity = 240/579 (41.45%), Postives = 344/579 (59.41%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST--------------------------NSSALKIDP----------AIEYWEHRVLGLNK--GIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            R+ W  K+DFLL+ IGF+V L NVWRFPYLCYKNGGGAFL+PY I +V+GGIP+F +E+ +GQ   +G I  W  +VPL KGIGYA V++ F ++ YYNVI+AW++ +  ASF   + W+ CNN WNT  C     +N++                          N S+L              A EY+   +L LN+  GI ++G IK D+  CLL  +++ YF +WKGI TSG+V++FTA  PY +++ LLIR  TLPG+ +G++YYL P +  +   EVWVD+ TQ+FFS     G L+A  SYN +H+N  +D +L S +NS TSF+AGFVIF  LG+M+   G+ I++V   GPGL FVVYP A+A MP ++ W+++FF M++ LG+DS F G E  IT+ +D FP      +N+++F+A +  + F +GL   T GG Y F L D Y     I++    E +++ + YG  RFS ++ +M GF  G    + W  + PIFLL I +   I Y  L Y        Y +PSW+  +GW +A S +V +P +A   +L   G + +R   L  P
Sbjct:   27 RETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFP---KIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYAD------YVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRFTILTTP 596          
BLAST of slc6a-2 vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0077447)

HSP 1 Score: 436.802 bits (1122), Expect = 3.178e-145
Identity = 229/575 (39.83%), Postives = 345/575 (60.00%), Query Frame = 3
Query:   66 DQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGI-EVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKID--PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKN-KQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPII-ERIKKLLQP-----KLKGIEHFTNESHQMK 1760
            D+ +     +  W NK+ F+LACIG+SVGLGNVWRFPY+CYK+GGG FL+PY I + +  IP+  +E+ VGQ+  RG I  +  + PL KG G ASVVV F+++ YY+VI+ ++IYY   SF   + W  CNN WNT  C     +   N+SA      P+ E++E++VL ++ G+E  G ++ +L  CL+ AW++VYF  WK IK+S +V YFTAT P+VL+I L++R  TL GA  GL ++  PKW  L    VW+++ +Q F S  I  G++++  SYN +++N +RD V  S VN  TS L G   F TLG ++      +++V+  GPG+ FVVYP+A+A+MP   LW+V+FF M++ LG++SQF  VE  +TS  D FP W+ +     +I +  VC+++   G+  +  GG+Y FQL D+Y  S  I+ +A  + ++I +FYG  R S+N+ +M G +  +     W  L P  L  I+++S I Y E  Y  G     Y +P W+  +GW  A+  L+ +P  A I  LR  G    ERI+  L+P     K+ G  H  ++  + +
Sbjct:   43 DETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQ-RKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGR----YTYPDWAYGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECKICGEHHCEHDYPEQE 612          
BLAST of slc6a-2 vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089971)

HSP 1 Score: 426.017 bits (1094), Expect = 4.179e-143
Identity = 218/459 (47.49%), Postives = 300/459 (65.36%), Query Frame = 3
Query:   39 HIVSISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCST----------DAFKNSTNS-----SALKI------DPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVT------HGGMYVFQLFDY 1334
             +V I ++PD        R  W +K+DF+L+ +G ++GLGNVWRFPYLCYKNGGGAF++PY I++ L GIPMF +E+ +GQ +  GG+ V+ I P+ KGIGYA+ V+   +N YY VILAWA++Y   S    V W  CNN WNT+ C +          D   N T       SAL I      DP  E+WE R L ++ GIE +G I+ +L   LL  WI+ YFCIWKG+K +G+V+YFTA  PYVL+  LL+R  TLPGA  G+++Y+IP + +L   EVW+D+ TQIFFSY + +GTLVALGSYN F +N  +D ++   VNS TS  AGFVIF  +GFM+     P+ +V ASGPGLAF+VYP A+ ++P + +WS LFF M++L+G+DSQF  +EGFIT+  D +P  +   K K+IFIA+VC +++ +GLT +T      + G Y   +F Y
Sbjct:   48 QLVKIEQLPD--------RGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVCSVSALNITSLELTDPVKEFWERRALQISHGIEEIGNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLR--KRKEIFIAIVCALSYLVGLTCITQLAAFAYCGSYSLNVFQY 496          
BLAST of slc6a-2 vs. Ensembl Zebrafish
Match: slc6a6a (solute carrier family 6 member 6a [Source:ZFIN;Acc:ZDB-GENE-081104-1])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 270/575 (46.96%), Postives = 387/575 (67.30%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE 1745
            +R  D+       R+KW +KLDF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  + P+  GIGYAS++++ +LN YY VILAW +YYL+  F + + W+ C ++WNT  C  D  +         N+TN ++    P  E+WE  VL ++ GI+ VG +K +L  CLLA W++ +FCIWKG+K++G+V+YFTAT P++++I LLIR  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  GI I +V  SGPGLAF+ YPKA+  MP+ ++W++LFF M++LLG+DSQFV VEG ITS  D++P  + KG  ++IFIAV+C++++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  F+ S + Y  L Y     N +YK+P WS+ +GW +A + ++ +P++  I I++  G +IERIK +  P   G      E
Sbjct:   28 TRPEDEAEGKAPQREKWASKLDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWGKLCPIFTGIGYASIIIVSLLNIYYIVILAWGLYYLLQCFQHELPWARCRHSWNTENCVEDTVRKNKTLWLSANATNFTS----PVTEFWERNVLSISSGIDEVGGLKWELALCLLAVWVICFFCIWKGVKSTGKVVYFTATFPFLMLIVLLIRGVTLPGATEGIKFYLYPDLSRLKDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGIAIADVAESGPGLAFIAYPKAVTMMPLPTVWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSLLRKGYRREIFIAVICVISYLLGLTMVTKGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADNFYDAIEDMIGYRPNSWMKWSWMLITPVLCVGCFVFSLVKYKPLTY-----NKLYKYPDWSIGLGWALALASMICIPMMVVIKIIQSDGSLIERIKAVAAPVKGGASSRPKE 593          
BLAST of slc6a-2 vs. Ensembl Zebrafish
Match: slc6a6b (solute carrier family 6 member 6b [Source:ZFIN;Acc:ZDB-GENE-030131-3077])

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 271/556 (48.74%), Postives = 377/556 (67.81%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIE 1688
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CNN WNT  C  D  +         N+TN ++    P  E+WE  VL ++ GIE VG +K DL  CLLA W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NS TSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA+VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + EM G+         W  +TP   +  FI S + Y+ L Y     N +Y++P WS+ VGWT+A + ++ +P++  I I++  GP+IE
Sbjct:   28 TRPEDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNKWNTENCVEDTLRRNKTLWAAANATNFTS----PVTEFWERNVLSISDGIEEVGHVKWDLALCLLAMWVICFFCIWKGVKSTGKVVYVTATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLGDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAIEEMIGYRPNPWMKWSWTVVTPFLCVGCFIFSLVKYAPLRY-----NKIYEYPDWSIGVGWTLALASMICIPMVVVIKIIQSDGPLIE 574          
BLAST of slc6a-2 vs. Ensembl Zebrafish
Match: slc6a8 (solute carrier family 6 member 8 [Source:ZFIN;Acc:ZDB-GENE-071024-2])

HSP 1 Score: 525.398 bits (1352), Expect = 5.536e-180
Identity = 262/556 (47.12%), Postives = 365/556 (65.65%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC----STDAFKNST--NSS---------ALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            R+ W  ++DF+++C+GF+VGLGNVWRFPYLCYKNGGG FLIPY + + LGGIP+F LE+ +GQFM  G I VWNI PL KG+GYAS+V++F  N YY ++LAW  YY + SFN  + WS C+N WNT  C         KN T  NS+         A    P IE+WE++VL ++ G++  G +  +LM CLLA W++VYFC+WKG+K++G+++YFTAT PYV++I LL+R  TLPGA  G+ YY+ P W +L   +VW+D+GTQIFFSY+I +G L ALGSYN F+++  +D  + +++NSGTSF AGFV+F  LGFM+   G+ I  V  SGPGLAF+ YPKA++ MP+  +W+ LFF M++LLG+DSQFVGVEGF+T   D+FP        ++I +A+ CL+ F I L+MVT GGMYVFQLFDYY  S + ++  A  EC+ + + YG  RF  ++  M G+         W  +TP   + IF+   + Y  L Y     N VY +P W   +GW +A S ++ +P+     +    G   ER + L +P
Sbjct:   46 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLFIFLGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGYASMVIVFFCNTYYIMVLAWGFYYFIKSFNATLPWSTCDNPWNTENCIEIFRQGDCKNGTIGNSTFGNLTCEELANGRSPIIEFWENKVLNISDGLDEPGAVNWELMLCLLAVWVMVYFCVWKGVKSTGKIVYFTATFPYVVLIILLVRGVTLPGAYDGILYYVKPDWSKLGEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNDCYKDAFVLALINSGTSFFAGFVVFSILGFMASEQGVDISKVAESGPGLAFIAYPKAVSMMPVAPVWAALFFIMLLLLGLDSQFVGVEGFVTGILDLFPGKYYMRYQREIAVAICCLLCFIIDLSMVTQGGMYVFQLFDYYSASGMTLLWQAFWECVVVAWVYGADRFMDDIARMIGYRPFPWMKWCWSIITPCVCMGIFLFHLLNYKPLTY-----NNVYVYPWWGEVIGWCLALSSMLCIPVSLVYKLSGAKGTFKERWENLTKP 596          
BLAST of slc6a-2 vs. Ensembl Zebrafish
Match: SLC6A13 (solute carrier family 6 member 13 [Source:NCBI gene;Acc:100332592])

HSP 1 Score: 516.153 bits (1328), Expect = 1.319e-176
Identity = 263/563 (46.71%), Postives = 368/563 (65.36%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKN-STNSSALK--IDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGS-RXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            R +W NKL+F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPY I +   GIP+F LE+ +GQ+ + GGI  W  I PL +GIGYA+ V++ +LN YY ++LAW I+YL  SF + + WS CNN WNT  C     +N S + S L     P IE+WE RVL ++ GIE++GT+  DL+ CLL AW++ YFCIWKG+K++G+V+YFTAT PYV+++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G L ALGSYN +++N  RD +    +NSGTSF+AGF IF  LGFMS    +PI  V  SGPGLAF+ YP+A++ MPI+ LW+  FF MI+LLG+DSQFV VE  +T+  D++P +  +   +++ I VV +++F +GL M+T GGMYVFQLFDYY  S   ++ +A+ E + I + YG  RF  N+ +M G+  G      W   TP      F  S I Y+ L+Y     N  Y +P W   +GW +A S ++ VP+     +    G ++ER++ L++P    +     E  +++ V
Sbjct:   24 RGQWSNKLEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFFLEISLGQYTSEGGITCWRKISPLFEGIGYATQVIVALLNFYYIIVLAWGIFYLSNSFTWNLPWSSCNNTWNTESCMEFQRRNDSVDQSYLDNATSPVIEFWERRVLRISSGIEDIGTLHWDLVLCLLLAWVLCYFCIWKGVKSTGKVVYFTATFPYVMLLILLIRGVTLPGASRGIQFYLYPDLGRLADPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNCYRDSLALCFLNSGTSFVAGFAIFSILGFMSYEQNVPISEVAESGPGLAFIAYPRAVSMMPISPLWACFFFIMIVLLGLDSQFVCVESLVTAMVDMYPSFFRRKNRRELLILVVAIVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFETVCIAWIYGANRFYDNIEDMIGYRPGPYIKYCWLFFTPATCFGTFAFSLIKYTPLKY-----NNEYVYPWWGYALGWMLALSSMICVPLWVIYRMGTTKGSLMERVQFLIRPS-PDLPKSRREQEKLQAV 580          
BLAST of slc6a-2 vs. Ensembl Zebrafish
Match: slc6a1b (solute carrier family 6 member 1b [Source:ZFIN;Acc:ZDB-GENE-041114-57])

HSP 1 Score: 506.523 bits (1303), Expect = 3.461e-173
Identity = 261/580 (45.00%), Postives = 374/580 (64.48%), Query Frame = 3
Query:   36 IHIVSISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAI-EYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWG----ALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQM 1757
            + +     +PD        R+ W  K DFLL+C+G+++GLGNVWRFPYLC KNGGGAFLIPYF++++  G+P+F LE  +GQ+ + GG+ VW + P+ KG+G A+ V+ F LN YY VI+AWAIYYL  SF   + W  C+N WNT +C    F N + ++   +  A+ E+WE  +  L  G+E  G I+L L   L  AW++VYFCIWKG+  +G+V+YF+AT PY ++  L IR  TLPGA+ G+ +Y+ P++ +L   EVW+D+ TQIFFSY + +G+L+ALGSYN F++N  +D ++   +NS TS  AGFVIF  +GFM+  T  PI +V ASGPGLAF+ YP+A+ ++PI+ LW+VLFF+M+++LGIDSQF  VEGFIT+  D FP  + +G+ ++IFIAVVCL+++ IGL+ +T GG+YVF+LFDYY  S + ++  V  EC+SI +FYG+ +F  NL EM    +GY P I+W       TP+ +  +F+ S +    L          Y FP W   VGW MA S +V +P       L   G   ER++ ++QP    +    N   Q 
Sbjct:   32 VKVQKKKELPD--------RETWQGKFDFLLSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFFLETALGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIIAWAIYYLYNSFTTDLPWKSCDNPWNTDKC----FSNYSMANIGNMTSAVVEFWERNMHQLTDGLEKPGEIRLPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYFMLFILFIRGVTLPGAKEGILFYVTPEFSKLKESEVWLDAATQIFFSYGLGLGSLIALGSYNPFNNNVYKDSIIVCCINSFTSMFAGFVIFSIVGFMAHITKRPIADVAASGPGLAFLAYPEAVTQLPISPLWAVLFFSMLLMLGIDSQFCTVEGFITALVDEFPRAL-RGR-REIFIAVVCLVSYLIGLSNITQGGLYVFKLFDYYSASGMCLLFLVFFECVSISWFYGVNKFYGNLEEM----IGYKPCIWWKLCWVVFTPLIVAGVFLFSAVQMVPLTLNN------YVFPKWGQGVGWCMALSSMVLIPGYMGYMFLTLKGSYKERLRIMIQPTAAAVRTQENGPEQQ 587          
BLAST of slc6a-2 vs. Ensembl Xenopus
Match: ilf3 (interleukin enhancer binding factor 3 [Source:Xenbase;Acc:XB-GENE-494367])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 276/582 (47.42%), Postives = 394/582 (67.70%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            +R  D+       R+KW +K+DF+L+  G  +GLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  I P+  GIGYAS+V++ +LN YY VILAW +YYL  SF   + W+ C+  WNT  C  D F+         NSTN ++    P  E+WEH+VL L+KGI++VG +K DL  CLL  W++ +FCIWKG++++G+V+YFTAT P+++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ S W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIAVVC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG  +F  N+ +M G+  G      W  +TP+  +  FI S   Y+ L Y     N  Y +P W++ +GW +A S ++ +P++    I+R  G +IERIK +  P  + +  +  +S    P+
Sbjct:   34 TRPEDEADGKPPQREKWASKIDFVLSVAGGFIGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVVLGQFTSEGGITCWEKICPVFTGIGYASIVIVSLLNVYYIVILAWGVYYLFQSFQGQLPWALCHQPWNTESCVEDTFRKNWTMWMSMNSTNFTS----PVTEFWEHKVLSLSKGIDDVGVLKWDLALCLLLTWVICFFCIWKGVRSTGKVVYFTATFPFIMLLMLLIRGVTLPGAAEGIKFYLYPDITRLADPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPLPSFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAVVCFLSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADKFYDNIEDMIGYKPGPWMKWSWTVITPLLCVACFIFSLAKYTPLTY-----NKYYVYPDWAIGLGWVLALSSMICIPLVVVFHIVRSDGSLIERIKAVTAP--REVNRWAKDSEAAAPI 604          
BLAST of slc6a-2 vs. Ensembl Xenopus
Match: ilf3 (interleukin enhancer binding factor 3 [Source:Xenbase;Acc:XB-GENE-494367])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 276/582 (47.42%), Postives = 394/582 (67.70%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            +R  D+       R+KW +K+DF+L+  G  +GLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  I P+  GIGYAS+V++ +LN YY VILAW +YYL  SF   + W+ C+  WNT  C  D F+         NSTN ++    P  E+WEH+VL L+KGI++VG +K DL  CLL  W++ +FCIWKG++++G+V+YFTAT P+++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ S W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIAVVC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG  +F  N+ +M G+  G      W  +TP+  +  FI S   Y+ L Y     N  Y +P W++ +GW +A S ++ +P++    I+R  G +IERIK +  P  + +  +  +S    P+
Sbjct:   29 TRPEDEADGKPPQREKWASKIDFVLSVAGGFIGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVVLGQFTSEGGITCWEKICPVFTGIGYASIVIVSLLNVYYIVILAWGVYYLFQSFQGQLPWALCHQPWNTESCVEDTFRKNWTMWMSMNSTNFTS----PVTEFWEHKVLSLSKGIDDVGVLKWDLALCLLLTWVICFFCIWKGVRSTGKVVYFTATFPFIMLLMLLIRGVTLPGAAEGIKFYLYPDITRLADPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPLPSFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAVVCFLSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADKFYDNIEDMIGYKPGPWMKWSWTVITPLLCVACFIFSLAKYTPLTY-----NKYYVYPDWAIGLGWVLALSSMICIPLVVVFHIVRSDGSLIERIKAVTAP--REVNRWAKDSEAAAPI 599          
BLAST of slc6a-2 vs. Ensembl Xenopus
Match: ilf3 (interleukin enhancer binding factor 3 [Source:Xenbase;Acc:XB-GENE-494367])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 276/582 (47.42%), Postives = 394/582 (67.70%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            +R  D+       R+KW +K+DF+L+  G  +GLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  I P+  GIGYAS+V++ +LN YY VILAW +YYL  SF   + W+ C+  WNT  C  D F+         NSTN ++    P  E+WEH+VL L+KGI++VG +K DL  CLL  W++ +FCIWKG++++G+V+YFTAT P+++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ S W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIAVVC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG  +F  N+ +M G+  G      W  +TP+  +  FI S   Y+ L Y     N  Y +P W++ +GW +A S ++ +P++    I+R  G +IERIK +  P  + +  +  +S    P+
Sbjct:   28 TRPEDEADGKPPQREKWASKIDFVLSVAGGFIGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVVLGQFTSEGGITCWEKICPVFTGIGYASIVIVSLLNVYYIVILAWGVYYLFQSFQGQLPWALCHQPWNTESCVEDTFRKNWTMWMSMNSTNFTS----PVTEFWEHKVLSLSKGIDDVGVLKWDLALCLLLTWVICFFCIWKGVRSTGKVVYFTATFPFIMLLMLLIRGVTLPGAAEGIKFYLYPDITRLADPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPLPSFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAVVCFLSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADKFYDNIEDMIGYKPGPWMKWSWTVITPLLCVACFIFSLAKYTPLTY-----NKYYVYPDWAIGLGWVLALSSMICIPLVVVFHIVRSDGSLIERIKAVTAP--REVNRWAKDSEAAAPI 598          
BLAST of slc6a-2 vs. Ensembl Xenopus
Match: ilf3 (interleukin enhancer binding factor 3 [Source:Xenbase;Acc:XB-GENE-494367])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 275/583 (47.17%), Postives = 395/583 (67.75%), Query Frame = 3
Query:   51 ISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            +++  D+       R+KW +K+DF+L+  G  +GLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  I P+  GIGYAS+V++ +LN YY VILAW +YYL  SF   + W+ C+  WNT  C  D F+         NSTN ++    P  E+WEH+VL L+KGI++VG +K DL  CLL  W++ +FCIWKG++++G+V+YFTAT P+++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ S W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIAVVC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG  +F  N+ +M G+  G      W  +TP+  +  FI S   Y+ L Y     N  Y +P W++ +GW +A S ++ +P++    I+R  G +IERIK +  P  + +  +  +S    P+
Sbjct:    4 MNKPEDEADGKPPQREKWASKIDFVLSVAGGFIGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVVLGQFTSEGGITCWEKICPVFTGIGYASIVIVSLLNVYYIVILAWGVYYLFQSFQGQLPWALCHQPWNTESCVEDTFRKNWTMWMSMNSTNFTS----PVTEFWEHKVLSLSKGIDDVGVLKWDLALCLLLTWVICFFCIWKGVRSTGKVVYFTATFPFIMLLMLLIRGVTLPGAAEGIKFYLYPDITRLADPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPLPSFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAVVCFLSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADKFYDNIEDMIGYKPGPWMKWSWTVITPLLCVACFIFSLAKYTPLTY-----NKYYVYPDWAIGLGWVLALSSMICIPLVVVFHIVRSDGSLIERIKAVTAP--REVNRWAKDSEAAAPI 575          
BLAST of slc6a-2 vs. Ensembl Xenopus
Match: ilf3 (interleukin enhancer binding factor 3 [Source:Xenbase;Acc:XB-GENE-494367])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 270/556 (48.56%), Postives = 382/556 (68.71%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIE 1688
            +R  D+       R+KW +K+DF+L+  G  +GLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  I P+  GIGYAS+V++ +LN YY VILAW +YYL  SF   + W+ C+  WNT  C  D F+         NSTN ++    P  E+WEH+VL L+KGI++VG +K DL  CLL  W++ +FCIWKG++++G+V+YFTAT P+++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ S W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIAVVC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG  +F  N+ +M G+  G      W  +TP+  +  FI S   Y+ L Y     N  Y +P W++ +GW +A S ++ +P++    I+R  G +IE
Sbjct:   16 TRPEDEADGKPPQREKWASKIDFVLSVAGGFIGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVVLGQFTSEGGITCWEKICPVFTGIGYASIVIVSLLNVYYIVILAWGVYYLFQSFQGQLPWALCHQPWNTESCVEDTFRKNWTMWMSMNSTNFTS----PVTEFWEHKVLSLSKGIDDVGVLKWDLALCLLLTWVICFFCIWKGVRSTGKVVYFTATFPFIMLLMLLIRGVTLPGAAEGIKFYLYPDITRLADPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPLPSFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAVVCFLSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADKFYDNIEDMIGYKPGPWMKWSWTVITPLLCVACFIFSLAKYTPLTY-----NKYYVYPDWAIGLGWVLALSSMICIPLVVVFHIVRSDGSLIE 562          
BLAST of slc6a-2 vs. Ensembl Mouse
Match: Slc6a6 (solute carrier family 6 (neurotransmitter transporter, taurine), member 6 [Source:MGI Symbol;Acc:MGI:98488])

HSP 1 Score: 520.39 bits (1339), Expect = 2.718e-178
Identity = 272/561 (48.48%), Postives = 382/561 (68.09%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTN-----SSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  D+       R+KW +K+DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +   G+P+F LEV +GQ+ + GGI  W  I PL  GIGYAS+V++ +LN YY VILAWA YYL  SF   + W+HCN++WNT QC  D  + + +     S+A    P IE+WE  VL L+ GI+N G++K DL  CLL  W+V +FCIWKG++++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA++C +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC  I + YG       + +M G+  G      W  +TP   +  F+ S + Y  L Y     N VY++P W++ +GW +A S ++ +P++  I + R  GP+  RIK L+ P+
Sbjct:   28 TRPEDEADGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEVIIGQYTSEGGITCWEKICPLFSGIGYASIVIVSLLNVYYIVILAWATYYLFHSFQKDLPWAHCNHSWNTPQCMEDTLRRNESHWVSLSTANFTSPVIEFWERNVLSLSSGIDNPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGEGIKFYLYPDISRLGDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAILCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPALCVGCFVFSLVKYVPLTY-----NKVYRYPDWAIGLGWGLALSSMLCIPLVIVILLCRTEGPLRVRIKYLITPR 583          
BLAST of slc6a-2 vs. Ensembl Mouse
Match: Slc6a13 (solute carrier family 6 (neurotransmitter transporter, GABA), member 13 [Source:MGI Symbol;Acc:MGI:95629])

HSP 1 Score: 514.612 bits (1324), Expect = 3.134e-176
Identity = 254/556 (45.68%), Postives = 368/556 (66.19%), Query Frame = 3
Query:   66 DQISMTGIV-RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNS----SALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGS-RXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            +++   G + R+ W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPY I +   GIP+F LE  +GQ+  +GGI  W  I P+ +GIGYAS +++ +LN YY V+LAWA++YL +SF   + W  C++ WNT  C    F+ + +S    S     P IE+WE RVL L+ GI+++G+++ +L+ CLL AWI+ YFCIWKG+K++G+V+YFTAT PY++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFS++I +G L ALGSYN +H+N  RDC+   ++NS TSF+AGF IF  LGFMS+  G+PI  V  SGPGLAF+ YP+A+  +P + LW+  FF M++LLG+DSQFV VE  +T+  D++P    K   +++ I +V +++F IGL M+T GGMYVFQLFDYY  S   ++ +A+ E L + + YG  RF  N+ +M G+    +    W   TP   L  F+ S I Y+ L Y     N  Y +P W   +GW +A S ++ +P  +   +    GP+ ER+++L+ P
Sbjct:   22 EKVEEDGTLEREHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRRICPIFEGIGYASQMIVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCV--EFQKANDSMNVTSENATSPVIEFWERRVLKLSDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCILNSSTSFMAGFAIFSILGFMSQEQGVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLILIVSVISFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAGRFYDNIEDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTY-----NKKYTYPWWGDALGWLLALSSMICIPAWSIYKLRTLKGPLRERLRQLVCP 570          
BLAST of slc6a-2 vs. Ensembl Mouse
Match: Slc6a1 (solute carrier family 6 (neurotransmitter transporter, GABA), member 1 [Source:MGI Symbol;Acc:MGI:95627])

HSP 1 Score: 501.516 bits (1290), Expect = 3.957e-171
Identity = 247/543 (45.49%), Postives = 361/543 (66.48%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC-STDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            RD W  + DFL++C+G+++GLGNVWRFPYLC KNGGGAFLIPYF++++  G+P+F LE  +GQ+ + GG+ VW + P+ KG+G A+ V+ F LN YY VI++WAIYYL  SF   + W  C+N WNT +C S  +  N+TN ++      +E+WE  +  +  G++  G I+  L   L  AW++VYFCIWKG+  +G+V+YF+AT PY+++I L  R  TLPGA+ G+ +Y+ P + +L   EVW+D+ TQIFFSY + +G+L+ALGSYN FH+N  RD ++   +NS TS  AGFVIF  +GFM+  T   I +V ASGPGLAF+ YP+A+ ++PI+ LW++LFF+M+++LGIDSQF  VEGFIT+  D +P  +     +++FIA VC++++ IGL+ +T GG+YVF+LFDYY  S + ++  V  EC+SI +FYG+ RF  N+ EM G        + W   TPI +  +F+ S +  + L    GS    Y FP W   VGW MA S +V +P       L   G + +R++ ++QP 
Sbjct:   44 RDTWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLVNTTNMTS----AVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLR--NRRELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRFYDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPL--TMGS----YVFPKWGQGVGWLMALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPS 574          
BLAST of slc6a-2 vs. Ensembl Mouse
Match: Slc6a12 (solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 [Source:MGI Symbol;Acc:MGI:95628])

HSP 1 Score: 498.434 bits (1282), Expect = 1.056e-169
Identity = 259/547 (47.35%), Postives = 364/547 (66.54%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST----NSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            R +W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPYFI     GIP+F LEV +GQ+ ++G +  W  I PL++GIG ASVV+   LN YY +ILAWA++YL +SF + + W+ C N+WNT  C  D   +S+    +SS     P +E+WE RVLG+  GI ++G+++ +L  CLL AWI+ YFCIWKG+K++G+V+YFTAT PY+++I LLIR  TLPGA  G+ +YL P   RL   +VW+D+GTQIFFS++I  G L ALGSYN +H+N  RD +    +NS TSF+AGFV+F  LGFMS+  GIPI  V  SGPGLAF+ +PKA+  MP++ LWS LFF M++ LG+DSQFV +E  +T+  D+FP  + K   +++ I  + ++ + +GL +VT GGMY+FQLFDYY  S I ++ +++ E + I + YG  RF  N+ +M G+    +  I W  LTP   L  F  S   Y+ L+Y     N VY +PSW   +GW +A S +  VP+   I  L+  G   +R+++L+ P 
Sbjct:   36 RGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFSCGIPVFFLEVALGQYSSQGSVTAWRKICPLLQGIGMASVVIESYLNIYYIIILAWALFYLFSSFTWELPWTTCTNSWNTEHC-VDFLNHSSARGVSSSENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLIILLIRGVTLPGAYQGIVFYLKPDLLRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYRDSIALCFLNSATSFVAGFVVFSILGFMSQEQGIPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLLFLGLDSQFVCMECLVTASMDMFPQQLRKSGRRELLILAISVLCYLMGLLLVTEGGMYIFQLFDYYASSGICLLFLSLFEVICIGWVYGADRFYDNVEDMIGYRPWPLVKISWLFLTPGLCLATFFFSLSKYTPLKY-----NNVYMYPSWGYSIGWLLAFSSMACVPLFIIITFLKTQGSFKKRLRRLITPD 576          
BLAST of slc6a-2 vs. Ensembl Mouse
Match: Slc6a12 (solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 [Source:MGI Symbol;Acc:MGI:95628])

HSP 1 Score: 498.819 bits (1283), Expect = 1.292e-169
Identity = 259/547 (47.35%), Postives = 364/547 (66.54%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST----NSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            R +W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPYFI     GIP+F LEV +GQ+ ++G +  W  I PL++GIG ASVV+   LN YY +ILAWA++YL +SF + + W+ C N+WNT  C  D   +S+    +SS     P +E+WE RVLG+  GI ++G+++ +L  CLL AWI+ YFCIWKG+K++G+V+YFTAT PY+++I LLIR  TLPGA  G+ +YL P   RL   +VW+D+GTQIFFS++I  G L ALGSYN +H+N  RD +    +NS TSF+AGFV+F  LGFMS+  GIPI  V  SGPGLAF+ +PKA+  MP++ LWS LFF M++ LG+DSQFV +E  +T+  D+FP  + K   +++ I  + ++ + +GL +VT GGMY+FQLFDYY  S I ++ +++ E + I + YG  RF  N+ +M G+    +  I W  LTP   L  F  S   Y+ L+Y     N VY +PSW   +GW +A S +  VP+   I  L+  G   +R+++L+ P 
Sbjct:   50 RGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFSCGIPVFFLEVALGQYSSQGSVTAWRKICPLLQGIGMASVVIESYLNIYYIIILAWALFYLFSSFTWELPWTTCTNSWNTEHC-VDFLNHSSARGVSSSENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLIILLIRGVTLPGAYQGIVFYLKPDLLRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYRDSIALCFLNSATSFVAGFVVFSILGFMSQEQGIPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLLFLGLDSQFVCMECLVTASMDMFPQQLRKSGRRELLILAISVLCYLMGLLLVTEGGMYIFQLFDYYASSGICLLFLSLFEVICIGWVYGADRFYDNVEDMIGYRPWPLVKISWLFLTPGLCLATFFFSLSKYTPLKY-----NNVYMYPSWGYSIGWLLAFSSMACVPLFIIITFLKTQGSFKKRLRRLITPD 590          
BLAST of slc6a-2 vs. UniProt/SwissProt
Match: sp|P31643|SC6A6_RAT (Sodium- and chloride-dependent taurine transporter OS=Rattus norvegicus OX=10116 GN=Slc6a6 PE=2 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 3.208e-178
Identity = 274/561 (48.84%), Postives = 382/561 (68.09%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTN-----SSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  D+       R+KW +K+DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +   G+P+F LEV +GQ+ + GGI  W  I PL  GIGYAS+V++ +LN YY VILAWA YYL  SF   + W+HCN++WNT QC  D  + + +     S+A    P IE+WE  VL L+ GI++ G++K DL  CLL  W+V +FCIWKG++++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA+VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC  I + YG       + +M G+  G      W  +TP   +  FI S + Y  L Y     N VY++P W++ +GW +A S +V +P++  I + R  GP+  RIK L+ P+
Sbjct:   28 TRPEDEADGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEVIIGQYTSEGGITCWEKICPLFSGIGYASIVIVSLLNVYYIVILAWATYYLFQSFQKDLPWAHCNHSWNTPQCMEDTLRRNESHWVSLSAANFTSPVIEFWERNVLSLSSGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGEGIKFYLYPNISRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPALCVGCFIFSLVKYVPLTY-----NKVYRYPDWAIGLGWGLALSSMVCIPLVIVILLCRTEGPLRVRIKYLITPR 583          
BLAST of slc6a-2 vs. UniProt/SwissProt
Match: sp|Q9MZ34|SC6A6_BOVIN (Sodium- and chloride-dependent taurine transporter OS=Bos taurus OX=9913 GN=SLC6A6 PE=2 SV=1)

HSP 1 Score: 521.931 bits (1343), Expect = 6.018e-178
Identity = 274/570 (48.07%), Postives = 383/570 (67.19%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNS-----TNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLK---GIEH 1733
            +R  D+       R+KW +++DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQ+ + GGI  W  I PL  GIGYAS+V++ +LN YY +ILAWA+YYL  SF   + W+ CN++WNT  C  D  + +     +NS+A    P  E+WE +VL L+ GI+  G +K DL  CLL  W+V +FCIWKG+K++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D+ P  + KG +++IFIA +C + + +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC +I + YG   F   + +M G+  G      W  +TP+     FI S + Y  L Y     N VY +P+W++ +GW +A S +V VP++  I + +  GP + R+K LL P+      +EH
Sbjct:   28 TRPEDEAEGKPPQREKWASRIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVIIGQYTSEGGITCWEKICPLFAGIGYASIVIVSLLNIYYIIILAWAMYYLFQSFQSELPWAKCNHSWNTPHCLEDTLRRNRSLWISNSTANFTSPVTEFWERKVLSLSSGIDEPGALKWDLALCLLLVWLVCFFCIWKGVKSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDISRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLHPSLLRKGFHREIFIASICCVTYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFAIAWIYGSDNFYDGIEDMIGYRPGPWMKYCWAVVTPLLCTGCFIFSLVKYVPLTY-----NKVYTYPTWAIGLGWCLALSSMVCVPLVMVIRLAQTEGPFLVRLKYLLTPREPNRWAVEH 592          
BLAST of slc6a-2 vs. UniProt/SwissProt
Match: sp|O35316|SC6A6_MOUSE (Sodium- and chloride-dependent taurine transporter OS=Mus musculus OX=10090 GN=Slc6a6 PE=1 SV=2)

HSP 1 Score: 520.39 bits (1339), Expect = 1.901e-177
Identity = 272/561 (48.48%), Postives = 382/561 (68.09%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTN-----SSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK 1715
            +R  D+       R+KW +K+DF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +   G+P+F LEV +GQ+ + GGI  W  I PL  GIGYAS+V++ +LN YY VILAWA YYL  SF   + W+HCN++WNT QC  D  + + +     S+A    P IE+WE  VL L+ GI+N G++K DL  CLL  W+V +FCIWKG++++G+V+YFTAT P+ +++ LL+R  TLPGA  G+++YL P   RL   +VW+D+GTQIFFSY+I +G + +LGSYN + +NS RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + WS+LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA++C +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC  I + YG       + +M G+  G      W  +TP   +  F+ S + Y  L Y     N VY++P W++ +GW +A S ++ +P++  I + R  GP+  RIK L+ P+
Sbjct:   28 TRPEDEADGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEVIIGQYTSEGGITCWEKICPLFSGIGYASIVIVSLLNVYYIVILAWATYYLFHSFQKDLPWAHCNHSWNTPQCMEDTLRRNESHWVSLSTANFTSPVIEFWERNVLSLSSGIDNPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGEGIKFYLYPDISRLGDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAILCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPALCVGCFVFSLVKYVPLTY-----NKVYRYPDWAIGLGWGLALSSMLCIPLVIVILLCRTEGPLRVRIKYLITPR 583          
BLAST of slc6a-2 vs. UniProt/SwissProt
Match: sp|P31646|S6A13_RAT (Sodium- and chloride-dependent GABA transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a13 PE=1 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 2.735e-177
Identity = 256/546 (46.89%), Postives = 364/546 (66.67%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNS----SALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGS-RXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            R++W NK++F+L+  G  +GLGNVWRFPYLCYKNGGGAF IPY I +   GIP+F LE  +GQ+  +GGI  W  I P+ +GIGYAS +++ +LN YY V+LAWA++YL +SF   + W  C++ WNT  C    F+ + NS    S     P IE+WE RVL ++ GI+++G+++ +L+ CLL AWI+ YFCIWKG+K++G+V+YFTAT PY++++ LLIR  TLPGA  G+++YL P   RL   +VW+D+GTQIFFS++I +G L ALGSYN +H+N  RDCV   ++NS TSF+AGF IF  LGFMS+  G+PI  V  SGPGLAF+ YP+A+  +P + LW+  FF M++LLG+DSQFV VE  +T+  D++P    K   ++I I +V +++F IGL M+T GGMYVFQLFDYY  S   ++ +A+ E L + + YG  RF  N+ +M G+    +    W   TP   L  F+ S I Y+ L Y     N  Y +P W   +GW +A S +V +P  +   +    GP+ ER+++L+ P
Sbjct:   32 REQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRKICPIFEGIGYASQMIVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCV--EFQKTNNSLNVTSENATSPVIEFWERRVLKISDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCVALCILNSSTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREILILIVSVVSFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGASRFYDNIEDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTY-----NKKYTYPWWGDALGWLLALSSMVCIPAWSIYKLRTLKGPLRERLRQLVCP 570          
BLAST of slc6a-2 vs. UniProt/SwissProt
Match: sp|Q91502|SC6A8_TORMA (Creatine transporter OS=Torpedo marmorata OX=7788 PE=2 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 6.678e-177
Identity = 257/564 (45.57%), Postives = 362/564 (64.18%), Query Frame = 3
Query:   33 EIHIVSISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTN---SSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            E+     ++ PD  +     R  W  ++DF+++C+GF+VGLGNVWRFPYLCYKNGGG FLIPY +  V GGIP+F LE+ +GQFM  GGI  WNI PL KG+GYAS+V++F  N YY ++L W+ +YLV SF+ P+ W+ CNN WNT  C       ST     +A      +++WE RVL L+ G+ +VG I  +L  CL A W++VYFCIWKG+KTSG+V+Y TAT PY++++ LL+R  TL GA  G+ YYL P W +L   +VW+D+GTQIFFSY+I +GTL ALGSYN  H++  +D  + S+VNS TSF AG V+F  LGFM+   G+ I  V  SGPGLAF+ YPKA+  MP   +W+VLFF M++ LG+ SQFVGVEGF+T+  D++P   +    +++ +A+V  ++F I L+M+T GGMY+FQ+FDYY  S   ++  A  EC+++ + YG  R+  +L  M G+    +    W  +TP+  + IF    + Y  L Y     N  Y +P W   +GW +A + ++ VP      + R  G + ER +KL  P
Sbjct:   16 EMRAPRRAQPPDVPAGEPGSRVTWSRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLVAVFGGIPIFFLEISLGQFMKAGGINAWNIAPLFKGLGYASMVIVFFCNTYYILVLTWSSFYLVQSFSSPLPWASCNNTWNTAACYEAGANASTEIYPPTAPAQSSIVQFWERRVLRLSSGLGDVGEIGWELTLCLTATWMLVYFCIWKGVKTSGKVVYVTATFPYIILVILLVRGVTLHGAVQGIVYYLQPDWGKLGEAQVWIDAGTQIFFSYAIGLGTLTALGSYNQLHNDCYKDAFILSLVNSATSFFAGLVVFSILGFMAVEEGVDISVVAESGPGLAFIAYPKAVTLMPFPQVWAVLFFIMLLCLGLGSQFVGVEGFVTAILDLWPSKFSFRYLREVVVAMVICLSFLIDLSMITEGGMYIFQIFDYYSASGTTLLWTAFWECVAVAWVYGGDRYLDDLAWMLGYRPWALVKWCWSVITPLVCMGIFTFHLVNYKPLTY-----NKTYTYPWWGEAIGWCLALASMLCVPTTVLYSLSRGRGSLKERWRKLTTP 574          
BLAST of slc6a-2 vs. TrEMBL
Match: A0A0H3YF47 (Transporter OS=Schmidtea mediterranea OX=79327 GN=slc6a-2 PE=2 SV=1)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 563/563 (100.00%), Postives = 563/563 (100.00%), Query Frame = 3
Query:   78 MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRIIIIIAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV
Sbjct:    1 MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRIIIIIAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 563          
BLAST of slc6a-2 vs. TrEMBL
Match: R7T921 (Transporter OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_146418 PE=3 SV=1)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 333/588 (56.63%), Postives = 432/588 (73.47%), Query Frame = 3
Query:   39 HIVSISRIPD-QISMTGIV-RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASF---NYPVSWSHCNNAWNTLQC-STDAFKNSTNSS-------ALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKP 1763
            H V+I   P     +TG+  R+ W  K+DFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYF+ V++GG+P F LEV +GQFM++GGI VWNI PLM+GIG+A+V+++F+LN YYNVILAWA +YL ASF      + W+ C+N WNT +C  +   KN+TN+S           DP  EYWE +VL L+ G+++VG I+ DL  CLL AWIVVYFCIWKGIK+SG+VMYFTAT+PY+LM TLLIR  TLPG+  G+ +YLIP WE+L  ++VWVD+GTQ+F+SYSI +GTLVALGSYN F+HN +RDC+ F+ +NSGTSF +GFVIF  LGFM+   G+ + +V  SGPGLAF+ YPKA+AEMP    WS++FF MIILLG+DSQFVGVEGFIT+  D+FP  M +G  ++IFIAVVCL++F +GL+MVT GG+YVF LFDYY GSR+I+++A  EC  + Y YG  RF+ NL  M G+ +  I    W  + P+F L +F +    YSEL Y R      Y++P W++ +GWT+A S +  +P IA I ILREGG +IERI+KL++P+LK         HQ++P
Sbjct:   10 HPVAIGDEPQPATDVTGVYKRETWSRKIDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFLCVLVGGVPTFFLEVSIGQFMSKGGIGVWNICPLMQGIGFATVIIVFLLNIYYNVILAWAFHYLFASFASLGSELPWATCDNEWNTEKCIRSIRDKNATNASIYSNSTTNTTTDPITEYWERKVLHLSSGVDDVGQIRWDLALCLLLAWIVVYFCIWKGIKSSGKVMYFTATAPYLLMFTLLIRGVTLPGSGEGIRFYLIPDWEKLREVQVWVDAGTQVFYSYSIGVGTLVALGSYNKFNHNCLRDCITFAGINSGTSFFSGFVIFSVLGFMAHEQGVSVADVAESGPGLAFIAYPKAVAEMPFAPFWSIMFFIMIILLGLDSQFVGVEGFITAIVDVFPRQMRRGYRREIFIAVVCLVSFFVGLSMVTEGGIYVFLLFDYYSGSRVILLVAFFECFVVAYIYGGTRFNDNLAMMLGYRIFPIIKFAWWIMNPLFTLGMFALCIYSYSELTYNRH-----YEYPQWAIAIGWTLACSSVFMIPFIAVIKILREGGTLIERIRKLIRPRLK--------QHQLRP 584          
BLAST of slc6a-2 vs. TrEMBL
Match: A0A1S3HJP5 (Transporter OS=Lingula unguis OX=7574 GN=LOC106155402 PE=3 SV=1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 327/574 (56.97%), Postives = 412/574 (71.78%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC--------STDAFKNSTNS---------SALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKP 1763
            R+ W NK+DFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYF  V+LGGIP+F LEV +GQFM++GGI VW +VPL +GIGYA+ V++F LN YYNVIL WA YY  ASF   + W+ C NAWNT+ C        ST+A  N++ S             +D   EYWE +VL ++ GI  +GTIK DL  CLL AW+VVYFCIWKG+K+SG+VMYFTATSPY+ M  LLIR ATL GA  G++YYL+P + ++  ++VWVD+GTQIFFSYSI +G L ALGSYN FHHNS RD ++F+  NSGTS LAG VIF  LGFM++  G  +  V   GPGLAF+ YPKALA+MP+  LWSVLFF MIILLG+DSQFVGVEGFIT+  D +P ++ KG N++IF  + CL++F IGL+MVT GGMYVFQLFD+Y GSRII+++A+ ECL+I Y YGI RF  NL  M+GF +     + W  + P F+  IFIMS + YSEL Y R     VY++P W++ +GWTMA+   + +P++  I I    G + ERI KLL+P+LK         HQ++P
Sbjct:   63 RETWTNKIDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFTCVILGGIPVFFLEVALGQFMSQGGIGVWKLVPLFQGIGYAATVIVFSLNVYYNVILTWAFYYFFASFTSVLPWATCGNAWNTIHCRMHYDVTNSTNATLNASQSVGNDTMFSNKTKGVDSVTEYWERKVLQISTGINAMGTIKWDLALCLLLAWVVVYFCIWKGVKSSGKVMYFTATSPYIFMTVLLIRGATLDGAVDGIKYYLLPDFTKIGELQVWVDAGTQIFFSYSIGLGALTALGSYNKFHHNSYRDSIIFACTNSGTSLLAGLVIFSVLGFMAKEQGTNVGKVAEYGPGLAFIAYPKALAQMPLAPLWSVLFFLMIILLGLDSQFVGVEGFITAIVDQYPHYLRKGHNREIFTGLTCLVSFFIGLSMVTEGGMYVFQLFDFYSGSRIILVVALFECLAISYCYGINRFHDNLEMMYGFRVNPAIKVMWMGVCPAFVTAIFIMSGVTYSELTYNR-----VYQYPKWAIAIGWTMASVAALMIPLLMIIQIATTPGTLKERIVKLLRPRLK--------RHQLRP 623          
BLAST of slc6a-2 vs. TrEMBL
Match: V4AWT5 (Transporter OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_111250 PE=3 SV=1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 322/586 (54.95%), Postives = 413/586 (70.48%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC----STDAFKNS-------------TNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNES-HQMKPV*EFYITDTLN 1796
            R+ W  K DFLLACIGFSVGLGNVWRFP+LCYKNGGGAFLIPYFI+V+ GGIP+F LEV +GQFM+ GGI  W + P+ +GIGYAS +++F+LN  YN+ILAWA YYL  SF   + WS C+N WNT  C     + AF  S              N+S   ID   E+WE +VL L+ G+ + G IK DL  CLL AWIVVYFCIWKGIK+SG+VMYFTATSPY+LM+ LLIR  TL GA  G++YYL+P W +L   +VWVD+GTQIFFSYSI++GTL ALGSYN FHHN  RD V+F+ VNSGTSFLAGFV F  LGFM+++  + I  V  SGPGLAF+ YP+A+A+MP   LWSVLFF M+ILLG+DSQFVGVEGF+T+  D+ P     GK ++  I  +C+++F IGL+MVT GGMYVFQLFDYY  SRI++++A  EC+ + Y YGI RF  NL  MFGF  G    I W  +TP+F   IF++  I YSEL YKR    + Y +P+W++ VGW +A + +VF+PI+    IL+  G + ERI  LL+P+L+  +   NE   +++ + + Y T++ N
Sbjct:   33 RETWGRKFDFLLACIGFSVGLGNVWRFPFLCYKNGGGAFLIPYFIAVICGGIPVFFLEVSIGQFMSEGGIGPWKLCPMFQGIGYASAIIVFLLNIDYNIILAWAFYYLFQSFQAVLPWSTCDNDWNTDNCRIFNESSAFNGSVLYQTMTHNLSLNQNTSGQVIDSVTEFWERKVLQLSSGVGSPGNIKWDLALCLLLAWIVVYFCIWKGIKSSGKVMYFTATSPYILMLVLLIRGVTLDGASEGIKYYLLPDWSKLAEPQVWVDAGTQIFFSYSISLGTLTALGSYNKFHHNCYRDTVMFAAVNSGTSFLAGFVTFSVLGFMAKQQNVSISEVAESGPGLAFIAYPEAVAQMPFAPLWSVLFFVMVILLGLDSQFVGVEGFVTAVVDLKPQIFRVGKRREFLILGICILSFFIGLSMVTEGGMYVFQLFDYYSASRIVLVVAFFECIVVAYIYGIDRFYDNLQMMFGFRPGPFMKIAWTFITPVFTFSIFVLGAISYSELTYKR--KLITYSYPTWAIAVGWCLALASVVFIPIVVIFKILKSKGSLKERIVDLLKPRLQRHQLRDNEDMSKVQLIDDVYQTNSAN 616          
BLAST of slc6a-2 vs. TrEMBL
Match: R7V188 (Transporter OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_185554 PE=3 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 315/563 (55.95%), Postives = 406/563 (72.11%), Query Frame = 3
Query:   75 SMTGIV-RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASF---NYPVSWSHCNNAWNTLQC----------STDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLK 1721
             +TG+  R+ W  K+DFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYF+ V++GG+P F LEV +GQFM++GGI VWNI PL++GIG+A+V+++F++N YYNVILAWA +YL ASF   N  + W  C N WNT +C          +T  F N+T++     DP  EYWE +VL L+ G+++VG I+ DL  CLL AWIVVYFCIWKGIK+SG+VMYFTAT+PYVLM TLLIR  TLPG+  G+ +YLIP W++LL ++VWVD+GTQ+F+SYSI IGTL ALGSYN ++HN +RDC+ F+ +NSGTSF +GFVIF  LGFM+   G+ + +   SGPGLAF+ YPKA+AEMP    WS+LFF MIILLG+DSQFVGVEGFIT+  D+FP  M +G  +++FIA VCL++F IGL+MVT GGMYVF LFDYY GSR+I+++A  ECL++ Y YG  RF  NL  M G+ +  I    W  +TP F L +F +    YSEL Y R      Y +P W++ +GWTM+ S    +P  A   I+R+ G + E      QP  +
Sbjct:   23 DVTGVYKRETWTRKIDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFLCVLVGGVPTFFLEVAIGQFMSKGGIGVWNICPLLQGIGFATVLIVFLVNVYYNVILAWAFHYLFASFASFNGVLPWETCENDWNTPKCVRTIRGDNTTNTTIFSNTTSNGT--SDPITEYWERKVLHLSSGVDDVGQIRWDLALCLLLAWIVVYFCIWKGIKSSGKVMYFTATAPYVLMFTLLIRGITLPGSAEGIRFYLIPDWDKLLEVQVWVDAGTQVFYSYSIGIGTLTALGSYNKWNHNCLRDCLAFAGINSGTSFFSGFVIFSVLGFMAHEQGVSVADAAESGPGLAFIAYPKAIAEMPFAPFWSILFFFMIILLGLDSQFVGVEGFITAIVDVFPRQMRRGYRREVFIAFVCLVSFFIGLSMVTEGGMYVFLLFDYYAGSRVILLVAFFECLAVAYIYGATRFHDNLTMMLGYKVYSIVKYAWWIMTPFFTLALFALCIYSYSELTYNRD-----YVYPLWAIAIGWTMSCSSASMIPFTAFFKIIRQNGTLTEVFDPADQPTAR 578          
BLAST of slc6a-2 vs. Ensembl Cavefish
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:103034481])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 277/588 (47.11%), Postives = 388/588 (65.99%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK--------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE--------SHQMKP 1763
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF ++GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CNN WNT  C  D  +        N+TN ++    P  E+WE  VL ++ GIE VG +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NS TSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA+VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  FI S + Y  L Y     N +Y++P WS+ VGWT+A + ++ +P++  I I++  GP+IERIK +  P   G      E        +H + P
Sbjct:   28 TRPEDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSQGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNPWNTENCVEDTLRRNMTLRGANATNFTS----PVTEFWERNVLSISDGIEKVGPVKWDLALCLLGVWVICFFCIWKGVKSTGKVVYITATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLADPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAVEDMIGYRPNPWMKWCWTVITPLLCVGCFIFSLVKYKPLTY-----NKIYEYPDWSIGVGWTLALASMICIPMVVVIKIIQSDGPLIERIKAVAAPVRGGASSCPPEYRPKNTELAHPLDP 606          
BLAST of slc6a-2 vs. Ensembl Cavefish
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:103034481])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 277/588 (47.11%), Postives = 388/588 (65.99%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK--------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE--------SHQMKP 1763
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF ++GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CNN WNT  C  D  +        N+TN ++    P  E+WE  VL ++ GIE VG +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NS TSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA+VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  FI S + Y  L Y     N +Y++P WS+ VGWT+A + ++ +P++  I I++  GP+IERIK +  P   G      E        +H + P
Sbjct:   28 TRPEDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSQGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNPWNTENCVEDTLRRNMTLRGANATNFTS----PVTEFWERNVLSISDGIEKVGPVKWDLALCLLGVWVICFFCIWKGVKSTGKVVYITATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLADPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAVEDMIGYRPNPWMKWCWTVITPLLCVGCFIFSLVKYKPLTY-----NKIYEYPDWSIGVGWTLALASMICIPMVVVIKIIQSDGPLIERIKAVAAPVRGGASSCPPEYRPKNTELAHPLDP 606          
BLAST of slc6a-2 vs. Ensembl Cavefish
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:103034481])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 277/588 (47.11%), Postives = 388/588 (65.99%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK--------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE--------SHQMKP 1763
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF ++GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CNN WNT  C  D  +        N+TN ++    P  E+WE  VL ++ GIE VG +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NS TSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  ++IFIA+VC +++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  FI S + Y  L Y     N +Y++P WS+ VGWT+A + ++ +P++  I I++  GP+IERIK +  P   G      E        +H + P
Sbjct:   32 TRPEDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSQGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNPWNTENCVEDTLRRNMTLRGANATNFTS----PVTEFWERNVLSISDGIEKVGPVKWDLALCLLGVWVICFFCIWKGVKSTGKVVYITATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLADPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAVEDMIGYRPNPWMKWCWTVITPLLCVGCFIFSLVKYKPLTY-----NKIYEYPDWSIGVGWTLALASMICIPMVVVIKIIQSDGPLIERIKAVAAPVRGGASSCPPEYRPKNTELAHPLDP 610          
BLAST of slc6a-2 vs. Ensembl Cavefish
Match: slc6a6a (sodium- and chloride-dependent taurine transporter-like [Source:NCBI gene;Acc:103045940])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 277/599 (46.24%), Postives = 396/599 (66.11%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV*EFYITDTLNVYRIYKQ 1817
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL+  F   + W+ C ++WNT  C  D  +         N+TN ++    P  E+WE  VL L+ GI+ VG +K DL  CLLA W++ +FCIWKG+K++G+V+YFTAT P++++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P  + KG  ++IFIAV+C++++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  F+ S + Y  L Y     N VY++P WS+ VGW++A + ++ +P++  I I++  G +IERIK +  P +KG      + + +K     +  D    Y + K 
Sbjct:   41 TRPEDEAEGKPPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLLQCFQRELPWARCRHSWNTQNCVEDTIRKNKTLWLSVNATNFTS----PVTEFWERNVLSLSSGIDEVGELKWDLALCLLAVWVICFFCIWKGVKSTGKVVYFTATFPFLMLIVLLVRGVTLPGASEGIKFYLYPDLSRLQDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVAIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSLLRKGYRREIFIAVICVISYLLGLTMVTKGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADNFYDAIEDMIGYRPNGWMKWSWTLITPVLCVGCFVFSLVKYKPLTY-----NKVYEYPDWSIGVGWSLALASMICIPMVVVIKIIQSDGSLIERIKAVAAP-VKGGASSRPKEYSLKNSELLHPLDPNGTYALSKH 629          
BLAST of slc6a-2 vs. Ensembl Cavefish
Match: slc6a6a (sodium- and chloride-dependent taurine transporter-like [Source:NCBI gene;Acc:103045940])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 277/599 (46.24%), Postives = 396/599 (66.11%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV*EFYITDTLNVYRIYKQ 1817
            +R  D+       R+KW +KLDFLL+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL+  F   + W+ C ++WNT  C  D  +         N+TN ++    P  E+WE  VL L+ GI+ VG +K DL  CLLA W++ +FCIWKG+K++G+V+YFTAT P++++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MP+ + W++LFF M++LLG+DSQFV VEG ITS  D++P  + KG  ++IFIAV+C++++ +GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  F+ S + Y  L Y     N VY++P WS+ VGW++A + ++ +P++  I I++  G +IERIK +  P +KG      + + +K     +  D    Y + K 
Sbjct:   28 TRPEDEAEGKPPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLLQCFQRELPWARCRHSWNTQNCVEDTIRKNKTLWLSVNATNFTS----PVTEFWERNVLSLSSGIDEVGELKWDLALCLLAVWVICFFCIWKGVKSTGKVVYFTATFPFLMLIVLLVRGVTLPGASEGIKFYLYPDLSRLQDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGVAIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSLLRKGYRREIFIAVICVISYLLGLTMVTKGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADNFYDAIEDMIGYRPNGWMKWSWTLITPVLCVGCFVFSLVKYKPLTY-----NKVYEYPDWSIGVGWSLALASMICIPMVVVIKIIQSDGSLIERIKAVAAP-VKGGASSRPKEYSLKNSELLHPLDPNGTYALSKH 616          
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 482.641 bits (1241), Expect = 2.072e-165
Identity = 238/520 (45.77%), Postives = 354/520 (68.08%), Query Frame = 3
Query:   90 VRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC-STDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSV-RDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVP 1640
            VR  W  + DFL++C+G+++GLGNVWRFPYLC KNGGGAFLIPYF+++V  GIP+F LE  +GQ+ + GG+ VW + P+ KG+G ASVV+ F LN YY VI++WAIYYL  SF   + W  CNN WNT +C S  +  ++TN ++      +E+WE  +  L+ G++  G ++  L   L  +W++VYFCIWKG+  +G+V+YF+AT PYV++  L  R  TLPGA+ G+ +Y+ P + RL    VW+D+ TQIFFSY + +G+LVALGSYN FH+N   RD ++   +NS TS  AGFVIF  +GFMS  T  P++ + ASGPGLAF+ YP+A+ ++PI+ LWS+LFF+M+++LG+DSQF  VEGF+T+ +D +P ++    +K+IFIAV+C++++ IGL  +T GG+YVF++FDYY  S + ++  V  E ++I + YG+ RF+ N+ EM G  +    +I W   TP+ ++ +F+ S +  + L          Y +P W   +GW MA S ++ +P
Sbjct:    9 VRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSILDTTNLTS----TVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYLR--GHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGS------YTYPMWGQGMGWFMALSSMLLIP 516          
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 387.111 bits (993), Expect = 1.272e-128
Identity = 216/518 (41.70%), Postives = 333/518 (64.29%), Query Frame = 3
Query:  201 GAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYP-VSWSHCNNAWNTLQCS-----TDAFKNSTNSSALKID---PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAV-LECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIF----WGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQP 1712
            GAFL+PY ++VV  GIP+F LEV +GQ   +G I VW IVPL  G+G AS+VV+F+ + YY V+LAW++YYL+ S     + W+HC   W T  CS     + A  N++  ++   D   PA+E+WE  VL ++ G+ ++G++  +++ CLLA W++VYF +WKGIK SG+V+Y T + PYVL++ LL++   LPGA  G+ YYL P W +L   +VWV++ TQ+F+ Y +  G L ALGSYN FH+N  RD ++ +++NS TSF +GFV+F  LGFM++  G+ I +V  +GPGL FVVYP+A++ +P+ +LW+ L F M++LLG+DS+F G+EGF+T   D+FP  ++  + ++ F  + CL++F + +TMVT GG+YVFQLFD Y  S I ++  +  EC+++ + YG  RF ++L  M GF     PH +    W  ++P   L IF+   + Y  L Y     N  Y++P W+  +GW +A S ++ +P +A   +    G + +R + L  P
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFR----PHAWVWWCWSVVSPAVCLGIFVFHLVHYERLVY-----NGRYEYPGWAEALGWLLALSSMLCIPAVALYKLATAKGSLAQRWRHLTSP 509          
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 375.941 bits (964), Expect = 4.063e-124
Identity = 205/501 (40.92%), Postives = 307/501 (61.28%), Query Frame = 3
Query:  201 GAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGL--NKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVAS-GPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIF-IAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIE 1688
            GAFLIPY +  V GGIP+F +E+ +GQF   G I +W  I P+ KG+G+A  ++ F +  YYN I+AWA+YYL +SF   + W+ C+N WNT+ C++               PA E++   VL +  +KG+  VG ++  L+ CL   + +VYF +WKG+KTSG+V++ TAT PYV++  LLIR ATLPGA  G+ +YL P W++LL  EVWVD+  QIFFS     G L+AL SYN F++N  RD ++ S VN  TSF++GFVIF  LG+M+E   + +++V    GP L F+ YP+A+A M  ++ W++LFF M+I LG+DS F G+E  IT+  D +P   +K +   +  +  +C M     L+ +T+GG Y+ +L + +     II I +LE +++ +FYG+KRF  +++ M GFS GY   + W A++P+FL      S IV S L   +      Y FP WS+ +G+ +A S  +FVP+     IL   G + +
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTTGVAWGKHSRSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREYFVLGLVTICFMG---ALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFL------SFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVPLYMAYKILITPGTLKQ 492          
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 306.605 bits (784), Expect = 4.204e-99
Identity = 162/352 (46.02%), Postives = 226/352 (64.20%), Query Frame = 3
Query:  684 RVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFY-GIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEH 1733
            +V+YFTAT PY+++I L I   TLPG+  G+ YYL P W +L   +VW+D+GTQIFFSY+I +G L ALGSYN F++N  RD  + ++VNSGTSF AGFV+F TLGFM+   G+ I  V  SGPGLAF+ YPKA++ MP+  LW+ LFF M+ILLG+DSQFVGVEGF+T  +D+FP  +  G  +++F+ V C  +F I ++MVT GGMYVFQLFDYY  S + ++  A  EC+ + + Y G  RF  N+  M G+         W  +TP     IF+ + + Y  L Y +G     Y +P W   +GW MA S ++ +P++A   + R  G ++ER + L  P + G  H
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKG-----YVYPWWGEALGWCMALSSMLCIPVVAIYRLARTKGNLLERWRILTTP-VWGCHH 346          
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 1.239e-63
Identity = 106/240 (44.17%), Postives = 153/240 (63.75%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTD--------AFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYL 788
            R  W +K +++L+ IG +VGLGN+WRFPYL YKNGGGAFLIPY I +   G+P+F LE  +GQF + G I +W +VPL+KG+G+  V+   ++  YYN I+A+ ++YL ASF   + WS C   W   +   D        A  N ++ ++ K  P+ +YW    L  ++ ++  G +   L   LL +WIV    + KGIK+SG+V+YFTA  PYV++I LLIR ATLPGA +G+EYY+
Sbjct:    6 RGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYI 245          
BLAST of slc6a-2 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 285/553 (51.54%), Postives = 378/553 (68.35%), Query Frame = 3
Query:   87 IVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCST-----DAFKNSTNSSALKIDPAIEYWEHR---VLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKL 1718
            + R+ W+ KLDF+LA IGFSVGLGN+WRFPYLCYKNGGG FLIPY I ++L G+P+  LEV +GQFM++GGI  W I PL +GIGYASVV++  LN YY VIL WA YY+  SF   + WSHC+N WNT +C         F + +    L I      W+     VL ++ G++ +GTI   +  CLL AWIV Y C++KG+K++GRV+YFTAT PYVL+  + +R  TLPGAR G+ +YL P W RL    VW+ + TQ+FFSYSI +GTL+ALGSYN F +N  RDC++F+ VNSGTSF  GFVIF  LGFM+E+ G+PIQ V  SGPGLAF+ YP A+AEMPI+ LWS+LFF M+ILLG+DS+FVGVEGF+T+  D+FP ++ +G  K+IFIA      F IGL MVT GGMYVFQLFD Y  S I ++ I++ E + I + YG +RF +N+ +M GF +     + W   TPIF L +FI S + Y  L Y     N+ YK+P W   +GW +A S +V +P++A I ++R  G  I+R++ +  P L
Sbjct:    7 VERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMITTFNSGSKCCQLFIKSFKCLWKDAADYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTY-----NLTYKYPVWGDAIGWLLALSSIVCIPLLAVINLMRAEGDFIDRLRSVTTPCL 554          
BLAST of slc6a-2 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 495.738 bits (1275), Expect = 1.626e-169
Identity = 267/599 (44.57%), Postives = 369/599 (61.60%), Query Frame = 3
Query:   78 MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC----------------STDAFKNSTNSSAL------------------KIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPK---LKGIEHFTNESHQMK 1760
            MT   R+ W  K DFLL+CIGF+VGLGNVWRFPYLCY NGGGAFL+PY I +VL G+PMF +E+  GQ+ + G I VW  I PL +GIG+AS+V+ F++  YYNVI+AW +Y+L  SF   V W HC+N WNT  C                S ++  NST ++A                   ++ P++E+WE+ +L L+ GI   G I+  ++ CL+ AW+ VYFC+WKG+K+SG+V+YFTAT PY+++  L +R  TLPGA  G+ +YL P+W RL   +VWV + TQIF+S  I  G+LVA+GSYN FH+N  +D +  S++N GTS  AGFVIF TLGFMS     PI+ V  SGPGLAFVVYP+A+A+MPI+ LW++LFF MI+ LG+DSQF  +E  IT   D +PV     K K++FIAV C + F +G+T VT GG YV  LFDY  G   ++ +   E + + + YG  RFS+++ +M G          W    P  +  IF  S I +  + Y  GS    YK+P W+   GW +A S ++F+P  A   I +  G + ER+  LL+P    L+ IE     S +++
Sbjct:    1 MTTNERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYILRLSDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVCR---KRKELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSY--GS----YKYPQWAEFFGWVIALSSMLFIPGNAIYMIWKTPGTLRERVTFLLKPDRNILQEIERREGLSKRVE 590          
BLAST of slc6a-2 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 452.21 bits (1162), Expect = 1.468e-152
Identity = 235/554 (42.42%), Postives = 349/554 (63.00%), Query Frame = 3
Query:   69 QISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALK--IDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLK 1721
             + + G  R+KW  K++F LAC+G++VGLGNVWRFPYLC+KNGGGAFLIPY   +++ G+P+F +E+ +GQF++ G +  W  I P+ KG+G+A +VV F+   YYNVI+AW +YYL  SF   V W  C+N WNT   +T+   N T++ ALK    P+ E++E+ VL +   I+  G ++  L+ CL+ AW++VYFC+WKGIK+SG+V+YFTAT PY++++ LLIR  TLPGA  GL +YL P + +L    VWVD+ TQIF+S  I  G+L+A+GSYN FH+N  RD +  SV+N  TS  AG VIF  LGFM+E  G  +  V  SGPGLAFVVYP+ +A+MPI+  WS+ FF M++ LG+D+QF   E   T   D +   +     K++F A +C   F +GL +V+  G ++  L+ +  G   ++ +A  E + + + YG  RF+ ++  M G  +     I W  +TP  +  IFI S + +  + Y        Y++P W+  VGW MA S ++++P +A   + R  G  +ER + L +P  +
Sbjct:   30 DVEIIGEEREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNT---ATNCTSNLTDT-ALKEYSSPSKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLR--NRKELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDD------YQYPPWAEFVGWVMALSSMLWIPGVAIYKMSRAKGTFMERWRSLTRPDQE 571          
BLAST of slc6a-2 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 445.662 bits (1145), Expect = 8.507e-150
Identity = 236/572 (41.26%), Postives = 353/572 (61.71%), Query Frame = 3
Query:   90 VRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC----STDAFKNST------NSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGK-NKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNES-HQMKPV 1766
             RDKW +K +F+L+ +G+ VG GNVWRFPYLCYKNGG  FLIPYFI +++ GIP+F LE+ +GQ+ + G I VW +I PL+KGIGYA  ++ ++   YY VILAW  YYL  SF   V W  C+N WNT  C    S D   N T      N +A    P+ E+W + VL + + I + G ++  L    + +WIVVYFC++KGIK+SG+V+YFTAT P++++  L+IR ATL G+  G+ YYL P WERL   +VW+ + TQI++S  +  G L+  GSYN F++N  +D ++ S+ N  TSF AGFV+F  LGFM+      +  V  SGPGLAFV YP+A+++MP+++LW+VLFF M+I LG+DSQF  +E  IT+  D +P W+   K  K +F+ ++C+    +GL  V  GGM++F L DY +    ++I+A+LE ++I + YG+ RFS ++  M G        I W  ++P+  L I + + I +  ++Y          +P W+  +GW +  S ++ +P  A   I +  G + ERI  LL+P  + +     ++ ++  PV
Sbjct:   38 TRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTEDISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYP-WVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGK------PYPGWAELIGWMLMLSSVLMIPAFAIHEIYKRSGTLRERITFLLKPDEEALSKIMRDNGNKRAPV 602          
BLAST of slc6a-2 vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 436.032 bits (1120), Expect = 4.978e-147
Identity = 236/537 (43.95%), Postives = 350/537 (65.18%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIV-PLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIF----WGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIE 1688
            R++W NK+DFLL+CIG++VGLGNVWRFPYLCYKNGG +FLIPY + +V  GIP+F LEV +GQ+ A+G +  W +V P+M GIG+A  V+ F+ + YYNVI+AW+ YY+  ++   V W+ CNN WNT  CS     N  +     I  ++     +VL L+  +   G ++ +L  CLL AWIVVYFC+WKGIK++G+V+YFTAT PY+++  LLIR ATLPGA  G  +Y+ P + +L    VWVD+  QIFFS S+  G L+  GSYN F++N  RD ++ SV+N  TS  AGFVIF  +GFM+   G+ +++VV SGPGLAF+ YP+ + ++P +  W+ LFF M+  LG+DSQFVGVE   T  +D +       + K     + C++++ +G++ VT GG+Y+F +FDY  G   +I+IA+LE ++I +FYG++RF+RN+  M    +G+ P+I+    W  ++P+ + +IFI + + +S + Y        Y FP+W+   GW +  S +V VPI A    ++  G + E
Sbjct:    4 REQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFCSCTHAMNIPSFHENTII-SVTLSRRKVLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSYK---GARRYKAHLTLLFCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVERFARNIESM----IGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGD------YVFPAWAEFCGWLLCFSSIVCVPICAIYRCVKGKGTLAE 526          
BLAST of slc6a-2 vs. Ensembl Medaka
Match: ENSORLT00000012014.2 (sodium- and chloride-dependent taurine transporter [Source:NCBI gene;Acc:101175313])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 276/577 (47.83%), Postives = 388/577 (67.24%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWN-IVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAF-KNST-----NSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMK 1760
            +R  D+       R+KW +KLDF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQF + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ C   WNT +C  D + KN T     N+S     P  E+WEH VLG++ GIE +G +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LLIR  TLPGA  G+++YL P  +RL+  EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA+  MPI +LW++LFF M++LLG+DSQFV VEG ITS  D++P ++ KG  +++FIA++C +++  GLTMVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG+  F   + +M G+         W  +TP+  +  F  S + Y  L Y     N VY++P W+V +GWT+A + ++ +P++  I I++  GP+IERIK +  P   G      +    K
Sbjct:   28 TRPEDEAEGKHPQREKWASKLDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGVYYLFQCFQPELPWAKCKQPWNTERCIEDTYRKNKTLWVAANASNFT-SPVTEFWEHNVLGISSGIEEIGAVKWDLALCLLLVWVICFFCIWKGVKSTGKVVYITATFPFVMLIVLLIRGVTLPGAAAGIKFYLYPNLDRLMDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGALNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPIPTLWAILFFVMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREVFIAIICCLSYLFGLTMVTKGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGVDNFYDAIEDMIGYRPNPWMKWSWTVVTPLLCMGCFFFSLVKYKPLTY-----NKVYQYPDWAVGIGWTLALASMICIPMVVVIKIIQSDGPLIERIKAVAAPVRGGASSRPADHRGPK 598          
BLAST of slc6a-2 vs. Ensembl Medaka
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:101165803])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 271/575 (47.13%), Postives = 384/575 (66.78%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE 1745
            +R  D+       R+KW +KLDF+L+  G  VGLGNVWRFPYLCYKNGGGAFLIPYFI +  GG+P+F LEV +GQ+ + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CN  WNT  C  D  +         N+TN ++    P  E+WE  VL ++ GIE++G +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ +LW++LFF M++LLG+DSQFV VEG ITS  D++P  + KG  ++IFIAV+C +++ +GL MVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  FI S + Y  L Y     N VY++P W++ +GW +A + ++ +P++  I IL+  GP+IERIK +  P   G+     E
Sbjct:   32 TRPEDEAEGKAPQREKWASKLDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQYTSEGGITCWAKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWAKCNQPWNTEHCIEDTVRRNKTLWLAANATNFTS----PVTEFWERNVLSISTGIEDIGPLKWDLAVCLLVVWVICFFCIWKGVKSTGKVVYITATFPFVMLIILLVRGVTLPGAAEGIKFYLYPNLTRLQDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPMPTLWAILFFIMLLLLGLDSQFVEVEGQITSIVDLYPSVLRKGYRREIFIAVMCFISYILGLAMVTKGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDGIEDMIGYRPNPWMKWSWTFITPVLCMGCFIFSLVKYKPLTY-----NKVYEYPDWAIGLGWCLALTSMICIPMVMVIKILQSEGPLIERIKAVAAPAKSGVSSRPKE 597          
BLAST of slc6a-2 vs. Ensembl Medaka
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:101165803])

HSP 1 Score: 518.079 bits (1333), Expect = 5.580e-177
Identity = 271/607 (44.65%), Postives = 384/607 (63.26%), Query Frame = 3
Query:   54 SRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGG--------------------------------GAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVW-NIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFK---------NSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNE 1745
            +R  D+       R+KW +KLDF+L+  G  VGLGNVWRFPYLCYKNGG                                GAFLIPYFI +  GG+P+F LEV +GQ+ + GGI  W  + P+  GIGYAS+V++ +LN YY VILAW +YYL   F   + W+ CN  WNT  C  D  +         N+TN ++    P  E+WE  VL ++ GIE++G +K DL  CLL  W++ +FCIWKG+K++G+V+Y TAT P+V++I LL+R  TLPGA  G+++YL P   RL   EVW+D+GTQIFFSY+I +G + +LGSYN + +N  RDC+L   +NSGTSF++GF IF  LGFM++  G+ I +V  SGPGLAF+ YPKA++ MP+ +LW++LFF M++LLG+DSQFV VEG ITS  D++P  + KG  ++IFIAV+C +++ +GL MVT GGMYVFQLFDYY  S + ++ +A  EC+++ + YG   F   + +M G+         W  +TP+  +  FI S + Y  L Y     N VY++P W++ +GW +A + ++ +P++  I IL+  GP+IERIK +  P   G+     E
Sbjct:   28 TRPEDEAEGKAPQREKWASKLDFVLSVAGGFVGLGNVWRFPYLCYKNGGGRWDKATVFDQKKKVWTLLIHYSFIPVSLQLSGAFLIPYFIFLFGGGLPVFFLEVALGQYTSEGGITCWAKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWAKCNQPWNTEHCIEDTVRRNKTLWLAANATNFTS----PVTEFWERNVLSISTGIEDIGPLKWDLAVCLLVVWVICFFCIWKGVKSTGKVVYITATFPFVMLIILLVRGVTLPGAAEGIKFYLYPNLTRLQDPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSGTSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVSMMPMPTLWAILFFIMLLLLGLDSQFVEVEGQITSIVDLYPSVLRKGYRREIFIAVMCFISYILGLAMVTKGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDGIEDMIGYRPNPWMKWSWTFITPVLCMGCFIFSLVKYKPLTY-----NKVYEYPDWAIGLGWCLALTSMICIPMVMVIKILQSEGPLIERIKAVAAPAKSGVSSRPKE 625          
BLAST of slc6a-2 vs. Ensembl Medaka
Match: slc6a8 (solute carrier family 6 member 8 [Source:NCBI gene;Acc:101160051])

HSP 1 Score: 510.76 bits (1314), Expect = 5.096e-174
Identity = 262/574 (45.64%), Postives = 370/574 (64.46%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC--------------STDAFKNSTNSSALKID---PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMK 1760
            R+ W  ++DF+++C+GF+VGLGNVWRFPYLCYKNGGG FLIPY + V++GGIP+F LE+ +GQFM  G I VWNI PL KG+G+AS+V++F  N YY ++LAW  YYL+ SF+  + WS C+N WNT  C              +     NS  + A  +D   P IE+WE++VL ++ G++  G +  +LM CL+A W++VYFC+WKG+K++G+++YFTAT PYV++I LL+R  TLPGA  G+ YY+ P W +L   +VW+D+GTQIFFSY+I +G L ALGSYN F+++  +D  + +++NSGTSF AGFV+F  LGFM+   G+ I  V  SGPGLAF+ YPKA++ MP+  LW+ LFF M++LLG+DSQFVGVEGF+T   D+ P        ++I +A+ CL+ F I L+MVT GGMYVFQLFDYY  S + ++  A  EC+ + + YG  RF  ++  M G+         W  +TP   + IF+   + Y  L Y     N VY +P W   +GW +A S ++ +P      + R  G   ER   L  P + G  H    +  +K
Sbjct:   67 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLIVIVGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGFASMVIVFFCNTYYIMVLAWGFYYLIKSFSSTLPWSTCDNEWNTPSCIEIFHHQDCKNASLANTTVGNSNMTCADLVDARSPIIEFWENKVLNISSGLDEPGKLNWELMLCLMAVWVLVYFCVWKGVKSTGKIVYFTATFPYVVLIILLVRGVTLPGAYDGIMYYIKPDWSKLEEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNDCYKDAFVLALINSGTSFFAGFVVFSILGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFVTGILDLIPGNHYHRYKREIAVAICCLLCFIIDLSMVTQGGMYVFQLFDYYSASGMTLLWQAFWECIVVAWVYGADRFMDDVARMIGYRPFPWMKWCWSFITPCVCIGIFLFHLVNYKPLTY-----NNVYVYPWWGEVIGWCLALSSMLCIPTTVLYKLFRARGTFKERWAHLTSP-VWGAHHLEYMAPDVK 634          
BLAST of slc6a-2 vs. Ensembl Medaka
Match: slc6a8 (solute carrier family 6 member 8 [Source:NCBI gene;Acc:101160051])

HSP 1 Score: 510.76 bits (1314), Expect = 8.171e-174
Identity = 262/574 (45.64%), Postives = 370/574 (64.46%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQC--------------STDAFKNSTNSSALKID---PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXX-XAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMK 1760
            R+ W  ++DF+++C+GF+VGLGNVWRFPYLCYKNGGG FLIPY + V++GGIP+F LE+ +GQFM  G I VWNI PL KG+G+AS+V++F  N YY ++LAW  YYL+ SF+  + WS C+N WNT  C              +     NS  + A  +D   P IE+WE++VL ++ G++  G +  +LM CL+A W++VYFC+WKG+K++G+++YFTAT PYV++I LL+R  TLPGA  G+ YY+ P W +L   +VW+D+GTQIFFSY+I +G L ALGSYN F+++  +D  + +++NSGTSF AGFV+F  LGFM+   G+ I  V  SGPGLAF+ YPKA++ MP+  LW+ LFF M++LLG+DSQFVGVEGF+T   D+ P        ++I +A+ CL+ F I L+MVT GGMYVFQLFDYY  S + ++  A  EC+ + + YG  RF  ++  M G+         W  +TP   + IF+   + Y  L Y     N VY +P W   +GW +A S ++ +P      + R  G   ER   L  P + G  H    +  +K
Sbjct:   67 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLIVIVGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGFASMVIVFFCNTYYIMVLAWGFYYLIKSFSSTLPWSTCDNEWNTPSCIEIFHHQDCKNASLANTTVGNSNMTCADLVDARSPIIEFWENKVLNISSGLDEPGKLNWELMLCLMAVWVLVYFCVWKGVKSTGKIVYFTATFPYVVLIILLVRGVTLPGAYDGIMYYIKPDWSKLEEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNDCYKDAFVLALINSGTSFFAGFVVFSILGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFVTGILDLIPGNHYHRYKREIAVAICCLLCFIIDLSMVTQGGMYVFQLFDYYSASGMTLLWQAFWECIVVAWVYGADRFMDDVARMIGYRPFPWMKWCWSFITPCVCIGIFLFHLVNYKPLTY-----NNVYVYPWWGEVIGWCLALSSMLCIPTTVLYKLFRARGTFKERWAHLTSP-VWGAHHLEYMAPDVK 634          
BLAST of slc6a-2 vs. Planmine SMEST
Match: SMESG000009904.1 (SMESG000009904.1)

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 561/563 (99.64%), Postives = 562/563 (99.82%), Query Frame = 3
Query:   78 MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQMKPV 1766
            MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMN GKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRIIIIIAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERI+KLLQPKLKGIEHFTNESHQMKPV
Sbjct:    1 MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALKIDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNIGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRIIIIIAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIQKLLQPKLKGIEHFTNESHQMKPV 563          
BLAST of slc6a-2 vs. Planmine SMEST
Match: SMESG000018924.1 (SMESG000018924.1)

HSP 1 Score: 454.136 bits (1167), Expect = 1.021e-152
Identity = 240/584 (41.10%), Postives = 365/584 (62.50%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNY-PVSWSHCNNAWNTLQCSTDA-----FKNSTN---SSALKID-------------PAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVL-ECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVP------IIACIGILREGGPIIERIKKLLQPKLKGIEHFTNESHQM 1757
            R++W +K+DF+L+ IG  VGLGN+WRFPYLCY+NGGGAFLIPY +++V  G+P+  LE+ +GQ  + GG+ VW    + KG+GYA+V++ F L+ YY VILA+A  Y+  SF   P+ WS CN+ WNT  C++D        NS N    S +K++             P +E+WE  VLG + GIE  G+I+  L   LL AWI+ YFCIWKG+K +G+++YFTA  PYVL++ L IR  TL G+  G+++YL P   +L   +VW+D  TQIFFSY + +GT +ALGSYN + +N  RD ++  VVN+ TS  AGFV+F  +GFM+ +    +++VV SG GL F+VYP ALA++P ++ WS+LFF MII LG+DSQF  +EGF+T+  D +P      +++++ + VVC +++ IGL+MVT GG YVF+LFD+Y  S + ++  +  +C++  + YGI RF ++ N+M GFS+       W   +P+  + + I S + Y  ++YK        ++ +W+  +G  +A S ++ +P          I   +    I+E ++ + QP  + I     E+ QM
Sbjct:   27 REQWSSKVDFVLSAIGLCVGLGNIWRFPYLCYENGGGAFLIPYLLTLVFAGVPILLLELMIGQMKSIGGLGVWKYCLVFKGVGYAAVIMAFWLSIYYIVILAYAFVYMFNSFTLNPLPWSDCNHPWNTQCCNSDNNVTALCNNSDNGILDSKMKMNFSHLCTECKAWNSPVLEFWERFVLGESSGIETPGSIQWQLALALLFAWILCYFCIWKGVKWTGKIVYFTALFPYVLLLCLFIRGMTLTGSAEGIKFYLKPNISKLKESKVWLDGATQIFFSYGLGLGTHIALGSYNKYKNNCHRDALIIGVVNASTSLFAGFVVFSVMGFMAHQQNKEVKDVVKSGQGLIFLVYPSALAQLPGSAFWSILFFLMIIFLGLDSQFCTLEGFLTAIIDEWP--HKFRQHRKLLLFVVCGVSYLIGLSMVTQGGAYVFRLFDHYSASGMALLFLIFCQCIAFSWCYGINRFIKDCNKMLGFSISKWWKFCWLIFSPLVCMFVLIFSVLSYEHVKYKDK------EYATWAHAIGIFLALSSVIMIPGYIFYYTFQQIISHKNEKSILEILRDVFQPTNEDITD-KKENIQM 601          
BLAST of slc6a-2 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 442.58 bits (1137), Expect = 2.103e-148
Identity = 230/539 (42.67%), Postives = 340/539 (63.08%), Query Frame = 3
Query:   48 SISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST--NSSALKIDPAIEY-------WEHRVLGLNKGIENV-------GTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMA 1616
             IS +  Q   T   R  W  + DF L+C+G++VGLGN+WRFP+LCY +GGGAFL+PYFI +++ GIP+F  E+ +GQF + G I +W + P+ KGIGY+ ++V  +++ YYNVI+AW++YYL ASF   + WS CNNAWN  +C TD F+N T  N S L     IEY       W+  VLG+     N+       G ++  L  CLL AWI+   C+ KG+K+SG+V+YFTA  PYV++I +++    L G+++G++YYLIPKW++LL+++VW D+ TQIF+S  +A G L+ + SYN F++N  RD +L SV+N  TSFLAGF IF  LG+M+ +TG  I+    SG GLAFV Y ++L+ M +  LWS+LFF M++ LGIDSQF G+E   T   D FP+          F   V ++ F +G+T V+ GG+Y+F + D Y G+  + IIA+ E ++I Y YG+K F +++  M GF  GY     W  +TP+ ++ I I+S + ++  ++        Y  P W+  +G+ M 
Sbjct:   13 QISEVDSQTPKT-TGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTD-FRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGN------YILPVWANVLGYLMT 543          
BLAST of slc6a-2 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 442.58 bits (1137), Expect = 2.418e-148
Identity = 230/538 (42.75%), Postives = 340/538 (63.20%), Query Frame = 3
Query:   51 ISRIPDQISMTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNST--NSSALKIDPAIEY-------WEHRVLGLNKGIENV-------GTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMA 1616
            IS +  Q   T   R  W  + DF L+C+G++VGLGN+WRFP+LCY +GGGAFL+PYFI +++ GIP+F  E+ +GQF + G I +W + P+ KGIGY+ ++V  +++ YYNVI+AW++YYL ASF   + WS CNNAWN  +C TD F+N T  N S L     IEY       W+  VLG+     N+       G ++  L  CLL AWI+   C+ KG+K+SG+V+YFTA  PYV++I +++    L G+++G++YYLIPKW++LL+++VW D+ TQIF+S  +A G L+ + SYN F++N  RD +L SV+N  TSFLAGF IF  LG+M+ +TG  I+    SG GLAFV Y ++L+ M +  LWS+LFF M++ LGIDSQF G+E   T   D FP+          F   V ++ F +G+T V+ GG+Y+F + D Y G+  + IIA+ E ++I Y YG+K F +++  M GF  GY     W  +TP+ ++ I I+S + ++  ++        Y  P W+  +G+ M 
Sbjct:   15 ISEVDSQTPKT-TGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTD-FRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGN------YILPVWANVLGYLMT 544          
BLAST of slc6a-2 vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 426.402 bits (1095), Expect = 4.640e-142
Identity = 246/576 (42.71%), Postives = 353/576 (61.28%), Query Frame = 3
Query:   93 RDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFISVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNCYYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTN--------SSALKIDPAIE-YWEHRVLGL------NKGIEN-VGTIKLDLMFCLLAAWIVVYFCIWKGIKTSGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVWVDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAGFVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLFFAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFGIGLTMVTHGGMYVFQLFDYYIGSRXXXXXAVLECLSICYFYGIKRFSRNLNEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYKFPSWSVKVGWTMANSCLVFVPIIACIGILREG---------GPIIER-----IKKLLQPKLKGIE 1730
            R  W +K+DF L+C+G++VGLGN+WRFP+LCYKNGGGAFLIPYF  +++ GIP+F  E+ +GQF + G + VW I P+ KGIG+A +V+  + + YYNVI+AW++YYL ASF   + WS CNN WN   C  D FKN TN        ++  K + A E YW+  VLG+       + +E  +GT++  L  CLL AWI+    + KG+K+SG+V+YFTA  PY +++ ++I    L G+  G++YYLIPKW +LL   VW D+ TQIF+S  +A G L+ + SYN F++N  RD ++ S++N  TSF+AGF IF  LG+MS +TG  +     SG GLAFV Y + +A MP + +WS+LFF M++ LGIDSQF G+E   T F D FP+      +   F  +  ++ F +GL  V+ GG+Y+F L D Y GS  +IIIA LE   I + YG+K FS+++  M  F  GY   I W  LTPI ++ I I+S I ++   Y    + V+   P W+ ++G  +A S +  VPI      + +G         GP +E+     I+   + KLK IE
Sbjct:   25 RGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLND-FKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTGRSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMFTLMDEYCGSFSLIIIAFLELTIISFIYGVKNFSQDIEMMLKFKPGYYWIICWTFLTPIIIIFILIVSIIQHAPSSY----NGVL--LPKWANQLGGVIAASSISAVPIYFFYHAIFKGFTFKPNEEWGPGVEKFWRDDIRYSSKLKLKEIE 593          
The following BLAST results are available for this feature:
BLAST of slc6a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A68.713e-17748.48solute carrier family 6 member 6 [Source:HGNC Symb... [more]
SLC6A67.220e-17648.48solute carrier family 6 member 6 [Source:HGNC Symb... [more]
SLC6A131.767e-17446.15solute carrier family 6 member 13 [Source:HGNC Sym... [more]
SLC6A124.338e-17347.90solute carrier family 6 member 12 [Source:HGNC Sym... [more]
SLC6A124.338e-17347.90solute carrier family 6 member 12 [Source:HGNC Sym... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snf-112.237e-14841.16Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
mod-51.620e-14039.96Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
dat-13.200e-13740.71Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-31.287e-13138.94Sodium- and chloride-dependent betaine transporter... [more]
snf-62.725e-9131.18Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gat5.129e-16343.57gene:FBgn0039915 transcript:FBtr0089972[more]
DAT1.494e-15441.45gene:FBgn0034136 transcript:FBtr0087125[more]
DAT1.652e-15441.45gene:FBgn0034136 transcript:FBtr0330002[more]
ine3.178e-14539.83gene:FBgn0011603 transcript:FBtr0077447[more]
Gat4.179e-14347.49gene:FBgn0039915 transcript:FBtr0089971[more]
back to top
BLAST of slc6a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a6a0.000e+046.96solute carrier family 6 member 6a [Source:ZFIN;Acc... [more]
slc6a6b0.000e+048.74solute carrier family 6 member 6b [Source:ZFIN;Acc... [more]
slc6a85.536e-18047.12solute carrier family 6 member 8 [Source:ZFIN;Acc:... [more]
SLC6A131.319e-17646.71solute carrier family 6 member 13 [Source:NCBI gen... [more]
slc6a1b3.461e-17345.00solute carrier family 6 member 1b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilf30.000e+047.42interleukin enhancer binding factor 3 [Source:Xenb... [more]
ilf30.000e+047.42interleukin enhancer binding factor 3 [Source:Xenb... [more]
ilf30.000e+047.42interleukin enhancer binding factor 3 [Source:Xenb... [more]
ilf30.000e+047.17interleukin enhancer binding factor 3 [Source:Xenb... [more]
ilf30.000e+048.56interleukin enhancer binding factor 3 [Source:Xenb... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a62.718e-17848.48solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a133.134e-17645.68solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a13.957e-17145.49solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a121.056e-16947.35solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a121.292e-16947.35solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31643|SC6A6_RAT3.208e-17848.84Sodium- and chloride-dependent taurine transporter... [more]
sp|Q9MZ34|SC6A6_BOVIN6.018e-17848.07Sodium- and chloride-dependent taurine transporter... [more]
sp|O35316|SC6A6_MOUSE1.901e-17748.48Sodium- and chloride-dependent taurine transporter... [more]
sp|P31646|S6A13_RAT2.735e-17746.89Sodium- and chloride-dependent GABA transporter 2 ... [more]
sp|Q91502|SC6A8_TORMA6.678e-17745.57Creatine transporter OS=Torpedo marmorata OX=7788 ... [more]
back to top
BLAST of slc6a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF470.000e+0100.00Transporter OS=Schmidtea mediterranea OX=79327 GN=... [more]
R7T9210.000e+056.63Transporter OS=Capitella teleta OX=283909 GN=CAPTE... [more]
A0A1S3HJP50.000e+056.97Transporter OS=Lingula unguis OX=7574 GN=LOC106155... [more]
V4AWT50.000e+054.95Transporter OS=Lottia gigantea OX=225164 GN=LOTGID... [more]
R7V1880.000e+055.95Transporter OS=Capitella teleta OX=283909 GN=CAPTE... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a6b0.000e+047.11solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a6b0.000e+047.11solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a6b0.000e+047.11solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a6a0.000e+046.24sodium- and chloride-dependent taurine transporter... [more]
slc6a6a0.000e+046.24sodium- and chloride-dependent taurine transporter... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a2.072e-16545.77solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.11.272e-12841.70pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
slc6a4b4.063e-12440.92solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000004857.14.204e-9946.02pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
ENSPMAT00000001684.11.239e-6344.17pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
back to top
BLAST of slc6a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO323560.000e+051.54Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO315451.626e-16944.57Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO492181.468e-15242.42Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO397078.507e-15041.26Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO397084.978e-14743.95Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
back to top
BLAST of slc6a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012014.20.000e+047.83sodium- and chloride-dependent taurine transporter... [more]
slc6a6b0.000e+047.13solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a6b5.580e-17744.65solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a85.096e-17445.64solute carrier family 6 member 8 [Source:NCBI gene... [more]
slc6a88.171e-17445.64solute carrier family 6 member 8 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009904.10.000e+099.64SMESG000009904.1[more]
SMESG000018924.11.021e-15241.10SMESG000018924.1[more]
SMESG000042091.12.103e-14842.67SMESG000042091.1[more]
SMESG000042091.12.418e-14842.75SMESG000042091.1[more]
SMESG000042051.14.640e-14242.71SMESG000042051.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007903
GenBankAKN21422.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007903 ID=SMED30007903|Name=slc6a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1891bp
GATCTCTTCAGTAAAACAATTTCATAGTTATCGAAATTCATATCGTTTCA
ATTTCTCGAATTCCAGATCAAATCTCAATGACAGGTATCGTTAGAGATAA
ATGGCTTAATAAGTTGGACTTCCTTCTTGCATGTATCGGATTTTCTGTTG
GTCTTGGAAATGTTTGGAGATTCCCATATCTATGCTATAAAAATGGCGGA
GGTGCATTTTTGATACCGTATTTTATCAGTGTGGTACTCGGTGGAATACC
TATGTTTTGCTTGGAGGTCTTTGTCGGTCAGTTCATGGCTAGAGGGGGCA
TTGAAGTTTGGAATATTGTTCCATTAATGAAAGGTATTGGATATGCCAGT
GTAGTTGTTTTATTTATGCTTAACTGTTATTATAATGTCATTTTGGCCTG
GGCCATTTATTATTTGGTGGCATCTTTTAACTATCCCGTCAGTTGGTCTC
ACTGTAATAATGCATGGAACACGCTCCAATGCTCTACGGATGCATTCAAA
AATTCTACCAACTCATCGGCATTGAAAATCGATCCAGCAATAGAATATTG
GGAGCATCGAGTTTTGGGACTGAATAAAGGAATTGAAAATGTGGGAACAA
TAAAATTAGACTTAATGTTCTGCTTGCTAGCTGCATGGATAGTCGTCTAC
TTCTGCATCTGGAAAGGCATCAAAACTTCTGGAAGAGTCATGTATTTTAC
TGCTACGAGTCCATATGTTTTGATGATAACTCTGCTAATACGGGTTGCCA
CTCTTCCTGGAGCCCGAATGGGTCTCGAATATTATTTGATTCCAAAATGG
GAAAGATTGCTGGCAATGGAAGTTTGGGTAGATTCTGGTACTCAAATATT
CTTTAGCTATTCAATCGCCATCGGGACTCTAGTGGCTTTGGGCAGTTACA
ATGATTTTCACCATAATTCGGTTAGAGACTGCGTCCTGTTTTCAGTAGTC
AACAGTGGAACCAGTTTTCTGGCGGGGTTTGTGATATTTATGACATTGGG
ATTCATGTCTGAACGAACTGGAATTCCAATTCAAAATGTGGTAGCAAGTG
GACCGGGATTAGCATTTGTCGTCTACCCAAAGGCCTTAGCAGAGATGCCC
ATAACTTCTCTTTGGTCAGTGTTGTTTTTCGCAATGATAATCCTTTTAGG
AATCGACAGTCAATTCGTCGGTGTTGAAGGATTCATTACCTCATTTAATG
ACATTTTTCCAGTTTGGATGAATAAAGGGAAAAATAAACAAATTTTTATC
GCAGTTGTTTGTTTAATGAACTTTGGAATTGGTTTAACTATGGTGACACA
TGGAGGAATGTATGTATTTCAATTGTTTGATTACTATATAGGAAGCAGGA
TAATAATAATTATTGCAGTTTTGGAATGCTTATCCATTTGCTATTTCTAT
GGAATCAAACGGTTTTCAAGAAACCTCAACGAGATGTTTGGATTTAGCCT
TGGATACATTCCGCACATATTCTGGGGAGCATTGACTCCGATATTTTTAC
TCATCATATTTATAATGAGTACAATCGTTTATTCTGAGCTGGAGTACAAA
CGGGGATCAGACAATGTCGTGTACAAATTTCCTAGTTGGTCCGTCAAAGT
TGGCTGGACGATGGCAAATTCTTGTTTGGTCTTTGTCCCCATCATAGCAT
GCATTGGAATTTTAAGAGAAGGTGGACCAATTATTGAGAGAATTAAAAAG
CTTTTGCAACCGAAATTGAAGGGCATCGAGCATTTCACCAATGAAAGCCA
CCAGATGAAGCCGGTTTAGGAATTCTATATTACAGATACACTAAATGTAT
ATAGAATATATAAGCAAATATTAAAACAACATAATAAAATGCTCTTGTTT
TTGTTTAAATATGTTGAATTATTACTAATAAATAATTATTT
back to top

protein sequence of SMED30007903-orf-1

>SMED30007903-orf-1 ID=SMED30007903-orf-1|Name=SMED30007903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=564bp
MTGIVRDKWLNKLDFLLACIGFSVGLGNVWRFPYLCYKNGGGAFLIPYFI
SVVLGGIPMFCLEVFVGQFMARGGIEVWNIVPLMKGIGYASVVVLFMLNC
YYNVILAWAIYYLVASFNYPVSWSHCNNAWNTLQCSTDAFKNSTNSSALK
IDPAIEYWEHRVLGLNKGIENVGTIKLDLMFCLLAAWIVVYFCIWKGIKT
SGRVMYFTATSPYVLMITLLIRVATLPGARMGLEYYLIPKWERLLAMEVW
VDSGTQIFFSYSIAIGTLVALGSYNDFHHNSVRDCVLFSVVNSGTSFLAG
FVIFMTLGFMSERTGIPIQNVVASGPGLAFVVYPKALAEMPITSLWSVLF
FAMIILLGIDSQFVGVEGFITSFNDIFPVWMNKGKNKQIFIAVVCLMNFG
IGLTMVTHGGMYVFQLFDYYIGSRIIIIIAVLECLSICYFYGIKRFSRNL
NEMFGFSLGYIPHIFWGALTPIFLLIIFIMSTIVYSELEYKRGSDNVVYK
FPSWSVKVGWTMANSCLVFVPIIACIGILREGGPIIERIKKLLQPKLKGI
EHFTNESHQMKPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 86..112
score: 52.94
coord: 43..62
score: 52.7
coord: 340..359
score: 51.8
coord: 204..221
score: 52.37
coord: 14..35
score: 71.76
coord: 423..443
score: 26.93
coord: 286..306
score: 48.56
coord: 463..483
score: 30.13
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 6..528
e-value: 1.6E-194
score: 647.5
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 6..537
IPR000175Sodium:neurotransmitter symporterPROSITEPS00610NA_NEUROTRAN_SYMP_1coord: 30..44
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 5..533
score: 97.776
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 6..527
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 508..530
NoneNo IPR availableTMHMMTMhelixcoord: 464..486
NoneNo IPR availableTMHMMTMhelixcoord: 257..274
NoneNo IPR availableTMHMMTMhelixcoord: 88..110
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 337..359
NoneNo IPR availableTMHMMTMhelixcoord: 173..195