Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30007895
Length (bp)4525
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30007895) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30007895) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30007895) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30007895) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007895

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30007895SMESG000080647.1 SMESG000010878.1 SMESG000010854.1 SmedASXL_002118SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30007895 SmedASXL_048852SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007895SMESG000079579.1 Contig53462uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007895SMESG000079579.1 Contig53462newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30007895SMESG000010878.1 SMESG000010854.1 HO007009ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007895SMESG000010878.1 SMESG000010854.1 HO007009ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30007895SMESG000010878.1 SMESG000010854.1 HO007009ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30007895 DN315983ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007895 DN315983ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30007895 DN315983ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 516.153 bits (1328), Expect = 1.012e-170
Identity = 246/314 (78.34%), Postives = 275/314 (87.58%), Query Frame = -3
Query: 1596 KNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2537
            +NPNY LK TL GHT+ VSSVKFSPNG+WLASSS+D+LI IWGAYDGK EKT+ GH L               + DVAWS+DS  L SASDDKTLK+WD+ SGKC+KTLKGH+NYVFCCNFNP SNLI+SGSFDE+VKIW+VK+GKCLKTL AH+DPV+AVHFN  GSLIVS SYDGLCRIWDA+SGQCLKTL+DDDNPPVSFVKFSPNGKYILT +LDN LKLWDY++G+CLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+ +CHPTEN+IASAALENDKTIKLW
Sbjct:   27 ENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNL--------------EISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326          

HSP 2 Score: 91.2781 bits (225), Expect = 7.835e-19
Identity = 65/193 (33.68%), Postives = 104/193 (53.89%), Query Frame = -3
Query: 1596 NPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2174
            + ++ L +S S ++S ++ +  +     TL  H + V++V F+ +G  + SSS D L  IW A  G+  KTL    N  +S V +S +   +++ S D  LKLWD   GKCLKT  GH N  +C   NF+  S   I+SGS D  V IW ++T + ++ L  H+D V A   + + ++I S +   D   ++W
Sbjct:    8 DAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLY-GHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCC--NFNPPSN-LIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSY--DGLCRIW 194          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK1 (doublecortin like kinase 1 [Source:HGNC Symbol;Acc:HGNC:2700])

HSP 1 Score: 172.17 bits (435), Expect = 2.338e-45
Identity = 92/266 (34.59%), Postives = 149/266 (56.02%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            I +RY++  +IG G+ + V    ++S     A+KII+K+    K   I +E+SIL+ + H NI+ L++ +D    L L+ +L   GDLF  +      TE   + ++ ++ SA+ YLH   IVHR++K EN++V++        KL DF L+  +  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF     D+  + D+I      FP  +W ++S+ +KELI M+L  +   R SA  +L + WV  +G
Sbjct:   79 ITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDG 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK1 (doublecortin like kinase 1 [Source:HGNC Symbol;Acc:HGNC:2700])

HSP 1 Score: 171.4 bits (433), Expect = 3.452e-45
Identity = 92/266 (34.59%), Postives = 149/266 (56.02%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            I +RY++  +IG G+ + V    ++S     A+KII+K+    K   I +E+SIL+ + H NI+ L++ +D    L L+ +L   GDLF  +      TE   + ++ ++ SA+ YLH   IVHR++K EN++V++        KL DF L+  +  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF     D+  + D+I      FP  +W ++S+ +KELI M+L  +   R SA  +L + WV  +G
Sbjct:   79 ITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDG 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:8574])

HSP 1 Score: 169.859 bits (429), Expect = 7.177e-45
Identity = 100/331 (30.21%), Postives = 164/331 (49.55%), Query Frame = -3
Query: 1596 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDN--------PPVSFVKFSPN-----------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2531
            P    K+ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD    +CI+T+ GH + V      P  + IVS S D+++K+W+V++G C+KT   H + V  V  N+DG+LI S S D   R+W  ++ +C   L + ++        P  S+   S             G ++L+GS D  +K+WD + G CL T VGH N    +  +   + GK+I+S ++D  + +W+ + K  ++ L  H   V +   H T   + + ++  D+T+K+W
Sbjct:   96 PRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGH--------------TDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFH---SGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSV--DQTVKVW 407          

HSP 2 Score: 128.257 bits (321), Expect = 9.255e-31
Identity = 76/237 (32.07%), Postives = 124/237 (52.32%), Query Frame = -3
Query: 1860 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSN--------------------LIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWD 2510
            T+ GH   VSSV   PNGD + S+S DK IK+W    G   KT +GH+              + V  V  + D   + S S+D+T+++W +A+ +C   L+ H + V C ++ P+S+                     ++SGS D+++K+WDV +G CL TL  H + V  V F+  G  I+S + D   R+WD  + +C+KTL   ++  V+ + F     Y++TGS+D  +K+W+
Sbjct:  187 TMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHR--------------EWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHF-VTSLDFHKTAPYVVTGSVDQTVKVWE 408          

HSP 3 Score: 71.2478 bits (173), Expect = 5.176e-12
Identity = 42/127 (33.07%), Postives = 69/127 (54.33%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+GV    + +  K + S +DDKTL++WD  + +C+KTL  H ++V   +F+  +  +V+GS D++VK+W+ +
Sbjct:  298 GSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH---------DNW--VRGVL---FHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 431.795 bits (1109), Expect = 1.023e-138
Identity = 203/314 (64.65%), Postives = 247/314 (78.66%), Query Frame = -3
Query: 1587 NYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2528
            NY L  TL GHTK +SS KFSP G +L +SS+DK +KIW       E+T++GHKL              GV D+AWS+DS+ + SASDDKTLKI+++ + +  KTLKGH NYVFCCNFNPQS+L+VSGSFDESV+IWDVK+G C+KTLPAH+DPV+AV FNRDGSLI S SYDGL RIWD ++GQC+KTL+DD+NPPV+FVKFSPNGKYIL  +LD+ LKLWD++KGK LK Y GH+N KYCIF+NFSVT GKWI+SGSED  +YIWNLQT+EIVQ L GHT  V+A+ CHP +NIIAS ALE D  I +WR +
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKL--------------GVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIWRSD 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 431.795 bits (1109), Expect = 1.023e-138
Identity = 203/314 (64.65%), Postives = 247/314 (78.66%), Query Frame = -3
Query: 1587 NYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2528
            NY L  TL GHTK +SS KFSP G +L +SS+DK +KIW       E+T++GHKL              GV D+AWS+DS+ + SASDDKTLKI+++ + +  KTLKGH NYVFCCNFNPQS+L+VSGSFDESV+IWDVK+G C+KTLPAH+DPV+AV FNRDGSLI S SYDGL RIWD ++GQC+KTL+DD+NPPV+FVKFSPNGKYIL  +LD+ LKLWD++KGK LK Y GH+N KYCIF+NFSVT GKWI+SGSED  +YIWNLQT+EIVQ L GHT  V+A+ CHP +NIIAS ALE D  I +WR +
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKL--------------GVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIWRSD 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 370.163 bits (949), Expect = 1.166e-115
Identity = 174/317 (54.89%), Postives = 231/317 (72.87%), Query Frame = -3
Query: 1584 PNYTLKFTLA-GHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGEN 2531
            P Y L   +   H K +S +KFSP+G ++ S S+D  IKIW   D   EKT+ GH+L              G+ + +WS+DSK + S SDDK +K++D++SG+C+KTLKGHTNYVFCC FNP   LI SGSFDE+++IW  ++G  + ++P H DPV++V FNRDG+ + S SYDG+ RIWD+++G C+KTLID+++PP++ VKFSPNGKYIL  +L+N LKLWDY K + LK Y GH+N KYC+ +NFSVT GKWIVSGSED+ VYIWNLQT+EI+Q L GH   V+ T CHP +NIIASAALE D  IK+WR ++
Sbjct:   94 PTYKLVAEIPNAHKKSISGIKFSPDGRYMGSGSADCSIKIW-RMDFVYEKTLMGHRL--------------GINEFSWSSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKGHTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKLRVLKEYTGHENSKYCVAANFSVTGGKWIVSGSEDHKVYIWNLQTREILQTLDGHNTAVMCTDCHPGQNIIASAALEPDMRIKIWRSQS 395          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 362.459 bits (929), Expect = 2.000e-111
Identity = 167/315 (53.02%), Postives = 230/315 (73.02%), Query Frame = -3
Query: 1593 KNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWR 2537
            +N  ++L  T++GHTK VS +KFS  G +L + S+DK IK+W   D    +T++ H+L              G+ D +WS++S+ + SASDD T+KI+D+ SG C++T++GHTNYVFCC+FNPQS+LI S  FDE+V++WD K+G C+K +PAH+DP+T++ +N DG+ + +SSYDG  R+WDA+SG CLKTL+D D+ PV+FV FSPNGKY+L+  LD+ LKLWD  K K LK Y GHKN+KYC+F+N SV  GK I+SGSED  + +W++QTK+IVQ L GHT  V+AT  HPT NIIAS  LE D  I++WR
Sbjct:  199 ENGEFSLVKTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTLASHQL--------------GINDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYDGCIRVWDAASGSCLKTLVDTDHAPVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPLKYYNGHKNKKYCLFANMSVPLGKHIISGSEDGRILVWSIQTKQIVQILEGHTTPVLATDSHPTLNIIASGGLEPDNVIRIWR 499          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 166.777 bits (421), Expect = 7.256e-45
Identity = 89/278 (32.01%), Postives = 155/278 (55.76%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGG-LVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLS-IKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRV 1302
            I ++Y+  + +G G+ SKV+  + KS+ G + A+K I K  +  K ES+ +E+ +L+ L H NI++L D  D  + + L+ +L T G+LF  +  +GS TE   +++I  +  A+ ++H N +VHR++K EN++ +          ++DF LS  +    +   CG+  Y++PE+ + K Y   VD+WS+GV+ YILL G PPFY  +     +  +I   +Y F   +W  +S+ +K+ I  L+  +P  R +  D L + W+  N   T   +G V
Sbjct:   18 IREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKI-MISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFY--DESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTV 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 540.421 bits (1391), Expect = 9.210e-180
Identity = 257/315 (81.59%), Postives = 284/315 (90.16%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VS+VKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS+ L S SDDKTLK+W+L++GK +KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDV++GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQ+KE+VQKL GHTD V+ T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   60 PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 540.421 bits (1391), Expect = 9.210e-180
Identity = 257/315 (81.59%), Postives = 284/315 (90.16%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VS+VKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS+ L S SDDKTLK+W+L++GK +KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDV++GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQ+KE+VQKL GHTD V+ T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   60 PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG10931 (gene:FBgn0034274 transcript:FBtr0089545)

HSP 1 Score: 345.51 bits (885), Expect = 2.878e-107
Identity = 164/330 (49.70%), Postives = 230/330 (69.70%), Query Frame = -3
Query: 1593 F*LQIF*NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWR 2582
            F + +  +   + +  +P Y +K +L GH+  V+ +KFS NG+ L SSS D+L+K+W     +  ++++GH                GV DVAWS  +  + S SDD T+++WD  S  C+K L+GH+ Y F C FNPQ+NL+ S SFDE+V++WDV++GK LK + AH DP+T+V F+RDG++ V+SSYDGL R+WD+S+G  LKTL+D DN PV +VKFSPNG+YIL+ +L+N L+LW+Y K KC++TY GH NE YC  SNFS T G WIVSGSEDN + IWNLQT+E+VQK+    D +++T CHPT N+IAS AL+N   IK+W+
Sbjct:   27 FKMPMLPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHG--------------DGVNDVAWSA-AGLIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNSYAIKIWK 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 157.532 bits (397), Expect = 4.345e-41
Identity = 100/319 (31.35%), Postives = 167/319 (52.35%), Query Frame = 1
Query:  388 IPHQAKSKNEKKALIDKYKLISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDK-SNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVF------KISYWRVFSKLADFSLS-IKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIK 1320
            +P   K  + KKA   K K +  + K   I ++Y +H  +G G+ S+V   + K S G   A+KII K  +  K ES+ +E+ +L+ L H NI++L++  +   ++ L+ +L T G+LF  + E+GS TE   + +I  I  A+ Y+H+  +VHR++K EN++ +      KI        ++DF LS ++    +   CG+  Y++PE+   K Y   VD+WS+GV+ YILL G PPFY  N     +  +I   D+ F   +W  +S  +K  I  L+      R +    L + W+  N   +   +G V E++ K
Sbjct:    1 MPLFGKKDSGKKA---KAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKI-------MISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDEN--DANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKK 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 161.77 bits (408), Expect = 2.591e-40
Identity = 86/266 (32.33%), Postives = 148/266 (55.64%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFS-KLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVAN 1269
            I   Y +   IG G+ + V+  + +  G   A+KII KN    K   I  E+ ++K L+H +II L+  +D +  + L+ +  + GDLF  + +    +EN +  +I  +G+A+ YLH   IVHR++K EN++V    +  V   KLADF L+ ++   +  VCG+  Y++PE+     Y   +D+W+ G++ YILL G PPF + +  +  + D I +  Y FP  +WS + +  ++LI  +LQ +P  R ++ D+L + W + N
Sbjct:  473 IRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGN 738          

HSP 2 Score: 54.299 bits (129), Expect = 9.223e-7
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 1
Query:   40 IHKQLERNKINYLDPKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKALKKFEIEPNIEKFAQLQI 390
            I K++  ++        I+ Y N +  + GI + V+  RY++FE   +DL   L+++V +    R +YN  GK I SL ++ D ++Y+       N +  KK E     +  + L +
Sbjct:  143 IKKRIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCS----CNNENFKKVEYNTGSQPLSNLPL 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 266/315 (84.44%), Postives = 287/315 (91.11%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 290.812 bits (743), Expect = 5.809e-90
Identity = 143/176 (81.25%), Postives = 156/176 (88.64%), Query Frame = -3
Query: 2004 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGL 2531
            PNYTLKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGL
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 194          

HSP 2 Score: 113.62 bits (283), Expect = 4.679e-28
Identity = 67/151 (44.37%), Postives = 92/151 (60.93%), Query Frame = -3
Query: 1875 VKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNV 2327
             K V  V +S   + L S+S DK +KIW    GK  KT+ GH   +    ++  SNL+VS S D+++KIWDV SGKCLKTL  H++ V   +FN   +LIVS S+D   RIWD  +G+CLKTL    + PVS V F+ +G  I++ S D +
Sbjct:   45 TKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSD-PVSAVHFNRDGSLIVSSSYDGL 194          

HSP 3 Score: 88.5817 bits (218), Expect = 3.035e-19
Identity = 62/166 (37.35%), Postives = 91/166 (54.82%), Query Frame = -3
Query: 1620 VKSGKCLK-TLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALE 2114
            VK    LK TL  H   V++V F+  G  + SSS D L +IW A  G+  KT I      +S V +S +   +++ S D  LK+WD + GKCLKT  GH N  +C   NF+  S   IVSGS D  V IW+++T + ++ L  H+D V A   +   ++I S++ +
Sbjct:   31 VKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKT-ISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCC--NFNPQSN-LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          

HSP 4 Score: 63.929 bits (154), Expect = 9.578e-11
Identity = 38/131 (29.01%), Postives = 69/131 (52.67%), Query Frame = -3
Query: 1596 LKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKW------IVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 1970
            LK  +      VS VKFSP+G+++ + S D ++K+W    GK  KT  GHK           ++   W      +VS S+D  + IW++ + + ++ L GH++ V   + +P  N+I S +   D+++++W
Sbjct:   37 LKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHK---------LGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSF--DESVRIW 156          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 176.792 bits (447), Expect = 2.931e-45
Identity = 94/265 (35.47%), Postives = 150/265 (56.60%), Query Frame = 1
Query:  484 RYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGNI 1278
            +Y++   IG G+ + V    ++S G   A+KII KN    K   I +E+++L+ + H NII L++ +D+   L L+ +L   GDLF  +      TE   + ++ D+ +AL YLH+  IVHR++K EN++V +        KL DF L+  +  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF S N  + ++ D+I      FP  FW ++S+ +KELI  +LQ N   R +A D+L + WV  +  +
Sbjct:  391 KYKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWVTEDAAM 655          

HSP 2 Score: 62.3882 bits (150), Expect = 4.060e-9
Identity = 38/116 (32.76%), Postives = 61/116 (52.59%), Query Frame = 1
Query:   85 KNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNK-YGKTIYSLLDIVDSENYIVGGLEPLNKKALKKFEIEP----NIEKFAQLQIPHQAKSKNE 417
            K +R Y N ++ FKG+  +V+ +R+++F+  L +L   L  +V L  G R +Y    GK I SL D+V+ E+Y+    EP  K    K  + P    N++  A   +P    +KNE
Sbjct:   64 KKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTK-NVNPNWSVNVKTGASRSMPSLTATKNE 178          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: pafah1b1a (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a [Source:NCBI gene;Acc:394246])

HSP 1 Score: 170.244 bits (430), Expect = 3.340e-45
Identity = 102/332 (30.72%), Postives = 163/332 (49.10%), Query Frame = -3
Query: 1596 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPN--------------------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2531
            P    K+ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD    +CI+T+ GH + V      P  + IVS S D+++K+W+V +G C+KT   H + V  V  N+DG+LI SSS D   R+W  ++ +C   L + ++  V  + ++P                     G ++L+GS D  +K+WD + G CL T VGH N    +  +     GK+IVS ++D  + IW+ + K   + L  H   V +   H T   + + ++  D+T+K+W
Sbjct:   96 PRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHETGDFERTLKGH--------------TDSVQDISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAELREHEH-VVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVH---PGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVVTGSV--DQTVKVW 407          

HSP 2 Score: 124.02 bits (310), Expect = 1.952e-29
Identity = 77/237 (32.49%), Postives = 121/237 (51.05%), Query Frame = -3
Query: 1860 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSN--------------------LIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWD 2510
            T+ GH   VSSV   PNGD + S+S DK IK+W    G   KT +GH+              + V  V  + D   + S+S+D+T+++W +A+ +C   L+ H + V C ++ P+S                      ++SGS D+++K+WDV  G CL TL  H + V  V  +  G  IVS + D   RIWD  + +C KTL   ++  V+ + F     Y++TGS+D  +K+W+
Sbjct:  187 TMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHR--------------EWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHF-VTSLDFHKTAPYVVTGSVDQTVKVWE 408          

HSP 3 Score: 68.5514 bits (166), Expect = 2.914e-11
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+GV         K + S +DDKTL+IWD  + +C KTL  H ++V   +F+  +  +V+GS D++VK+W+ +
Sbjct:  298 GSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGH---------DNW--VRGVL---VHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: pafah1b1a (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a [Source:NCBI gene;Acc:394246])

HSP 1 Score: 170.244 bits (430), Expect = 3.340e-45
Identity = 102/332 (30.72%), Postives = 163/332 (49.10%), Query Frame = -3
Query: 1596 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPN--------------------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2531
            P    K+ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD    +CI+T+ GH + V      P  + IVS S D+++K+W+V +G C+KT   H + V  V  N+DG+LI SSS D   R+W  ++ +C   L + ++  V  + ++P                     G ++L+GS D  +K+WD + G CL T VGH N    +  +     GK+IVS ++D  + IW+ + K   + L  H   V +   H T   + + ++  D+T+K+W
Sbjct:   96 PRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHETGDFERTLKGH--------------TDSVQDISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAELREHEH-VVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVH---PGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVVTGSV--DQTVKVW 407          

HSP 2 Score: 124.02 bits (310), Expect = 1.952e-29
Identity = 77/237 (32.49%), Postives = 121/237 (51.05%), Query Frame = -3
Query: 1860 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSN--------------------LIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWD 2510
            T+ GH   VSSV   PNGD + S+S DK IK+W    G   KT +GH+              + V  V  + D   + S+S+D+T+++W +A+ +C   L+ H + V C ++ P+S                      ++SGS D+++K+WDV  G CL TL  H + V  V  +  G  IVS + D   RIWD  + +C KTL   ++  V+ + F     Y++TGS+D  +K+W+
Sbjct:  187 TMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHR--------------EWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHF-VTSLDFHKTAPYVVTGSVDQTVKVWE 408          

HSP 3 Score: 68.5514 bits (166), Expect = 2.914e-11
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+GV         K + S +DDKTL+IWD  + +C KTL  H ++V   +F+  +  +V+GS D++VK+W+ +
Sbjct:  298 GSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGH---------DNW--VRGVL---VHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 266/325 (81.85%), Postives = 288/325 (88.62%), Query Frame = -3
Query: 1587 NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2561
            NN        PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 266/325 (81.85%), Postives = 288/325 (88.62%), Query Frame = -3
Query: 1587 NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2561
            NN        PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 266/325 (81.85%), Postives = 288/325 (88.62%), Query Frame = -3
Query: 1587 NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2561
            NN        PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 266/325 (81.85%), Postives = 288/325 (88.62%), Query Frame = -3
Query: 1587 NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2561
            NN        PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 264/315 (83.81%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   31 PNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 331          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 489.96 bits (1260), Expect = 5.506e-161
Identity = 229/319 (71.79%), Postives = 272/319 (85.27%), Query Frame = -3
Query: 1587 DVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2543
            + + PNY L+ TLAGH+  +SSVKFSPNG+WLASS++D LI IWGAYDG  +KT+ GH L               + DVAWS+DS  L SASDDKTLK+WD+ SGKC+KTLKGH+++VFCC+FNP SNLIVSGSFDESVKIW+VK+GKCLKTL AH+DP++AV+FN +GSLIVS SYDGLCRIWDA+SGQCL+TL D+ NPPVSFVKFSPNGKYILT +LDN LKLWDY++G+CLKTY GHKNEKYC+F++FSVT  KW+VSGSEDNMVYIWNLQTKEIVQ+L GHTDVVI+ +CHPT+NIIASAALENDKTIK+W  +
Sbjct:   23 EPQKPNYALRLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSL--------------EISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVWSSD 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 468.389 bits (1204), Expect = 1.301e-153
Identity = 231/293 (78.84%), Postives = 250/293 (85.32%), Query Frame = -3
Query: 1587 IWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLI----------------DDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2417
            IWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLI                DDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:    2 IWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIVFVTSHEKRSPLRTPCDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 174.096 bits (440), Expect = 1.001e-46
Identity = 94/266 (35.34%), Postives = 150/266 (56.39%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            I +RY++  +IG G+ + V    ++S     A+KII+K+    K   I +E+SIL+ + H NI+ L++ +D    L L+ +L   GDLF  +      TE   + ++ ++ SA+ YLH   IVHR++K EN++V++        KL DF L+  +  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF     D+  + D+I      FP  +W ++S+ +KELINM+L  N   R SA  +L + WV  +G
Sbjct:   79 ITERYKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEHPWVNDDG 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 174.866 bits (442), Expect = 1.342e-46
Identity = 94/266 (35.34%), Postives = 150/266 (56.39%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            I +RY++  +IG G+ + V    ++S     A+KII+K+    K   I +E+SIL+ + H NI+ L++ +D    L L+ +L   GDLF  +      TE   + ++ ++ SA+ YLH   IVHR++K EN++V++        KL DF L+  +  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF     D+  + D+I      FP  +W ++S+ +KELINM+L  N   R SA  +L + WV  +G
Sbjct:   78 ITERYKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEHPWVNDDG 343          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q498M4|WDR5_RAT (WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P61965|WDR5_MOUSE (WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P61964|WDR5_HUMAN (WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KIG2|WDR5_BOVIN (WD repeat-containing protein 5 OS=Bos taurus OX=9913 GN=WDR5 PE=2 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY LKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5M786|WDR5_XENTR (WD repeat-containing protein 5 OS=Xenopus tropicalis OX=8364 GN=wdr5 PE=2 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 266/325 (81.85%), Postives = 288/325 (88.62%), Query Frame = -3
Query: 1587 NNLVMADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2561
            NN        PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY  HKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKE+VQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A120H2H9 (WDR5 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 303/322 (94.10%), Postives = 304/322 (94.41%), Query Frame = -3
Query: 1584 MADVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGEN 2549
            MADVKNPNY+LKFTLAGHTKGVSSVKFSPNGDWLASSSSDKL KIWGAYDGKIEKTISGHKL              GVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLK LIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLW YAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHT VVIATSCHPTENIIASAALENDKTIKLWRGEN
Sbjct:    1 MADVKNPNYSLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLTKIWGAYDGKIEKTISGHKL--------------GVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKALIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWGYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTGVVIATSCHPTENIIASAALENDKTIKLWRGEN 308          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2T7NKL6 (WD_REPEATS_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17510 PE=4 SV=1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 267/315 (84.76%), Postives = 287/315 (91.11%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK +SSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWSTDS+ LCSASDDKTLKIWD A+GKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPVTAVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTYVGH+NEKYC+F+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVV+  +CHPTENIIASAALENDKTIKLWR +
Sbjct:   37 PNYTLKFTLAGHTKALSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GLSDVAWSTDSRLLCSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYVGHRNEKYCVFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVLCCACHPTENIIASAALENDKTIKLWRSD 337          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: V4A8E8 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_200955 PE=4 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 266/317 (83.91%), Postives = 286/317 (90.22%), Query Frame = -3
Query: 1587 KNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2537
            + PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWSTDS+ L SASDDKTLKIWD + GKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPVTAVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTYVGHKNEKYCIF+NFSVT GKWIVSGSEDN+V+IWNLQTKEIVQKL GHTDVV+  +CHPTENIIASAALENDKTIKLWR +
Sbjct:   51 QKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSTDSRLLVSASDDKTLKIWDFSMGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYVGHKNEKYCIFANFSVTGGKWIVSGSEDNVVFIWNLQTKEIVQKLQGHTDVVLCCACHPTENIIASAALENDKTIKLWRSD 353          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4W5N6G5 (WD_REPEATS_REGION domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 267/315 (84.76%), Postives = 287/315 (91.11%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLWR +
Sbjct:   74 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWRSD 374          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: H3BHU5 (WD repeat domain 5B OS=Latimeria chalumnae OX=7897 GN=WDR5B PE=4 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 266/315 (84.44%), Postives = 287/315 (91.11%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSPNG+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDN+VYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 266/315 (84.44%), Postives = 287/315 (91.11%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 257/315 (81.59%), Postives = 285/315 (90.48%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK +SSVKFSPNG+WLASSS+DKLIKIWG++DGK EK++SGHKL              G+ DVAWS DS  L SASDDKTLKIWD+ SGKC+KTLKGH+NYVFCCNFNPQSNL+VSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCR+WD++SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYC+F+NFSVT GKWIVSGSED+MVYIWNLQTKEIVQKL GH DVVIAT+CHP+ENIIASAALENDKTIKLW+ +
Sbjct:   30 PNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKL--------------GISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQGHADVVIATACHPSENIIASAALENDKTIKLWKSD 330          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 503.827 bits (1296), Expect = 1.879e-166
Identity = 250/315 (79.37%), Postives = 270/315 (85.71%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNYTLKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD++SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSS   L   WD            DDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSPQLLLFNWD------------DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 321          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 468.389 bits (1204), Expect = 9.810e-153
Identity = 230/322 (71.43%), Postives = 254/322 (78.88%), Query Frame = -3
Query: 1686 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGK----------------------------------------WIVSGSEDNMVYIWNLQTKEIVQKLYGH 2531
            PNYTLKFTLAGHTK +SSVKFSPNG+WLASSS+DKLIKIWG++DGK EK++SGHKL              G+ DVAWS DS  L SASDDKTLKIWD+ SGKC+KTLKGH+NYVFCCNFNPQSNL+VSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCR+WD++SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYC+F+NFSVT GK                                        WIVSGSED+MVYIWNLQTKEIVQKL GH
Sbjct:   30 PNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKL--------------GISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKVRRLLFLDLVTFSAAFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGH 337          

HSP 2 Score: 89.7373 bits (221), Expect = 1.759e-18
Identity = 61/174 (35.06%), Postives = 95/174 (54.60%), Query Frame = -3
Query: 1596 VKSGKCLK-TLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2114
            VK    LK TL  H   +++V F+ +G  + SSS D L +IW +  G+  K+L       +S V +SP+   +++ S D  LK+WD   GKCLKT  GH N  +C   NF+  S   +VSGS D  V IW+++T + ++ L  H+D V A   +   ++I S++   D   ++W
Sbjct:   28 VKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSL-SGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCC--NFNPQSN-LVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSY--DGLCRMW 195          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052579.1 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 468.389 bits (1204), Expect = 9.810e-153
Identity = 230/322 (71.43%), Postives = 254/322 (78.88%), Query Frame = -3
Query: 1686 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGK----------------------------------------WIVSGSEDNMVYIWNLQTKEIVQKLYGH 2531
            PNYTLKFTLAGHTK +SSVKFSPNG+WLASSS+DKLIKIWG++DGK EK++SGHKL              G+ DVAWS DS  L SASDDKTLKIWD+ SGKC+KTLKGH+NYVFCCNFNPQSNL+VSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCR+WD++SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYC+F+NFSVT GK                                        WIVSGSED+MVYIWNLQTKEIVQKL GH
Sbjct:   30 PNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKL--------------GISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKVRRLLFLDLVTFSAAFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGH 337          

HSP 2 Score: 89.7373 bits (221), Expect = 1.759e-18
Identity = 61/174 (35.06%), Postives = 95/174 (54.60%), Query Frame = -3
Query: 1596 VKSGKCLK-TLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2114
            VK    LK TL  H   +++V F+ +G  + SSS D L +IW +  G+  K+L       +S V +SP+   +++ S D  LK+WD   GKCLKT  GH N  +C   NF+  S   +VSGS D  V IW+++T + ++ L  H+D V A   +   ++I S++   D   ++W
Sbjct:   28 VKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSL-SGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCC--NFNPQSN-LVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSY--DGLCRMW 195          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 1.063e-45
Identity = 106/313 (33.87%), Postives = 169/313 (53.99%), Query Frame = 1
Query:  388 IPHQAKSKNE-KKALIDKYK-----LISFIEKYPEINKRYEMHNSIGYGSHSKV-YCGQDKSNGGL-------VAIKIIRKNFISVKCESIYDELSILKNL-DHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSN---ESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            +PH+ K+KN+ K    DK       L   I    +I  RYE+  +IG G+ + V  C +  S  G        +A+KII K  +  + E +  E+++   L  H N+++LV+ ++S     L+ +    GDLF  + E    TE H A+++ D+  AL YLH N IVHR+VK EN++V + +      KLAD  L++++  PI  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF S+  D+ E+ + I+  +Y F   +W H+S+    +K+L++ LL  +   R +A   L + WV   G
Sbjct:  324 VPHKGKAKNKLKDGDADKKSKKFPNLPMPIVSLQDIESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTGPIYTVCGTPTYVAPEILAETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSDGG 636          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 167.548 bits (423), Expect = 1.337e-45
Identity = 100/333 (30.03%), Postives = 166/333 (49.85%), Query Frame = -3
Query: 1593 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPN--------------------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWR 2531
            P    K+ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD  S +C++T+ GH + V    F P  + +VS S D+++K+W+V++G C+KT   H + V  V  N+DGSLI S S D   R+W  ++ +C   L + ++  V  V ++P+                    G Y+L+GS D  +K+WD + G C+ T VGH N    +  +     GK+I+S ++D  + +W+ + K   + L  H   V +   H T   + + ++  D+++K+W 
Sbjct:   35 PRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGH--------------TDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEH-VVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFH---PGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSV--DQSVKVWE 347          

HSP 2 Score: 67.3958 bits (163), Expect = 6.463e-12
Identity = 41/127 (32.28%), Postives = 67/127 (52.76%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+GV    +    K + S +DDKTL++WD  + +C K+L  H ++V   +F+  +  +++GS D+SVK+W+ +
Sbjct:  237 GAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGH---------DNW--VRGVL---FHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 155.221 bits (391), Expect = 4.801e-42
Identity = 89/265 (33.58%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  487 YEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFI--SVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKP-ICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANG 1272
            +++   +G G    VY  ++KS   ++A+K++ K+ +  S     +  E+ I  +L H NI++L  +     R+ LI + A +G+L+++L++ G   E  +AS + D+  AL+Y H  +++HR++K EN+++          K+ADF  S+         +CG+++Y+ PEM  G+ +   VDLWS+GV+CY  L G PPF S   +  E   +I   D  FP    SHLS+ +K+LI  LL+HNP  RL    +L + WV AN 
Sbjct:   15 FDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKG----ELKIADFGWSVHAPSSRRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHN--ETYRRISKVDLRFP----SHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKANA 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 8.074e-40
Identity = 100/296 (33.78%), Postives = 159/296 (53.72%), Query Frame = -3
Query: 1596 GDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSK--TLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSG-----KWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSC-HPTENIIASAALENDKTIKLW 2459
            G+ + S S D  +K+W A  GK  +T+ GH                GV    WS+  +   + S S D+TLK+W+  +G+C+ TL GHT+ V C + +   N +VSGS D ++++WD+++G+CL  L  H   V  V +  DG  +VS +YD   ++WD  S  CL TL    N   S  +F  +G +I++GSLD  +++WD   G CL T VGH+          S+TSG       +VSG+ D+ V IW+++T + +Q L G      A +C   +  ++ +++  +D T+KLW
Sbjct:  244 GNRIVSGSDDNTLKVWSAVTGKCLRTLVGH--------------TGGV----WSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSL-QF--DGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQ----------SLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSS--DDGTVKLW 502          

HSP 2 Score: 143.28 bits (360), Expect = 8.990e-36
Identity = 98/312 (31.41%), Postives = 158/312 (50.64%), Query Frame = -3
Query: 1599 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVG---HKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLY-----GHTDVVIATSCHPTENIIASAALENDKTIKL 2510
            TL GHT GV S +    G+ + S S+D+ +K+W A  G+   T+ GH      +                      + S S D TL++WD+ +G+C+  L GH   V C  ++ +   +VSG++D +VK+WD +S  CL TL  H + V ++ F  DG  IVS S D   R+WDA +G CL TL+   +   S ++   N   +++G+ D+ +K+WD   G+CL+T  G   H++   C+   FS    K +V+ S+D  V +W+L+T + ++ L      G   VV    C  T+ + A  +    +  KL
Sbjct:  269 TLVGHTGGVWSSQM--RGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCM----------------HLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRR--VVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQF--DGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSL-TSGMELRDN--ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCL--QFSR---KLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGSGGVVWRVRCSNTKLVCAVGSRNGTEETKL 550          

HSP 3 Score: 110.923 bits (276), Expect = 3.263e-25
Identity = 72/222 (32.43%), Postives = 113/222 (50.90%), Query Frame = -3
Query: 1584 WDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVK-FSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGEN 2246
            W     +  K LKGH ++V  C      N IVSGS D ++K+W   +GKCL+TL  H   V +      G++IVS S D   ++W+A +GQC+ TL        S V+    +G  +++GS D  L++WD   G+CL    GH     C+  +     G+ +VSG+ D  V +W+ +++  +  L GHT+ V +         I S +L  D +I++W  E 
Sbjct:  218 WRCGEIRAPKVLKGHDDHVITC-LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR--GNIIVSGSTDRTLKVWNADTGQCVHTLYGH----TSTVRCMHLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYD-----GRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGVH--IVSGSL--DTSIRVWDAET 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 144.821 bits (364), Expect = 7.673e-38
Identity = 101/317 (31.86%), Postives = 161/317 (50.79%), Query Frame = -3
Query: 1587 LAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAY-DGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCC---NFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAK----GKCLKTYVG--HKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2507
            L GH   V   KF PNG+ LAS+  D+ I +W  Y D      + GH                 + D+ +STD  T+ ++S DKT+ +WD  +G+ IK LKGHT++V  C      PQ  ++ + S D +VK+WD +    + +   +     +V FN     I+S   D + ++WD    + + T+    N  V+ +  SP+G Y+L+ ++DN +++WD        +C+K + G  H  EK  +  ++S   G  + +GS D  VYIW+  ++ I+ KL GH   V   + HP E I+ S A  NDK  +L+ GE
Sbjct:   53 LTGHEGEVYCCKFHPNGNTLASAGFDRTILMWNVYGDCDNYAHLKGH--------------TGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQ--MVCTASDDGTVKLWDTRKKGSVHSF-QNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTM-KGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWS-HDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCA--NDK--RLYLGE 346          

HSP 2 Score: 106.301 bits (264), Expect = 8.248e-25
Identity = 62/211 (29.38%), Postives = 109/211 (51.66%), Query Frame = -3
Query: 1596 IKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKC--LKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2222
            I  L GH   V+CC F+P  N + S  FD ++ +W+V  G C     L  H   +  +H++ DGS I +SS D    +WD+ +G+ +K L    +   +        + + T S D  +KLWD  K   + ++   +N   C+   F+ TS + I+SG  DN++ +W+L+  +++  + GH D V   S  P  + + S A++N  ++++W
Sbjct:   50 IMLLTGHEGEVYCCKFHPNGNTLASAGFDRTILMWNVY-GDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSF---QNTYQCLSVTFNDTSDQ-ILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDN--SVRIW 253          

HSP 3 Score: 55.0694 bits (131), Expect = 7.496e-8
Identity = 33/139 (23.74%), Postives = 69/139 (49.64%), Query Frame = -3
Query: 2109 LKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYD-GKIEKTISGHKLV*YLL**NNLIDV-KGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2519
            L +T+ GH   V+ +  SP+G +L S++ D  ++IW       +E+ +   +         N+ +  K +   +WS D   + + S D+ + IWD  S + +  L GH   V    F+P+  +++S + D+ + + +++
Sbjct:  218 LIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQ--------GNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYLGEIQ 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SWD3 (Essential subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; WD40 beta propeller superfamily member and ortholog of mammalian WDR5 [Source:SGD;Acc:S000000379])

HSP 1 Score: 154.066 bits (388), Expect = 1.598e-41
Identity = 110/313 (35.14%), Postives = 161/313 (51.44%), Query Frame = -3
Query: 1593 KFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHF-NRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDN-------PPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCI-------FSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQ----KLYGHTDVVIATSCHPTENIIASAALENDKTIKLWR 2474
            K SP+G +LA +    ++     YD  I +      LV            +   ++ WS D + + +ASDD +++I  L+ G  + T  GHT  V    FN + NL+ + S DES+KIWD  +G  +KT+ AH++ V +V     D S++ S SYDGL RI+DA +G CLKTL  D +        P+S VKFS N +Y+L  SLD V+K+WD   G  ++T+     EK  +       F N    S   ++SG E+  +Y WN  TK ++Q     LY H+  V++  C    NI+ S AL  D    LWR
Sbjct:   20 KISPDGQFLAITQGLNIL----IYD--INRRTVSQTLV--------TSHARPFSELCWSPDGQCIATASDDFSVEIIHLSYG-LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCF--GNIMCSLALNGDCC--LWR 313          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 138.658 bits (348), Expect = 4.283e-35
Identity = 93/288 (32.29%), Postives = 150/288 (52.08%), Query Frame = 1
Query:  442 KLISFIEKYPE--INKR-YEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFIS---VKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKP---ICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFY--SINGDKIEILDKIRNCDY--TFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVA 1266
            K I+ +   PE  +N+  Y    ++G GS   V   +  S    VAIKI+ K  +    V+ + +Y+ELSIL+ L H NI+   D  +S  +  ++  LAT G+LF  +  RG  TE     II  I  A+ Y+H   +VHR++K EN++    S       +ADF ++ ++      I +  GS+ Y++PE+     +  P D+WS+GV+ Y LL G  PF   S+ G     +++     Y  TF + +W ++S + K  I   L+ NP DR +AT+LL + W+ +
Sbjct:   29 KFINKLSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLV-IADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEG----FMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITS 311          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 137.887 bits (346), Expect = 7.291e-35
Identity = 84/274 (30.66%), Postives = 146/274 (53.28%), Query Frame = 1
Query:  481 KRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFIS---VKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIK-------IFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIE-ILDKIRNCDYT--FPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVV 1263
            K+Y    ++G G+   V   ++   G  VA+KI+ K  +    V+ E++YDEL IL+ L H NI+   D  +S  +  +I  LA  G+LF  + ++G  TE     I+ +I SA+ Y+H   IVHR++K EN++    S       +ADF ++ +       ++KP     GS+ Y++PE+     +  P D+WS+GV+ Y LL G   + +   ++++  LD+    +Y   F   +W  +SN++K+ I   L  +P  R +A +LL + W++
Sbjct:   35 KKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLV-VADFGIAKRLKSDEELLYKP----AGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCG---YSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWII 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 133.265 bits (334), Expect = 6.323e-34
Identity = 83/253 (32.81%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  529 VYCGQDKSNGGLVAIKIIRKNFISVK---CESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICE---VCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVAN 1269
            VYC + +S G + A+K++ K  I +K    +    E+ I  +L+H N+ K   +   +KR+ L+ +    G+++++L+  G   +   +  I  I +AL Y+HK  I+HR++K ENI+   I +  V  KL DF  SI I  P      VCG+I+Y+SPEM   +EY + +D W++GV+ + LL+G PPF     D      +I   D   P    S++S ++++LI  LL+++P DR+   D+  + W++ N
Sbjct:  118 VYCVRHRSTGYICALKVMEKEEI-IKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENIL---IGFNNVI-KLTDFGWSI-INPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKMP----SNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRN 358          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 126.716 bits (317), Expect = 1.006e-30
Identity = 104/365 (28.49%), Postives = 169/365 (46.30%), Query Frame = -3
Query: 1596 DVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGK-IEKTISGHKLV*YLL**NNLIDVKGVCDVAWST-------DSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKS-GKCLKTLPAHADPVTAVHFNRDGSLIVSS--------------------SYDGLCRIWDASSGQCLKTLIDDD-----NP-----P----------VSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2543
            D + P +TLK    GH   V  V +SP+G+ +A+ S D  I++W    G+ +   + GH               K +  ++W             L S+S D T+KIWD  S  C  T+ GHTN V C  +  Q  L+ SGS D +V++WD+ S G+C+  L +HA  V  +  + D +L + +                    +Y+ +C+  + +S + + T  DD      NP     P          V+ V FSP+G+YI++ S DN +KLWD   GK + T+ GH    Y +  +   +  + +VS S+D  + +W+++T+++   L GH D V           + S     DK ++LW
Sbjct:  174 DTQTPMHTLK----GHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHS--------------KWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQ-GLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKK-NGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS---SDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGG--KDKMVRLW 513          

HSP 2 Score: 110.538 bits (275), Expect = 2.179e-25
Identity = 80/291 (27.49%), Postives = 137/291 (47.08%), Query Frame = -3
Query: 1584 VCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCL-KTLPAHADPVTA-----VHFNRDGS--LIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDY-AKGKCLKTYVGHKN------------------------------------EKYCIFSNFSVTSGKWIVSGSEDNMVYIWN-LQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGEN 2318
            +C       S  + + + D T +IWD  +   + TLKGH N+V C +++P   +I +GS D ++++WD KSG+CL   L  H+  +T+     +H  + GS   + SSS DG  +IWD  S  C  T+    N  VS VK+   G  + +GS D  +++WD  ++G+C+     H +                                    E Y      +  S + +V+ S+D  +++WN L++ + + ++ GH  +V   +  P    I SA+ +N  +IKLW G +
Sbjct:  147 LCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTN-SVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRD 433          

HSP 3 Score: 86.6557 bits (213), Expect = 9.305e-18
Identity = 71/255 (27.84%), Postives = 116/255 (45.49%), Query Frame = -3
Query: 1857 KFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIW--------------------------------GAYD--GKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWD-LASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDY 2516
            ++T++GHT  VS VK+   G  L S S D+ +++W                                GA+D  GK   T    +          L + + +C    +++ + + +ASDD T+ +W+ L S K I  + GH   V    F+P    IVS SFD S+K+WD + GK + T   H   V  V ++ D  L+VS S D   ++WD  + + L   +      V  V +S +GK + +G  D +++LW +
Sbjct:  271 QYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQK-------KALENYEKICKKNGNSE-EMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRK-LSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWTH 515          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 528.865 bits (1361), Expect = 6.237e-176
Identity = 252/317 (79.50%), Postives = 280/317 (88.33%), Query Frame = -3
Query: 1587 KNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2537
            K PNY LK+TL GH K VSSVKFS NG+WLASSS+DK+IKIWGAYDGK EKTI+GHKL              G+ DVAWSTDS+ L SASDDKTLKIWD A+GKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPVTAVHFNRDG+LIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYC+F+NFSVT GKWIVSGSED+ VYIWNLQ+KE+VQKL GH+DVV+  +CHPTENIIAS ALENDKTIK+W+ +
Sbjct:   51 KKPNYQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKL--------------GISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIWKSD 353          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 193.356 bits (490), Expect = 1.321e-52
Identity = 105/285 (36.84%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  403 KSKNEKKALIDKYKLISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKW 1257
            KS NE+K    KYK     +K  E+   Y     +G G+ + V   +DK      AIKII K  I  K + I DE++I++   H NI++L +  DS   + L+ +L   GDLF  +      TE+   S   D+  AL YLHK +IVHR++K EN++V K S  +   KLADF L++++  PI  VCG+  Y++PE+     Y   VD+W+ GV+ YI+L G PPF S N D+ E+ D I++ ++ F   +W  +S+++K+LI+ +L  +P  R +A  +L ++W
Sbjct:  220 KSPNERKPQSPKYKRPLVTDK--EVTDVYNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDDEIAIMRRCRHPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLAMEVTAPIFTVCGTPTYVAPEILEENGYGLKVDMWAAGVITYIMLCGFPPFRSPNRDQDELFDLIQSGEFEFLSPYWDPVSDDAKDLISTMLVVDPTKRATADQVLQHRW 502          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 168.703 bits (426), Expect = 6.771e-47
Identity = 94/259 (36.29%), Postives = 153/259 (59.07%), Query Frame = 1
Query:  487 YEMHNSIGYGSHSKVY-CGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWV 1260
            Y +   IG G+ + V  C   K+N    A+KII K  +  K   I +E+SIL+ + H +I++L++  ++ + + L+ +L   GDLF+ + E    TE H + ++ D+ SAL YLH N IVHR++K EN++V  +   R   KLADF L++++  P+  VCG+  Y++PE+     Y   VD+W+ GV+ YILL G PPF S + D  E+ D I   ++ +   FW+ +S+ +K+LI+ +L  +   R SA  +L + WV
Sbjct:    1 YRIGKVIGDGNFAVVRECKHRKTNKEY-ALKIINKAKVKGKEHMIENEISILRRVKHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKSLKLADFGLAMEVKSPMFLVCGTPTYVAPEILDESGYGLKVDIWAAGVISYILLCGFPPFRSPDQD--ELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPWV 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 166.007 bits (419), Expect = 2.268e-45
Identity = 94/287 (32.75%), Postives = 155/287 (54.01%), Query Frame = 1
Query:  475 INKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLS-IKIFKPICE-VCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKY 1329
            I K+Y++   +G G+ S+V   ++K+ G L A+K I K  +  K ES+ +E++ILK + H NII L D  D+   L L+ DL   G+LF  + E+G+ TE   ++++  I  A  YLH   IVHR++K EN++ +          ++DF LS I+      +  CG+  Y++PE+ + + Y   VD WS+GV+ YILL G PPFY  +     +  +I   +Y F   +W  +S  +K+ I  L++ +P  R +    L + W+     +T   +  V E++ K  Y
Sbjct:   13 ITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIM-ISDFGLSKIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFY--DDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEALTRDIHASVSEQIKKNFY 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 167.162 bits (422), Expect = 1.434e-44
Identity = 102/308 (33.12%), Postives = 157/308 (50.97%), Query Frame = -3
Query: 1593 FTLAGHTKGVSSVKFS-PNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWR 2513
             TL GH   V ++ F+ P GD +A+ S DK  K+W A  GK   T  GH               + VC +A++  S  + + S D T K+WD+ +G  I TL GH+  +  C FN     +++GSFD +V +WD +SG+ + TL  H   ++   FN D S IV+ S D  C+IWDA +G+C+ TL   D+  +  V F   G+ I T S D   ++++     CL    GH+ E   I  N     G  +++ S D    +W+  T + +Q L GHTD + + + +   +II + +   D T +LWR
Sbjct:  128 LTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHS-------------AEIVC-LAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLD-VAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFN---AQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGS--KDNTCRLWR 415          

HSP 2 Score: 162.54 bits (410), Expect = 5.561e-43
Identity = 98/318 (30.82%), Postives = 163/318 (51.26%), Query Frame = -3
Query: 1596 DVKNPNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVV--IATSCHPTENIIASAALENDKTIKLW 2543
            +  + ++ L   L  H   +++V F+ +G    + S D+  K+W    G+   T+ GHK V Y +  NN    K             + + S DKT K+W+  +GKC  T +GH+  + C  FNPQS +I +GS D + K+WDV++G  + TL  H+  + +  FN  G+ +++ S+D    +WD  SG+ + TLI      +S  +F+ +  +I+TGS+D   K+WD   GKC+ T  GH +E   +  ++   +G+ I + S D    ++N  T   + KL GH   +  I  +   T  + AS+    DKT +LW
Sbjct:   76 ETDDRHFYLFKILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDK-------------IATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLI-GHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDY---TGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASS----DKTARLW 372          

HSP 3 Score: 101.679 bits (252), Expect = 1.564e-22
Identity = 66/206 (32.04%), Postives = 101/206 (49.03%), Query Frame = -3
Query: 1482 LKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGEN*WIKSCTIFTLINY*FC*LNKLSTSGF-VDCMFII 2096
             K L AH  P+T V FN+ G+  ++ SYD  C++WD +SG+   TL    N   +    +P G  I TGS D   KLW+   GKC  TY GH  E  C+  N   T    I +GS D    +W++QT   +  L GH+  +I+ + + T   + + +   D T+ +W   +       + TLI +      ++S + F  DC FI+
Sbjct:   85 FKILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTV---IATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSF--DHTVSVWDTRS----GRRVHTLIGH----RGEISNAQFNFDCSFIV 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 265/315 (84.13%), Postives = 286/315 (90.79%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY+LKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD+ SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN LKLWDY+KGKCLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   33 PNYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 525.783 bits (1353), Expect = 1.422e-174
Identity = 257/317 (81.07%), Postives = 281/317 (88.64%), Query Frame = -3
Query: 1587 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDN--VLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLWRGE 2531
            PNY+LKFTLAGHTK VSSVKFSP+G+WLASSS+DKLIKIWGAYDGK EKTISGHKL              G+ DVAWS+DS  L SASDDKTLKIWD+ SGKC+KTLKGH+NYVFCCNFNPQSNLIVSGSFDESV+IWDVK+GKCLKTLPAH+DPV+AVHFNRDGSLIVSSSYDGLCRIWD +SGQCLKTLIDDDNPPVSFVKFSPNGKYIL  +LDN  +  ++ Y   +CLKTY GHKNEKYCIF+NFSVT GKWIVSGSEDNMVYIWNLQTKEIVQKL GHTDVVI+T+CHPTENIIASAALENDKTIKLW+ +
Sbjct:   32 PNYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--------------GISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 334          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dclk3 (doublecortin like kinase 3 [Source:NCBI gene;Acc:101156024])

HSP 1 Score: 183.726 bits (465), Expect = 2.130e-49
Identity = 88/269 (32.71%), Postives = 155/269 (57.62%), Query Frame = 1
Query:  472 EINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGNI 1278
            +I + YE    IG G+ + V   + +  G L+A+KI+ ++ +  +   + +ELS+L +L H  I++L  H  +     L+ +L + GDLF+ + +RG   E     I++D+  AL Y+H+  IVHR++K EN++V +++      KL DF L++ + +P+  +CG+  Y++PE+     Y   VD+W++GV+ ++LL G PPF S   D+ E+   I+     FP  +W  +S E+K L+  LL+ +P  RL+A   L + WV A  ++
Sbjct:   70 DIERVYEFGRVIGDGNFAVVRECRRRDGGELLALKIVERSKLVGREHMMQNELSLLGSLCHPRIVRLFTHHHTRTHSYLVMELVSGGDLFEAISDRGKFPEAEAGLIVSDVSEALEYIHRKSIVHRDLKPENLLVERVAASVCRLKLGDFGLAMVVTEPVFTICGTPTYVAPEILHETGYGVAVDVWALGVILFVLLCGFPPFRSRERDQEELFKLIKQAQLHFPSPYWDSISEEAKSLVRCLLEVDPTLRLTAEQTLQHPWVKAMASV 338          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 169.088 bits (427), Expect = 7.677e-45
Identity = 101/332 (30.42%), Postives = 162/332 (48.80%), Query Frame = -3
Query: 1596 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPN--------------------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2531
            P    ++ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD    +CI+T+ GH + V      P  + IVS S D+++K+W+V +G C+KT   H + V  V  N+DG+LI S S D   R+W  +S +C   L + ++  V  + ++P                     G ++L+GS D  +K+WD + G CL T VGH N    I  +     GK+IVS ++D  + IW+ + K  ++ L  H   V +   H     + + ++  D+T+K+W
Sbjct:   96 PRPPERYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGH--------------TDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEH-VVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFH---PGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSV--DQTVKVW 407          

HSP 2 Score: 128.257 bits (321), Expect = 6.031e-31
Identity = 77/237 (32.49%), Postives = 123/237 (51.90%), Query Frame = -3
Query: 1860 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSN--------------------LIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWD 2510
            T+ GH   VSSV   PNGD + S+S DK IK+W    G   KT +GH+              + V  V  + D   + S S+D+T+++W +AS +C   L+ H + V C ++ P+S                      ++SGS D+++K+WDV +G CL TL  H + V  + F+  G  IVS + D   RIWD  + +C+KTL   ++  V+ + F     +++TGS+D  +K+W+
Sbjct:  187 TMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHR--------------EWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHF-VTSLDFHKAAPFVVTGSVDQTVKVWE 408          

HSP 3 Score: 70.4774 bits (171), Expect = 5.195e-12
Identity = 42/127 (33.07%), Postives = 68/127 (53.54%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+G+    +    K + S +DDKTL+IWD  + +C+KTL  H ++V   +F+  +  +V+GS D++VK+W+ +
Sbjct:  298 GSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH---------DNW--VRGIL---FHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSVDQTVKVWECR 410          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 169.088 bits (427), Expect = 7.677e-45
Identity = 101/332 (30.42%), Postives = 162/332 (48.80%), Query Frame = -3
Query: 1596 PNYTLKFTLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPN--------------------GKYILTGSLDNVLKLWDYAKGKCLKTYVGHKNEKYCIFSNFSVTSGKWIVSGSEDNMVYIWNLQTKEIVQKLYGHTDVVIATSCHPTENIIASAALENDKTIKLW 2531
            P    ++ L+GH   V+ V F P    + S+S D  IK+W    G  E+T+ GH                 V D+++    K L S S D T+K+WD    +CI+T+ GH + V      P  + IVS S D+++K+W+V +G C+KT   H + V  V  N+DG+LI S S D   R+W  +S +C   L + ++  V  + ++P                     G ++L+GS D  +K+WD + G CL T VGH N    I  +     GK+IVS ++D  + IW+ + K  ++ L  H   V +   H     + + ++  D+T+K+W
Sbjct:   96 PRPPERYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGH--------------TDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEH-VVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFH---PGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSV--DQTVKVW 407          

HSP 2 Score: 128.257 bits (321), Expect = 6.031e-31
Identity = 77/237 (32.49%), Postives = 123/237 (51.90%), Query Frame = -3
Query: 1860 TLAGHTKGVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSN--------------------LIVSGSFDESVKIWDVKSGKCLKTLPAHADPVTAVHFNRDGSLIVSSSYDGLCRIWDASSGQCLKTLIDDDNPPVSFVKFSPNGKYILTGSLDNVLKLWD 2510
            T+ GH   VSSV   PNGD + S+S DK IK+W    G   KT +GH+              + V  V  + D   + S S+D+T+++W +AS +C   L+ H + V C ++ P+S                      ++SGS D+++K+WDV +G CL TL  H + V  + F+  G  IVS + D   RIWD  + +C+KTL   ++  V+ + F     +++TGS+D  +K+W+
Sbjct:  187 TMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHR--------------EWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHF-VTSLDFHKAAPFVVTGSVDQTVKVWE 408          

HSP 3 Score: 70.4774 bits (171), Expect = 5.195e-12
Identity = 42/127 (33.07%), Postives = 68/127 (53.54%), Query Frame = -3
Query: 2109 GVSSVKFSPNGDWLASSSSDKLIKIWGAYDGKIEKTISGHKLV*YLL**NNLIDVKGVCDVAWSTDSKTLCSASDDKTLKIWDLASGKCIKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVKIWDVK 2489
            G  + K    G +L S S DK IK+W    G    T+ GH         +N   V+G+    +    K + S +DDKTL+IWD  + +C+KTL  H ++V   +F+  +  +V+GS D++VK+W+ +
Sbjct:  298 GSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH---------DNW--VRGIL---FHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSVDQTVKVWECR 410          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000080647.1 (SMESG000080647.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 279/280 (99.64%), Postives = 280/280 (100.00%), Query Frame = 1
Query:   37 MIHKQLERNKINYLDPKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKALKKFEIEPNIEKFAQLQIPHQAKSKNEKKALIDKYKLISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVV 876
            MIHKQLERNKINYLDPKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKALKKFEIEPNIEKFAQL+IPHQAKSKNEKKALIDKYKLISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVV
Sbjct:    1 MIHKQLERNKINYLDPKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKALKKFEIEPNIEKFAQLRIPHQAKSKNEKKALIDKYKLISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVV 280          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000010854.1 (SMESG000010854.1)

HSP 1 Score: 231.876 bits (590), Expect = 1.112e-70
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query: 1195 MLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGIDIDQEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN 1530
            MLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGIDIDQEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN
Sbjct:    1 MLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGIDIDQEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN 112          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000010878.1 (SMESG000010878.1)

HSP 1 Score: 221.09 bits (562), Expect = 8.001e-67
Identity = 109/112 (97.32%), Postives = 110/112 (98.21%), Query Frame = 1
Query: 1195 MLLQHNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGIDIDQEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN 1530
            MLLQ+NPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGID  QEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN
Sbjct:    1 MLLQYNPVDRLSATDLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGID--QEKNTESKTKTIFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN 110          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 192.2 bits (487), Expect = 1.594e-49
Identity = 99/277 (35.74%), Postives = 166/277 (59.93%), Query Frame = 1
Query:  445 LISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGN 1275
            L   +E   +  K Y++ NSIG G+ S+V   + K+ G   A KII K  +  K + I +E+ ILK+ +H NI+KL +  ++  ++ L+ +   +GDLF  + E     E+ +A ++ DI  ALLY+H   IVHR++K EN++   I    +  KL+DF L+++I +P+  +CG+  Y++PE+   + Y   VD+W+ GV+CYILL G PPF S   ++ E+ + I+  ++ +   +W  +S ESK+LIN +L  +P+ R +  D LC+ W++  GN
Sbjct:  642 LAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN 917          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 192.2 bits (487), Expect = 2.881e-49
Identity = 99/277 (35.74%), Postives = 166/277 (59.93%), Query Frame = 1
Query:  445 LISFIEKYPEINKRYEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSILKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTASIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIKIFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYSINGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSATDLLCNKWVVANGN 1275
            L   +E   +  K Y++ NSIG G+ S+V   + K+ G   A KII K  +  K + I +E+ ILK+ +H NI+KL +  ++  ++ L+ +   +GDLF  + E     E+ +A ++ DI  ALLY+H   IVHR++K EN++   I    +  KL+DF L+++I +P+  +CG+  Y++PE+   + Y   VD+W+ GV+CYILL G PPF S   ++ E+ + I+  ++ +   +W  +S ESK+LIN +L  +P+ R +  D LC+ W++  GN
Sbjct:  740 LAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN 1015          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR50.000e+084.13WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR5B1.012e-17078.34WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
DCLK12.338e-4534.59doublecortin like kinase 1 [Source:HGNC Symbol;Acc... [more]
DCLK13.452e-4534.59doublecortin like kinase 1 [Source:HGNC Symbol;Acc... [more]
PAFAH1B17.177e-4530.21platelet activating factor acetylhydrolase 1b regu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr-5.11.023e-13864.65WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.023e-13864.65WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.21.166e-11554.89WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
wdr-5.32.000e-11153.02WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
cmk-17.256e-4532.01Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wds9.210e-18081.59gene:FBgn0040066 transcript:FBtr0308566[more]
wds9.210e-18081.59gene:FBgn0040066 transcript:FBtr0070438[more]
CG109312.878e-10749.70gene:FBgn0034274 transcript:FBtr0089545[more]
CaMKI4.345e-4131.35gene:FBgn0016126 transcript:FBtr0333670[more]
CG175282.591e-4032.33gene:FBgn0261387 transcript:FBtr0111274[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr50.000e+084.44WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr55.809e-9081.25WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
dclk2a2.931e-4535.47doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
pafah1b1a3.340e-4530.72platelet-activating factor acetylhydrolase 1b, reg... [more]
pafah1b1a3.340e-4530.72platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4r1l0.000e+081.85protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l0.000e+081.85protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l0.000e+081.85protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l0.000e+081.85protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l0.000e+083.81protein phosphatase 4 regulatory subunit 1 like (p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr50.000e+084.13WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Wdr5b5.506e-16171.79WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr51.301e-15378.84WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Dclk11.001e-4635.34doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
Dclk11.342e-4635.34doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q498M4|WDR5_RAT0.000e+084.13WD repeat-containing protein 5 OS=Rattus norvegicu... [more]
sp|P61965|WDR5_MOUSE0.000e+084.13WD repeat-containing protein 5 OS=Mus musculus OX=... [more]
sp|P61964|WDR5_HUMAN0.000e+084.13WD repeat-containing protein 5 OS=Homo sapiens OX=... [more]
sp|Q2KIG2|WDR5_BOVIN0.000e+084.13WD repeat-containing protein 5 OS=Bos taurus OX=99... [more]
sp|Q5M786|WDR5_XENTR0.000e+081.85WD repeat-containing protein 5 OS=Xenopus tropical... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A120H2H90.000e+094.10WDR5 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A2T7NKL60.000e+084.76WD_REPEATS_REGION domain-containing protein OS=Pom... [more]
V4A8E80.000e+083.91WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A4W5N6G50.000e+084.76WD_REPEATS_REGION domain-containing protein OS=Huc... [more]
H3BHU50.000e+084.44WD repeat domain 5B OS=Latimeria chalumnae OX=7897... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr50.000e+084.44WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007963.20.000e+081.59WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr51.879e-16679.37WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007962.29.810e-15371.43WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000052579.19.810e-15371.43WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010548.11.063e-4533.87pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
pafah1b1b1.337e-4530.03platelet-activating factor acetylhydrolase 1b, reg... [more]
aurka4.801e-4233.58aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
ENSPMAT00000008862.18.074e-4033.78pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
snrnp407.673e-3831.86small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SWD31.598e-4135.14Essential subunit of the COMPASS (Set1C) complex; ... [more]
CMK24.283e-3532.29Calmodulin-dependent protein kinase; may play a ro... [more]
CMK17.291e-3530.66Calmodulin-dependent protein kinase; may play a ro... [more]
IPL16.323e-3432.81Aurora kinase of chromosomal passenger complex; me... [more]
RSA41.006e-3028.49WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332976.237e-17679.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424321.321e-5236.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444886.771e-4736.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362532.268e-4532.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348651.434e-4433.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr50.000e+084.13WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr51.422e-17481.07WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
dclk32.130e-4932.71doublecortin like kinase 3 [Source:NCBI gene;Acc:1... [more]
PAFAH1B17.677e-4530.42platelet activating factor acetylhydrolase 1b regu... [more]
PAFAH1B17.677e-4530.42platelet activating factor acetylhydrolase 1b regu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080647.10.000e+099.64SMESG000080647.1[more]
SMESG000010854.11.112e-70100.00SMESG000010854.1[more]
SMESG000010878.18.001e-6797.32SMESG000010878.1[more]
SMESG000072629.11.594e-4935.74SMESG000072629.1[more]
SMESG000072629.12.881e-4935.74SMESG000072629.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007895 ID=SMED30007895|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4525bp
AAATTATTATAACTTTGATACAATAAATTTATCAATATGATTCATAAGCA
ACTTGAAAGAAACAAAATTAATTACTTAGATCCTAAAAATATTCGTATTT
ATGTTAATAATAATGAGAATTTTAAAGGAATAAATGTATCAGTAACTAAA
AATAGATACAAAAATTTCGAGAATTTTCTTCAAGACTTAGATTATAAACT
AAAACAACATGTTTTCTTAGCAACCGGCGCCAGAAAATTGTATAACAAGT
ATGGGAAAACTATTTATTCGTTATTAGATATCGTTGATTCGGAGAATTAT
ATCGTTGGTGGATTGGAACCTCTTAACAAGAAAGCTCTTAAAAAATTCGA
AATAGAGCCAAATATTGAAAAGTTTGCACAACTCCAAATTCCACACCAAG
CAAAATCTAAGAATGAAAAAAAGGCACTAATTGACAAATACAAACTGATA
TCTTTTATCGAAAAATATCCAGAAATTAATAAAAGATATGAAATGCATAA
TTCAATTGGATATGGAAGCCATTCAAAAGTATATTGTGGCCAAGATAAAA
GTAATGGTGGTTTAGTAGCTATTAAAATCATTCGTAAAAATTTCATTTCT
GTAAAATGTGAATCTATATATGATGAATTATCGATCTTGAAAAATTTAGA
TCATGTAAACATTATAAAATTAGTGGATCACATTGATTCTGACAAAAGGT
TAACATTAATATTTGATCTGGCTACAAAAGGTGATTTATTTCAAATTCTT
AAAGAAAGAGGTTCACTGACAGAAAATCACACAGCTTCAATTATTAACGA
TATCGGATCAGCTTTACTTTATCTTCACAAAAACAGAATTGTTCACAGAA
ATGTAAAATTAGAAAATATAGTGGTTTTTAAAATAAGTTATTGGCGTGTA
TTTTCAAAATTAGCGGATTTTAGTTTATCTATCAAAATATTTAAGCCTAT
CTGTGAAGTTTGTGGGTCTATTAATTATATTAGTCCTGAAATGGCAAGAG
GAAAAGAGTACAGTTACCCTGTCGATTTGTGGTCTATGGGTGTTGTATGC
TATATTCTACTATCTGGTTTACCTCCATTTTACAGTATAAATGGAGACAA
AATAGAAATTCTGGACAAAATAAGAAATTGTGATTATACTTTTCCAATTA
TATTTTGGTCCCATTTATCAAACGAATCAAAGGAGTTAATCAATATGTTG
TTGCAGCATAACCCAGTCGACAGATTATCAGCTACAGATTTACTGTGTAA
TAAATGGGTTGTTGCTAATGGTAACATAACCAGTAAAAGTAACGGTCGAG
TCCCTGAAAAAGTTATTAAAAGAAAATACGAATTGGAAGGTATTGATATT
GATCAAGAAAAAAATACAGAAAGTAAAACTAAAACTATATTTGGTTCGAT
TAAATCATTTTTCCACGGAACATGTCAAAATAATTCGATCAAATCTTTCC
TTGGGCCAAGCTACATAAAAATCGGTCGTCGAATGATAAACATACAATCG
ACAAAACCAGACGTTGACAGTTTATTCAATTAACAAAATTAATAATTTAT
TAAAGTAAAAATTGTACACGATTTGATCCATCAATTTTCACCTCTCCACA
ATTTAATAGTTTTGTCATTTTCCAAAGCAGCTGAGGCAATAATGTTTTCA
GTTGGGTGACAAGATGTTGCGATAACGACATCAGTATGTCCATAAAGTTT
CTGAACAATTTCTTTTGTTTGAAGATTCCAAATATAAACCATATTGTCTT
CCGATCCTGAAACAATCCATTTTCCACTAGTTACTGAAAAATTCGAGAAA
ATGCAATACTTTTCGTTTTTGTGACCCACATATGTCTTTAAACATTTTCC
TTTAGCATAGTCCCATAGTTTGAGAACATTGTCCAATGAACCAGTAAGGA
TATATTTACCATTAGGTGAAAATTTTACAAATGAAACTGGTGGATTATCA
TCGTCTATTAATGTTTTTAAACATTGTCCAGATGATGCATCCCAGATACG
ACATAGTCCGTCATAACTGCTCGAAACAATCAATGACCCATCACGATTAA
AGTGAACAGCAGTTACTGGATCTGCATGAGCAGGAAGTGTTTTAAGACAT
TTACCACTTTTAACATCCCATATCTTAACGCTCTCGTCGAACGATCCAGA
CACTATTAAATTAGATTGTGGGTTAAAATTACAACAGAAAACATAATTTG
TATGGCCCTTTAATGTTTTAATACATTTACCACTAGCTAAATCCCAAATT
TTTAACGTTTTGTCATCAGATGCACTACATAACGTCTTTGAATCAGTTGA
CCAAGCTACGTCACATACACCCTTTACATCAATTAAATTATTTTATCATA
GTAGATATTATACTAATTTATGACCACTAATAGTTTTTTCAATTTTTCCA
TCATATGCACCCCATATCTTAATTAATTTATCAGAAGATGAACTAGCCAA
CCAATCACCATTAGGGCTAAATTTGACAGAAGAAACACCTTTAGTATGAC
CAGCGAGAGTAAATTTGAGGGTATAATTTGGATTTTTAACATCAGCCATG
ACTAAATTATTTTAAAATATTTGCAATTAAAAATCAACGTTTGCACTTTT
TAATCAATAAAAATAAAAATCGTTAAAATTCAATAAGCGAAATCAATAAT
CTCCGTTATAAGTTTCAGAAAATGGCGACTTTTAGTCAACATGGCCACCT
CGTCAATATGGATTCCATCGAGAGGAAAAATTGTTTGTCTTTTAATGCGA
TCCATTCTTTGAACCATTTTTTGATTTCCTCGTGGGTTCTAAAGTAACGG
TCTTGAAGAGCGCTTTGTATTAATCGAAAAACGAAGTCAAATGATGGGGC
ACAATCTGGTGAGTAGTTAGCATGTGGTAGGATTTCCTATTTAAGTGCTT
CTAACGTATTTTATTACTTGTTTTGCAACATGTGGTCGAGCATTTTCGTG
AAGCAAAATCACTTTATGATCTTTGTTGACGTTTTTCGTTCAATTCATGG
TACAAATCTATCAATTGTTGTTGGTAACGTTCAGCAGTAATAGTTTCGTT
CGGTTTTAGTGGTTCATATTACACCACTCCTTTCTGATCCAACCAAAAAC
ACAGCATAACTTTACTTCCATTAATGTTTCGAATGGTTCACCTGGAAAAA
ACTCATAATTAATGCGGAATTTCAACTTTTTAAAGCGCCGTAGGTGTCAG
TGTCAAAGAATGTTTAGTACAAAAGTTATACGCCCAATAGAAAAGTGATA
ATTGTGAATCGATGCTAAAAACTAATTATGACATGTATTTTTCTATTTTA
TATTTACCTGCATGACACAATTTCTTATGATATTAACCAATAAATGCGTT
ACTACTGTCATCTGGTATCCAAATTTTACCTTCGATCGTTTTAACATTAT
TATTTTCGACTTTAAATTTTGAATTTATTGAGCCACTAGATTTAATGGTT
TTTATTTCATTACTATCTTTTTGCCATTTATCAAATAGATTTTCTGTCAT
TGTTGCAAATAATTTTTTTTCAGTTTCCCAATCTTTGCTTCTGGATGAAT
TGTTTGACACTGAGTACACATTACACAGTCACTTCTCGATAATGAATATG
CGTTCTCGTGAAGTTCATCTTTTCTGTATTCAAATTCAATATCTAGCCTA
CTAAGATGGCTCATCCAAGTTTTAAATTATGCGGTTGTGTTTTTATGTTT
TTATCATAAATGTAAGAGCTTTATGGTCTGTTCTAAGTTTTAATCGTTTT
CCATACAGATAATGCTTGAAGTGAACTGTAAAGTGATAAGCGGCTAAAAG
CTCTTATCTTGTAATACAATATCTCAATTGTGTTTATTGATGGCTTTTAA
CCCATATGTGATTACCCTTTTTCCTTTTTTCATTTAACTGTGACAACATC
GCACCAATTCTATCAAAACTGGCATCAGTATCTAAAATAAAACTCTTATT
AAAGTCTGAATATATCAGAATTGGTGCCATGCAAAATTTCTCTTTTAGTT
CTACGAAAGCTTCTGGCACTTTCATGACAATATTAATTTTTTATTTTTAC
TGCTTGTTAACGATTCTAAGGGGTTTTAATACTTTGTGTAATTGTCTATA
AATTTCCGGTAATAATTTGATAACCATAGAATGTTGTATCAATGATAAGT
TGTAACAAAATTGGAAGATGCACTGCCACAAATAGAATATACATTGAATG
CGACACATCAGAAGACTAATAAAAATTCCCCAGTAGATATATTTGACAAA
CGCATAAACAAAAATTGTTTCGTAGATAGAACTTTTAACGTTGGAGAAAA
AGTATTAGTTAAAATAGATTTATGAAATAAAGATGATAATCGATATCGAG
GCCCATGGAGACAATAAAGAAAATACATGAAAACAGTTATGAAATGTTAG
ATAATTCAGGTTCTACAATTATTCGGAATATTGAATGTTTAAAATCTTTT
AAAGTGGGGGGGGGATAAAAGTAATCTAATAATTAAATGACCTAATTAAT
AATTATTATGAATGGTTTGATGCAT
back to top

protein sequence of SMED30007895-orf-1

>SMED30007895-orf-1 ID=SMED30007895-orf-1|Name=SMED30007895-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MIHKQLERNKINYLDPKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQD
LDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKA
LKKFEIEPNIEKFAQLQIPHQAKSKNEKKALIDKYKLISFIEKYPEINKR
YEMHNSIGYGSHSKVYCGQDKSNGGLVAIKIIRKNFISVKCESIYDELSI
LKNLDHVNIIKLVDHIDSDKRLTLIFDLATKGDLFQILKERGSLTENHTA
SIINDIGSALLYLHKNRIVHRNVKLENIVVFKISYWRVFSKLADFSLSIK
IFKPICEVCGSINYISPEMARGKEYSYPVDLWSMGVVCYILLSGLPPFYS
INGDKIEILDKIRNCDYTFPIIFWSHLSNESKELINMLLQHNPVDRLSAT
DLLCNKWVVANGNITSKSNGRVPEKVIKRKYELEGIDIDQEKNTESKTKT
IFGSIKSFFHGTCQNNSIKSFLGPSYIKIGRRMINIQSTKPDVDSLFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001632Gprotein_B
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR001888Transposase_1
IPR003533Doublecortin_dom
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding