Exportin 1 (CRM1 homolog, yeast) b

Overview
NameExportin 1 (CRM1 homolog, yeast) b
Smed IDSMED30007894
Length (bp)3401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exportin 1 (CRM1 homolog, yeast) b (SMED30007894) t-SNE clustered cells

Violin plots show distribution of expression levels for Exportin 1 (CRM1 homolog, yeast) b (SMED30007894) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exportin 1 (CRM1 homolog, yeast) b (SMED30007894) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exportin 1 (CRM1 homolog, yeast) b (SMED30007894) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007894

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007894SMESG000025559.1 SmedASXL_010548SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007894SMESG000025559.1 SmedASXL_010548SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30007894SMESG000025559.1 dd_Smed_v4_3264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30007894SMESG000025559.1 dd_Smed_v4_3264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30007894SMESG000025559.1 dd_Smed_v4_3264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 1474.92 bits (3817), Expect = 0.000e+0
Identity = 701/1074 (65.27%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+L ++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+ +L+         +P +N +++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQA EEK + + SVPGI NPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP-------GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 1474.92 bits (3817), Expect = 0.000e+0
Identity = 701/1074 (65.27%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+L ++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+ +L+         +P +N +++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQA EEK + + SVPGI NPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP-------GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 1474.92 bits (3817), Expect = 0.000e+0
Identity = 701/1074 (65.27%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+L ++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+ +L+         +P +N +++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQA EEK + + SVPGI NPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP-------GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 270.781 bits (691), Expect = 1.402e-83
Identity = 125/170 (73.53%), Postives = 150/170 (88.24%), Query Frame = 3
Query:   99 ENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVF 608
            ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVF
Sbjct:   10 DHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVF 179          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 187.193 bits (474), Expect = 2.142e-54
Identity = 86/123 (69.92%), Postives = 105/123 (85.37%), Query Frame = 3
Query:   99 ENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNM 467
            ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNM
Sbjct:   10 DHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNM 132          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Match: xpo-1 (EXPOrtin (Nuclear export receptor) [Source:UniProtKB/TrEMBL;Acc:Q8MPS6])

HSP 1 Score: 1025 bits (2649), Expect = 0.000e+0
Identity = 511/1075 (47.53%), Postives = 739/1075 (68.74%), Query Frame = 3
Query:  135 KLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANV----SGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIE--------SKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYR-----QNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAK--QVFYKNFFLEVLHHMFSVVTDSS--HAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEI-TEDM 3293
            ++D++LLD VV+ M   +G EQ  A +IL +LKE  D+W +VD+IL+ S   ++KY+ALQILE VI+ KWK LP+VQ EGIK YI+  + + SS+  ++E  ++ L KLN++LVQI+K +WPK WPTFI DIV SS++NE +C NNM I+ LLSEEVFDF    +TQ K +HLK   C +F  +F LC  +L    +  +V +TL+TL +F+ WIP+GY+FETN+ + L   FL++ ++R + LQCLTE++ +    +   Y    + +F +T   + ++L+   ++   Y    D +QK I +++ F  +    H+ LIE        +K  +R   + A + +L I+ +EE E+FK+CL+ W  + ++LYR     Q   + Y M     + P+R L Y   LS+LR  MISRMA+PEEVL+VEN+QGEVVRE +KDTDSI LY+NMRE LVYLTHLD  DT+  MT+KL  Q++G E+SWKNLN LCWA+GSISG+M E+DE+RFLV+ IRDLL LCEQKRGKDNKA++ASNIMYVVGQYPRFL+AHW+FLKTVI KLFEFMHETH+GVQDMACDTFIKI++KC+R FV +Q  E   FV+E+L  +  II DL   QVH FYEA+G +++A+ D  +Q +LI KL  +PN+ W+DII  A  N  +L+ P++VK ++NILKTN +ACKS+G+S+V QL +IY D+L++YK++SE ++ AVT  GE+  K P+++ MRAVK+E L ++S+++ K+ D  ++ ++ +PP+ DA+LFDYQ+N+  AREP+VLS ++ ++ +L   +   +P+IL AVF+C+++MINKDME +PEHRTNFF L+ ++ Q+ F  F  +P E    ++D+++WA +HTMR V+E GL+IL  LL  V    EQ+ K  Q FYK +++++L H+ +V  DSS  H   LT    +L ++F+  E    ++ + +    P     Q N+ Y+   +    +  F  +   QI++ I+G FSFN ++   R ++RDFL+QI+E  G+D SDL+LEE+E EI+QAQ+ K+     VPGIL P E+  EDM
Sbjct:   21 RIDVTLLDQVVEIMNRMSGKEQAEANQILMSLKEERDSWTKVDAILQYSQLNESKYFALQILETVIQHKWKSLPQVQREGIKSYIITKMFELSSDQSVMEQSQLLLHKLNLVLVQIVKQDWPKAWPTFITDIVDSSKNNETVCINNMNILSLLSEEVFDFGSQNLTQAKEQHLKQQFCGQFQEVFTLCVSILEKCPSNSMVQATLKTLQRFLTWIPVGYVFETNITELLSENFLSLEVYRVIALQCLTEISQIQVETNDPSYDEKLVKMFCSTMRHISQVLSLDLDLAAVYKDASDQDQKLISSLAQFLVAFIKEHVHLIEVTDEPLTEAKILMRESHDYAIQLLLKITLIEEMEVFKVCLDCWCWLTAELYRICPFIQPSTL-YGMMSQVREHPRRQL-YREYLSQLRSTMISRMAKPEEVLIVENDQGEVVREMVKDTDSIALYRNMRETLVYLTHLDNKDTEVKMTEKLASQVNGGEFSWKNLNRLCWAVGSISGTMVEEDEKRFLVLVIRDLLGLCEQKRGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVINKLFEFMHETHEGVQDMACDTFIKISIKCKRHFVIVQPAENKPFVEEMLENLTGIICDLSHAQVHVFYEAVGHIISAQIDGNLQEDLIMKLMDIPNRTWNDIIAAASTNDSVLEEPEMVKSVLNILKTNVAACKSIGSSFVTQLGNIYSDLLSLYKILSEKVSRAVTTAGEEALKNPLVKTMRAVKREILILLSTFISKNGDAKLILDSIVPPLFDAVLFDYQKNVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSAVFQCSIDMINKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILKELLARVS---EQDDKIAQPFYKRYYIDLLKHVLAVACDSSQVHVAGLTYYAEVLCALFRAPE---FSIKVPLNDANP----SQPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEIQQAQQRKR----DVPGILKPDEVEDEDM 1079          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Match: xpo-1 (EXPOrtin (Nuclear export receptor) [Source:UniProtKB/TrEMBL;Acc:Q8MPS6])

HSP 1 Score: 1025 bits (2649), Expect = 0.000e+0
Identity = 511/1075 (47.53%), Postives = 739/1075 (68.74%), Query Frame = 3
Query:  135 KLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANV----SGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIE--------SKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYR-----QNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAK--QVFYKNFFLEVLHHMFSVVTDSS--HAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEI-TEDM 3293
            ++D++LLD VV+ M   +G EQ  A +IL +LKE  D+W +VD+IL+ S   ++KY+ALQILE VI+ KWK LP+VQ EGIK YI+  + + SS+  ++E  ++ L KLN++LVQI+K +WPK WPTFI DIV SS++NE +C NNM I+ LLSEEVFDF    +TQ K +HLK   C +F  +F LC  +L    +  +V +TL+TL +F+ WIP+GY+FETN+ + L   FL++ ++R + LQCLTE++ +    +   Y    + +F +T   + ++L+   ++   Y    D +QK I +++ F  +    H+ LIE        +K  +R   + A + +L I+ +EE E+FK+CL+ W  + ++LYR     Q   + Y M     + P+R L Y   LS+LR  MISRMA+PEEVL+VEN+QGEVVRE +KDTDSI LY+NMRE LVYLTHLD  DT+  MT+KL  Q++G E+SWKNLN LCWA+GSISG+M E+DE+RFLV+ IRDLL LCEQKRGKDNKA++ASNIMYVVGQYPRFL+AHW+FLKTVI KLFEFMHETH+GVQDMACDTFIKI++KC+R FV +Q  E   FV+E+L  +  II DL   QVH FYEA+G +++A+ D  +Q +LI KL  +PN+ W+DII  A  N  +L+ P++VK ++NILKTN +ACKS+G+S+V QL +IY D+L++YK++SE ++ AVT  GE+  K P+++ MRAVK+E L ++S+++ K+ D  ++ ++ +PP+ DA+LFDYQ+N+  AREP+VLS ++ ++ +L   +   +P+IL AVF+C+++MINKDME +PEHRTNFF L+ ++ Q+ F  F  +P E    ++D+++WA +HTMR V+E GL+IL  LL  V    EQ+ K  Q FYK +++++L H+ +V  DSS  H   LT    +L ++F+  E    ++ + +    P     Q N+ Y+   +    +  F  +   QI++ I+G FSFN ++   R ++RDFL+QI+E  G+D SDL+LEE+E EI+QAQ+ K+     VPGIL P E+  EDM
Sbjct:   21 RIDVTLLDQVVEIMNRMSGKEQAEANQILMSLKEERDSWTKVDAILQYSQLNESKYFALQILETVIQHKWKSLPQVQREGIKSYIITKMFELSSDQSVMEQSQLLLHKLNLVLVQIVKQDWPKAWPTFITDIVDSSKNNETVCINNMNILSLLSEEVFDFGSQNLTQAKEQHLKQQFCGQFQEVFTLCVSILEKCPSNSMVQATLKTLQRFLTWIPVGYVFETNITELLSENFLSLEVYRVIALQCLTEISQIQVETNDPSYDEKLVKMFCSTMRHISQVLSLDLDLAAVYKDASDQDQKLISSLAQFLVAFIKEHVHLIEVTDEPLTEAKILMRESHDYAIQLLLKITLIEEMEVFKVCLDCWCWLTAELYRICPFIQPSTL-YGMMSQVREHPRRQL-YREYLSQLRSTMISRMAKPEEVLIVENDQGEVVREMVKDTDSIALYRNMRETLVYLTHLDNKDTEVKMTEKLASQVNGGEFSWKNLNRLCWAVGSISGTMVEEDEKRFLVLVIRDLLGLCEQKRGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVINKLFEFMHETHEGVQDMACDTFIKISIKCKRHFVIVQPAENKPFVEEMLENLTGIICDLSHAQVHVFYEAVGHIISAQIDGNLQEDLIMKLMDIPNRTWNDIIAAASTNDSVLEEPEMVKSVLNILKTNVAACKSIGSSFVTQLGNIYSDLLSLYKILSEKVSRAVTTAGEEALKNPLVKTMRAVKREILILLSTFISKNGDAKLILDSIVPPLFDAVLFDYQKNVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSAVFQCSIDMINKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILKELLARVS---EQDDKIAQPFYKRYYIDLLKHVLAVACDSSQVHVAGLTYYAEVLCALFRAPE---FSIKVPLNDANP----SQPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEIQQAQQRKR----DVPGILKPDEVEDEDM 1079          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Match: xpo-1 (EXPOrtin (Nuclear export receptor) [Source:UniProtKB/TrEMBL;Acc:Q8MPS6])

HSP 1 Score: 1025 bits (2649), Expect = 0.000e+0
Identity = 511/1075 (47.53%), Postives = 739/1075 (68.74%), Query Frame = 3
Query:  135 KLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANV----SGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIE--------SKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYR-----QNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAK--QVFYKNFFLEVLHHMFSVVTDSS--HAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEI-TEDM 3293
            ++D++LLD VV+ M   +G EQ  A +IL +LKE  D+W +VD+IL+ S   ++KY+ALQILE VI+ KWK LP+VQ EGIK YI+  + + SS+  ++E  ++ L KLN++LVQI+K +WPK WPTFI DIV SS++NE +C NNM I+ LLSEEVFDF    +TQ K +HLK   C +F  +F LC  +L    +  +V +TL+TL +F+ WIP+GY+FETN+ + L   FL++ ++R + LQCLTE++ +    +   Y    + +F +T   + ++L+   ++   Y    D +QK I +++ F  +    H+ LIE        +K  +R   + A + +L I+ +EE E+FK+CL+ W  + ++LYR     Q   + Y M     + P+R L Y   LS+LR  MISRMA+PEEVL+VEN+QGEVVRE +KDTDSI LY+NMRE LVYLTHLD  DT+  MT+KL  Q++G E+SWKNLN LCWA+GSISG+M E+DE+RFLV+ IRDLL LCEQKRGKDNKA++ASNIMYVVGQYPRFL+AHW+FLKTVI KLFEFMHETH+GVQDMACDTFIKI++KC+R FV +Q  E   FV+E+L  +  II DL   QVH FYEA+G +++A+ D  +Q +LI KL  +PN+ W+DII  A  N  +L+ P++VK ++NILKTN +ACKS+G+S+V QL +IY D+L++YK++SE ++ AVT  GE+  K P+++ MRAVK+E L ++S+++ K+ D  ++ ++ +PP+ DA+LFDYQ+N+  AREP+VLS ++ ++ +L   +   +P+IL AVF+C+++MINKDME +PEHRTNFF L+ ++ Q+ F  F  +P E    ++D+++WA +HTMR V+E GL+IL  LL  V    EQ+ K  Q FYK +++++L H+ +V  DSS  H   LT    +L ++F+  E    ++ + +    P     Q N+ Y+   +    +  F  +   QI++ I+G FSFN ++   R ++RDFL+QI+E  G+D SDL+LEE+E EI+QAQ+ K+     VPGIL P E+  EDM
Sbjct:   21 RIDVTLLDQVVEIMNRMSGKEQAEANQILMSLKEERDSWTKVDAILQYSQLNESKYFALQILETVIQHKWKSLPQVQREGIKSYIITKMFELSSDQSVMEQSQLLLHKLNLVLVQIVKQDWPKAWPTFITDIVDSSKNNETVCINNMNILSLLSEEVFDFGSQNLTQAKEQHLKQQFCGQFQEVFTLCVSILEKCPSNSMVQATLKTLQRFLTWIPVGYVFETNITELLSENFLSLEVYRVIALQCLTEISQIQVETNDPSYDEKLVKMFCSTMRHISQVLSLDLDLAAVYKDASDQDQKLISSLAQFLVAFIKEHVHLIEVTDEPLTEAKILMRESHDYAIQLLLKITLIEEMEVFKVCLDCWCWLTAELYRICPFIQPSTL-YGMMSQVREHPRRQL-YREYLSQLRSTMISRMAKPEEVLIVENDQGEVVREMVKDTDSIALYRNMRETLVYLTHLDNKDTEVKMTEKLASQVNGGEFSWKNLNRLCWAVGSISGTMVEEDEKRFLVLVIRDLLGLCEQKRGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVINKLFEFMHETHEGVQDMACDTFIKISIKCKRHFVIVQPAENKPFVEEMLENLTGIICDLSHAQVHVFYEAVGHIISAQIDGNLQEDLIMKLMDIPNRTWNDIIAAASTNDSVLEEPEMVKSVLNILKTNVAACKSIGSSFVTQLGNIYSDLLSLYKILSEKVSRAVTTAGEEALKNPLVKTMRAVKREILILLSTFISKNGDAKLILDSIVPPLFDAVLFDYQKNVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSAVFQCSIDMINKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILKELLARVS---EQDDKIAQPFYKRYYIDLLKHVLAVACDSSQVHVAGLTYYAEVLCALFRAPE---FSIKVPLNDANP----SQPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEIQQAQQRKR----DVPGILKPDEVEDEDM 1079          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Match: xpo-1 (EXPOrtin (Nuclear export receptor) [Source:UniProtKB/TrEMBL;Acc:Q8MPS6])

HSP 1 Score: 82.4185 bits (202), Expect = 7.381e-19
Identity = 41/78 (52.56%), Postives = 57/78 (73.08%), Query Frame = 3
Query: 3063 QIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEI-TEDM 3293
            QI++ I+G FSFN ++   R ++RDFL+QI+E  G+D SDL+LEE+E EI+QAQ+ K+     VPGIL P E+  EDM
Sbjct:    5 QIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEIQQAQQRKR----DVPGILKPDEVEDEDM 78          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Match: xpo-1 (EXPOrtin (Nuclear export receptor) [Source:UniProtKB/TrEMBL;Acc:Q8MPS6])

HSP 1 Score: 82.4185 bits (202), Expect = 7.381e-19
Identity = 41/78 (52.56%), Postives = 57/78 (73.08%), Query Frame = 3
Query: 3063 QIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEI-TEDM 3293
            QI++ I+G FSFN ++   R ++RDFL+QI+E  G+D SDL+LEE+E EI+QAQ+ K+     VPGIL P E+  EDM
Sbjct:    5 QIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEIQQAQQRKR----DVPGILKPDEVEDEDM 78          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Fly
Match: emb (gene:FBgn0020497 transcript:FBtr0079663)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 630/1072 (58.77%), Postives = 816/1072 (76.12%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNM--NQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAP-AREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            +  + A +LLDF+QKLDI+LLD +V+ +YT  G + ++A+ ILTTLKEHP+AW RVDSILE S NQ+TK+YALQILE VIK +WKVLPR QCEGIKKY+V LIIKTSS+  ++E  KVYL KLNMILV ILK EWP+NW TFI DIVG+S++NE+LC NNMVI+K LSEEVFDFS GQ+TQTK KHLKD+MCSEFS IF LC +VL +S NA L+  TLETLL+F++WIPLGYIFET   +TLI KFL+VPMFRNVTL+CL+E+A ++ + Y   F  +F++T   L++++    N+   + +G D EQ+ + N+++F  +    H +L+E  + +   LN A  Y++ ISEVE+ E+FKICLE WN +V DLY  N E  +    +     +  R  FYAPILS++R IMISRMA+PEEVLVVENE GEVVREFMKDT+SINLYKNMRE LV+LTHLD  DTD+IMT KL  Q++GSE+SWKNLNTLCWAIGSISG+  E+DE+RFLV  I+DLL LCEQK+GKDNKAI+ASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA+KCRR FVT+Q  E  TF+DEIL  +++II DL PQQVHTFYEA+G +++A+ D V Q  LI +   LPNQVWDDII++A +N++ L+N   VKQ+ +ILKTN +ACK+LG +YV QL  IY+DMLNVYK+ SENI  A+  +G  V  QP+I+ M  VKKE L +IS WV +S D  +V +NFIPP+LDAIL DYQR   P AREP+VLS++A I+++L QHI   +P I DAVFECTL+MINK+ E++P+HR +F+ LL+AVN   F AF  +P  +FKL+ DS++WA KHTMR V++ GLNIL  +LQN++      A Q FY+ +F ++L  +FSVVTD+SH   L     IL+ MF  +E+ KITVNL     GP+     DN++++Q  +A+LLK AF  L D Q+KVF+ GLF+ ++++  F+E++RDFL+QIRE  G+D SDL+LEE+E  + + Q  K +++ ++PG+LNPHE+ EDM D
Sbjct:    5 LTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLY--NSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLD--QHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL-----GPI----PDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQD 1062          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Fly
Match: emb (gene:FBgn0020497 transcript:FBtr0346708)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 630/1072 (58.77%), Postives = 816/1072 (76.12%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNM--NQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAP-AREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            +  + A +LLDF+QKLDI+LLD +V+ +YT  G + ++A+ ILTTLKEHP+AW RVDSILE S NQ+TK+YALQILE VIK +WKVLPR QCEGIKKY+V LIIKTSS+  ++E  KVYL KLNMILV ILK EWP+NW TFI DIVG+S++NE+LC NNMVI+K LSEEVFDFS GQ+TQTK KHLKD+MCSEFS IF LC +VL +S NA L+  TLETLL+F++WIPLGYIFET   +TLI KFL+VPMFRNVTL+CL+E+A ++ + Y   F  +F++T   L++++    N+   + +G D EQ+ + N+++F  +    H +L+E  + +   LN A  Y++ ISEVE+ E+FKICLE WN +V DLY  N E  +    +     +  R  FYAPILS++R IMISRMA+PEEVLVVENE GEVVREFMKDT+SINLYKNMRE LV+LTHLD  DTD+IMT KL  Q++GSE+SWKNLNTLCWAIGSISG+  E+DE+RFLV  I+DLL LCEQK+GKDNKAI+ASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA+KCRR FVT+Q  E  TF+DEIL  +++II DL PQQVHTFYEA+G +++A+ D V Q  LI +   LPNQVWDDII++A +N++ L+N   VKQ+ +ILKTN +ACK+LG +YV QL  IY+DMLNVYK+ SENI  A+  +G  V  QP+I+ M  VKKE L +IS WV +S D  +V +NFIPP+LDAIL DYQR   P AREP+VLS++A I+++L QHI   +P I DAVFECTL+MINK+ E++P+HR +F+ LL+AVN   F AF  +P  +FKL+ DS++WA KHTMR V++ GLNIL  +LQN++      A Q FY+ +F ++L  +FSVVTD+SH   L     IL+ MF  +E+ KITVNL     GP+     DN++++Q  +A+LLK AF  L D Q+KVF+ GLF+ ++++  F+E++RDFL+QIRE  G+D SDL+LEE+E  + + Q  K +++ ++PG+LNPHE+ EDM D
Sbjct:    5 LTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLY--NSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLD--QHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL-----GPI----PDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQD 1062          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Fly
Match: Ranbp21 (gene:FBgn0031051 transcript:FBtr0340614)

HSP 1 Score: 51.2174 bits (121), Expect = 7.159e-6
Identity = 48/229 (20.96%), Postives = 98/229 (42.79%), Query Frame = 3
Query:  282 NNQQTKYYALQILENVIKCKWKVLPR-----VQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTK-----------------IKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLN-QTLITKFLNVPMFRNVTLQCLTEMANVSG 899
            +NQQ +++ LQ++E  IK +W  +       ++   IK   VG  +  + +  +L  +      L+ I+V+++K EWP+ W   + ++  +    EA  +  +++   L E+V      +  Q +                    L +   + F    +LC Y   ++ ++ +V   L TL  F+ W+ + +I  +N      +   LN   F+    +CL ++ N  G
Sbjct:   61 SNQQVRHFGLQLIEYTIKYRWNCITHEEKVYIKDNAIKMLNVG--VGPAEDRSLLPTKDA----LSRIIVEMIKREWPQQWSDLLPELSQACTKGEAQTELVLLVFLRLVEDVALLQTIESNQRRKDMYQALNNNMNDIFEFFLRLVEQHVTAFRETTRLCNYTKANA-HSRVVEMVLLTLSGFVEWVSIQHIMSSNGKLMHFLCILLNDKAFQCNAAECLAQITNRKG 282          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Fly
Match: Ranbp21 (gene:FBgn0031051 transcript:FBtr0074759)

HSP 1 Score: 51.2174 bits (121), Expect = 7.159e-6
Identity = 48/229 (20.96%), Postives = 98/229 (42.79%), Query Frame = 3
Query:  282 NNQQTKYYALQILENVIKCKWKVLPR-----VQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTK-----------------IKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLN-QTLITKFLNVPMFRNVTLQCLTEMANVSG 899
            +NQQ +++ LQ++E  IK +W  +       ++   IK   VG  +  + +  +L  +      L+ I+V+++K EWP+ W   + ++  +    EA  +  +++   L E+V      +  Q +                    L +   + F    +LC Y   ++ ++ +V   L TL  F+ W+ + +I  +N      +   LN   F+    +CL ++ N  G
Sbjct:   61 SNQQVRHFGLQLIEYTIKYRWNCITHEEKVYIKDNAIKMLNVG--VGPAEDRSLLPTKDA----LSRIIVEMIKREWPQQWSDLLPELSQACTKGEAQTELVLLVFLRLVEDVALLQTIESNQRRKDMYQALNNNMNDIFEFFLRLVEQHVTAFRETTRLCNYTKANA-HSRVVEMVLLTLSGFVEWVSIQHIMSSNGKLMHFLCILLNDKAFQCNAAECLAQITNRKG 282          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Match: xpo1b (exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Acc:ZDB-GENE-070530-6])

HSP 1 Score: 1488.4 bits (3852), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 861/1074 (80.17%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI+LLD VV+C+Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+++F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+ +       +P +N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFNQKLDINLLDNVVNCLYHGVGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDAANVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITGEIPQIFDAVFECTLNMINKDFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTTLNPS-------NPVNNQVFIQEYVANLLKSAFPHLQDAQVKVFVTGLFSLNQDIAAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Match: xpo1b (exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Acc:ZDB-GENE-070530-6])

HSP 1 Score: 1488.4 bits (3852), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 861/1074 (80.17%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI+LLD VV+C+Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+++F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+ +       +P +N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:   18 LADHAARQLLDFNQKLDINLLDNVVNCLYHGVGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDAANVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITGEIPQIFDAVFECTLNMINKDFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTTLNPS-------NPVNNQVFIQEYVANLLKSAFPHLQDAQVKVFVTGLFSLNQDIAAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1081          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Match: xpo1a (exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Acc:ZDB-GENE-050309-201])

HSP 1 Score: 1471.45 bits (3808), Expect = 0.000e+0
Identity = 694/1074 (64.62%), Postives = 862/1074 (80.26%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++TA QLLDF+QKLDI+LLD VV+ MY   GS+Q++A+++LT LK+HPDAW RVD+ILE S N +TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E E+VY+ KLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+++F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSW+NLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ V+Q+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+ ++GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+L+A+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTL MINK+ EE+PEHRT+FF LL+AVN + F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  +LQN+    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+V L+    G       +N  YVQ+ +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +I+ SVPGILNPHE+ E+M +
Sbjct:    8 LADHTARQLLDFSQKLDINLLDNVVNSMYYDVGSQQRLAQEVLTNLKDHPDAWTRVDTILEFSQNMKTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDANSVEKEQVYISKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSTSQH-FDVPPRRHLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWRNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQERLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVRQLGSILKTNVRACKAVGHPFVLQLGRIYLDMLNVYKCLSENISSAIQSNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLEAVLIDYQRNVPAAREPEVLSTMATIVNKLGSHITGEIPKIFDAVFECTLEMINKNFEEFPEHRTHFFYLLQAVNSQCFPAFLSIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTMLQNIA--QEEAAAQSFYQTYFFDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISVALNAGTAG-------NNQGYVQDYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDSTDLFLEEREASLRQAQEEKHKIQLSVPGILNPHELPEEMCE 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Match: xpo1a (exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Acc:ZDB-GENE-050309-201])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 443/640 (69.22%), Postives = 533/640 (83.28%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETD 1997
            + ++TA QLLDF+QKLDI+LLD VV+ MY   GS+Q++A+++LT LK+HPDAW RVD+ILE S N +TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E E+VY+ KLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+++F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSW+NLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD
Sbjct:    8 LADHTARQLLDFSQKLDINLLDNVVNSMYYDVGSQQRLAQEVLTNLKDHPDAWTRVDTILEFSQNMKTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDANSVEKEQVYISKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSTSQH-FDVPPRRHLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWRNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTD 646          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Match: xpo1b (exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Acc:ZDB-GENE-070530-6])

HSP 1 Score: 276.559 bits (706), Expect = 7.069e-86
Identity = 130/201 (64.68%), Postives = 158/201 (78.61%), Query Frame = 3
Query: 1188 WNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEF 1775
            WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE L                +KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEF
Sbjct:    3 WNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETL----------------EKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEF 186          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Match: XPO1 (uncharacterized LOC100145274 [Source:Xenbase;Acc:XB-GENE-5780436])

HSP 1 Score: 1491.09 bits (3859), Expect = 0.000e+0
Identity = 707/1074 (65.83%), Postives = 863/1074 (80.35%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+        ASP  N L++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+E+AG+D SDLFLEE+E+ +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDATCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSSDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNQ-------ASPLSNQLFIQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEYAGEDTSDLFLEERESSLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Match: XPO1 (uncharacterized LOC100145274 [Source:Xenbase;Acc:XB-GENE-5780436])

HSP 1 Score: 1410.97 bits (3651), Expect = 0.000e+0
Identity = 681/1074 (63.41%), Postives = 843/1074 (78.49%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAV  C        +E    +    F +++      +++F +L    FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+        ASP  N L++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+E+AG+D SDLFLEE+E+ +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDATCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSSDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITAEIPQIFDAV--CF------GLEYITVYNGYSFNVIKG----GWLSFFLL----FKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNQ-------ASPLSNQLFIQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEYAGEDTSDLFLEERESSLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1055          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Match: XPO1 (uncharacterized LOC100145274 [Source:Xenbase;Acc:XB-GENE-5780436])

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 589/945 (62.33%), Postives = 729/945 (77.14%), Query Frame = 3
Query:  480 ILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            ILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAV  C           +       + +        +++F +L    FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+        ASP  N L++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+E+AG+D SDLFLEE+E+ +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    4 ILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSSDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITAEIPQIFDAV--C-----------FGLEYITVYNVGLVCESSRWLSFFLL----FKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNQ-------ASPLSNQLFIQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEYAGEDTSDLFLEERESSLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 921          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Match: XPO1 (uncharacterized LOC100145274 [Source:Xenbase;Acc:XB-GENE-5780436])

HSP 1 Score: 97.8265 bits (242), Expect = 1.146e-22
Identity = 43/69 (62.32%), Postives = 57/69 (82.61%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTK 299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TK
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTK 76          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Match: hdac1 (histone deacetylase 1 [Source:Xenbase;Acc:XB-GENE-479583])

HSP 1 Score: 58.9214 bits (141), Expect = 5.789e-8
Identity = 50/219 (22.83%), Postives = 104/219 (47.49%), Query Frame = 3
Query:  279 SNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQ-MLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIF-----------QLCQYVLFHSQNAM-------LVVSTLETLLKFMHWIPLGYIFETNLN-QTLITKFLNVPMFRNVTLQCL 875
            S++   +++ L +LE+VIK +W  + R +   +K  ++ LI   S  M  +LE E      +  I+V++ K EWP++WP  + ++   +R  EA  +  M I+  L+E+V  F    +   + + ++ +M  +   +F           Q  Q++     N++       + V++L+TL  ++ W+ + +I   N     ++   L+ P  +    +CL
Sbjct:   57 SHSPCVRHFGLHVLEHVIKFRWNDMSREEKVCLKDSVMDLI---SHGMHPILEEESHIKDMMARIVVEMAKREWPQHWPDLLNELDSLTRVGEAQTELVMFILLRLAEDVVTFQ--NLPTQRRRDIQTTMTQKMDVLFAFMLNILQQSVQQYQHLKTDPANSVKAQGMCRVAVASLKTLAGYIDWVAITHIMADNCKLLGMLCVLLSEPELQLEAAECL 270          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Match: Xpo1 (exportin 1 [Source:MGI Symbol;Acc:MGI:2144013])

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         +P +N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Match: Xpo1 (exportin 1 [Source:MGI Symbol;Acc:MGI:2144013])

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         +P +N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Match: Xpo1 (exportin 1 [Source:MGI Symbol;Acc:MGI:2144013])

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         +P +N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Match: Xpo1 (exportin 1 [Source:MGI Symbol;Acc:MGI:2144013])

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         +P +N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Match: Xpo1 (exportin 1 [Source:MGI Symbol;Acc:MGI:2144013])

HSP 1 Score: 342.428 bits (877), Expect = 1.711e-109
Identity = 164/277 (59.21%), Postives = 196/277 (70.76%), Query Frame = 3
Query: 1542 NTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAM 2372
            NTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQ                                             N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP M
Sbjct:    2 NTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQ---------------------------------------------NVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQM 233          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Match: sp|Q80U96|XPO1_RAT (Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 PE=1 SV=1)

HSP 1 Score: 1479.92 bits (3830), Expect = 0.000e+0
Identity = 705/1074 (65.64%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         SP  N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GSPVSNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Match: sp|Q6P5F9|XPO1_MOUSE (Exportin-1 OS=Mus musculus OX=10090 GN=Xpo1 PE=1 SV=1)

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 704/1074 (65.55%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F  +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QL+E + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  DIP R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+  L+         +P +N +++Q+ +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+ET +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNP-------GNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Match: sp|O14980|XPO1_HUMAN (Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1)

HSP 1 Score: 1474.92 bits (3817), Expect = 0.000e+0
Identity = 701/1074 (65.27%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF+QKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYY LQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNV+L+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+L ++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+LDA+L DYQRN+  AREPEVLS++A I+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+ +L+         +P +N +++Q  +A LLK AFP LQD Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQA EEK + + SVPGI NPHEI E+M D
Sbjct:    8 LADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH-FDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP-------GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Match: sp|Q9TVM2|XPO1_DROME (Exportin-1 OS=Drosophila melanogaster OX=7227 GN=emb PE=1 SV=1)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 630/1072 (58.77%), Postives = 816/1072 (76.12%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNM--NQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAP-AREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            +  + A +LLDF+QKLDI+LLD +V+ +YT  G + ++A+ ILTTLKEHP+AW RVDSILE S NQ+TK+YALQILE VIK +WKVLPR QCEGIKKY+V LIIKTSS+  ++E  KVYL KLNMILV ILK EWP+NW TFI DIVG+S++NE+LC NNMVI+K LSEEVFDFS GQ+TQTK KHLKD+MCSEFS IF LC +VL +S NA L+  TLETLL+F++WIPLGYIFET   +TLI KFL+VPMFRNVTL+CL+E+A ++ + Y   F  +F++T   L++++    N+   + +G D EQ+ + N+++F  +    H +L+E  + +   LN A  Y++ ISEVE+ E+FKICLE WN +V DLY  N E  +    +     +  R  FYAPILS++R IMISRMA+PEEVLVVENE GEVVREFMKDT+SINLYKNMRE LV+LTHLD  DTD+IMT KL  Q++GSE+SWKNLNTLCWAIGSISG+  E+DE+RFLV  I+DLL LCEQK+GKDNKAI+ASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA+KCRR FVT+Q  E  TF+DEIL  +++II DL PQQVHTFYEA+G +++A+ D V Q  LI +   LPNQVWDDII++A +N++ L+N   VKQ+ +ILKTN +ACK+LG +YV QL  IY+DMLNVYK+ SENI  A+  +G  V  QP+I+ M  VKKE L +IS WV +S D  +V +NFIPP+LDAIL DYQR   P AREP+VLS++A I+++L QHI   +P I DAVFECTL+MINK+ E++P+HR +F+ LL+AVN   F AF  +P  +FKL+ DS++WA KHTMR V++ GLNIL  +LQN++      A Q FY+ +F ++L  +FSVVTD+SH   L     IL+ MF  +E+ KITVNL     GP+     DN++++Q  +A+LLK AF  L D Q+KVF+ GLF+ ++++  F+E++RDFL+QIRE  G+D SDL+LEE+E  + + Q  K +++ ++PG+LNPHE+ EDM D
Sbjct:    5 LTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLY--NSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLD--QHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL-----GPI----PDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQD 1062          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Match: sp|P14068|XPO1_SCHPO (Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3)

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 521/1070 (48.69%), Postives = 735/1070 (68.69%), Query Frame = 3
Query:  117 LLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANV-SGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQ-----EMNYNMNQHN------------IDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNP 3272
            +L F ++LD++LLD VV   Y G G+EQ+ A+++LT  + HPDAW +  SILE S   QTKY AL +L+ +I  +WK+LP+ Q  GI+ YIV ++IK SS+  +L+ +K +L KL++ LVQILK EWP NWP FI +IV +S++N +LC+NNM++++LLSEE+FD+S  QMTQ K K+LK+ MC EF+ IFQLC  +L  +Q   L+ +TL TLL+F++WIPLGYIFETN+ + +  +FLNVP FRNVT++CLTE+A++ S  +Y + F+ +F      +  ML  QT+ +EAY     +EQ FIQN++LF  + F +HL+ +E+ EN    LN A  Y+LNIS + E EIFKICLE W+ +V+ LY + Q     EMN  +N  +             ++P R   Y  ILS LR +MI  M +PEEVL+VEN++GE+VREF+K+TD+I LYK+MRE LVYLTHLD  DT+ +MT+KL + + G+EWSW+NLNTLCWAIGSISG+M+E+ E+RFLV  I+DLL LCE KRGKDNKA+VASNIMYVVGQYPRFLKAHW+FLKTV+ KLFEFMHE H+GVQDMACDTFIKIA KCRR FV  Q GE   F++EI+  +     DL PQQ HTFYEA G +++A+    +Q  LI  L  LPNQ W++I+ QA +N ++L +P  VK + N+LKTN +AC S+G+ +  Q++  Y+DML +YK +S  I+  V   G    K P +R +R +KKE LK++ +++ ++ D  +V    IP + +A+L DY +N+  AR+ EVL+ I TI+N+L + + + IP +LDAVF CTL MI+KD  EYPEHR  FF LL A+N   F A   +PA +FKL+++SI+W+ KH  R + ETGLNILL L+ N+ + M  +    F++ +++ +L  +  V+TDS H     LQ  IL+ +F  +E  +ITV L      P      +N L+++  +  LL  AFP LQ  QI+ F++ + + NQD  +F+  +RDFL+Q++EF GD+ ++L+LEEKE E+   Q+ +     +VPG++ P
Sbjct:    4 ILAFDRELDVALLDRVVQTFYQGVGAEQQQAQQVLTQFQAHPDAWSQAYSILEKSEYPQTKYIALSVLDKLITTRWKMLPKEQRLGIRNYIVAVMIKNSSDETVLQQQKTFLNKLDLTLVQILKQEWPHNWPNFIPEIVQASKTNLSLCENNMIVLRLLSEEIFDYSAEQMTQLKTKNLKNQMCGEFAEIFQLCSQILERAQKPSLIKATLGTLLRFLNWIPLGYIFETNIVELITNRFLNVPDFRNVTIECLTEIASLTSQPQYNDKFVTMFNLVMTSVNSMLPLQTDFREAYEESSTNEQDFIQNLALFLCAFFSSHLRPLENPENQEVLLN-AHSYLLNISRINEREIFKICLEYWSKLVAQLYEEMQQIPMSEMNPLLNLSSPTSLISSNPNMLANLPLRKHIYKDILSTLRLVMIENMVKPEEVLIVENDEGEIVREFVKETDTITLYKSMREVLVYLTHLDVVDTEIVMTEKLARIVVGTEWSWQNLNTLCWAIGSISGAMNEEMEKRFLVNVIKDLLGLCEMKRGKDNKAVVASNIMYVVGQYPRFLKAHWKFLKTVVNKLFEFMHEYHEGVQDMACDTFIKIAQKCRRHFVAQQLGETEPFINEIIRNLAKTTEDLTPQQTHTFYEACGYMISAQPQKHLQERLIFDLMALPNQAWENIVAQAAQNAQVLGDPQTVKILANVLKTNVAACTSIGSGFYPQIAKNYVDMLGLYKAVSGLISEVVAAQGNIATKTPHVRGLRTIKKEILKLVDAYISRAEDLELVGNTLIPALFEAVLLDYLQNVPDARDAEVLNLITTIVNQLSELLTDKIPLVLDAVFGCTLEMISKDFSEYPEHRAAFFQLLRAINLNCFPALLNIPAPQFKLVINSIVWSFKHVSRDIQETGLNILLELINNMAS-MGPDVSNAFFQTYYISLLQDILYVLTDSDHKSGFKLQSLILARLFYLVESNQITVPLYDPSQFP---QEMNNQLFLRQYIMNLLVTAFPHLQPIQIQEFVQTVLALNQDSIKFKLALRDFLIQLKEFGGDN-AELYLEEKEQELAAQQKAQLEKAMTVPGMIKP 1067          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Match: K1RK33 (Exportin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10021125 PE=4 SV=1)

HSP 1 Score: 1508.43 bits (3904), Expect = 0.000e+0
Identity = 723/1072 (67.44%), Postives = 868/1072 (80.97%), Query Frame = 3
Query:  108 ASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQ--------HNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            A++LLDF+QKLDI+LLD +V  MYTG G +Q+MA+++LTTLKEHPD+W RVD+ILE S NQQTKYYALQILENVIK +WKVLPR QC  IKKYIVGLIIKTSS+  +LE EKVY+GKLNMILVQILK+EWP+NWP+FI DIVG+S++NE+LCQNN+ I+KLLSEEVFDFS GQMTQ K KHLKDSMCSEFS IFQLCQ+V+ +SQNA LV STLETLL+F++WIPLGYIFET L  TLI KFLNVP+FRN+TL+CLTE+A V   +Y   F+ +F  T   LK+ML  +TN+KEAY  G DDEQKFIQN+SLF  +    H QLIE K++L + L +A  Y++ ISEVEE EIFKI LE WN + +DLYR   E  ++ N         H+ D+P R   Y  +LSR+R++MISRMA+PEEVL+VENEQGEVVREF+KDTDSINLYKNMRE LVYLTHLDY+DT+ IMT+KL  Q+DG+EWSWKNLNTLCWAIGSISG+MHEDDE+RFLV  I+DLL LCEQKRGKDNKAIVASNIMYVVGQYPRFL+AHWRFLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F++EIL GIN II DL PQQVHTFYEA+GM+++A+ D V Q  LI +   LPNQVWD II QA +N+E+L++PD VKQ+ NILKTN  ACK+LG  YV QL  IY+DMLNVYKV+SENI+ A+  +GE V KQP+IR+MR VKKE LK+IS WV +S DP MVAENFIPP+LDA+L DYQRN++ AREPEVLS++ATI+NRL  +I + IP I DAVFECTL MINKD E++PEHRTNFF LL++V    F A+  +P E+FKL+LDS+IWA KHTMR V++TGL+IL  LLQNV     +EA Q FY+ +F ++L H+FSVVTDSSH   LT+Q TIL+ MF  LE+GKITV L+ T +GP +     NV Y+Q  L  LLK AFP L +PQIK+FIEGLFSF+QD+  F+E++RDFLVQIREFAG+D  DLFLEE+E  I+QAQEEK++I+ SVPGIL PHEI EDM D
Sbjct:   10 AAKLLDFSQKLDITLLDNIVTMMYTGNGPQQRMAQEVLTTLKEHPDSWTRVDTILEYSVNQQTKYYALQILENVIKTRWKVLPRAQC--IKKYIVGLIIKTSSDAALLEKEKVYVGKLNMILVQILKYEWPRNWPSFISDIVGASKTNESLCQNNLAILKLLSEEVFDFSSGQMTQAKAKHLKDSMCSEFSSIFQLCQFVMDNSQNAPLVGSTLETLLRFLNWIPLGYIFETKLITTLIYKFLNVPLFRNITLKCLTEIAAVCVQQYDEQFVHLFNLTMTQLKQMLPLETNLKEAYQKGTDDEQKFIQNLSLFLCTYLKEHGQLIERKQDLHTVLLEALHYLILISEVEEVEIFKIALEYWNTLAADLYR---ESPFSSNTSPLLIGKPHHNDVPARRQLYTQVLSRVRRVMISRMAKPEEVLIVENEQGEVVREFLKDTDSINLYKNMRETLVYLTHLDYNDTESIMTEKLHHQVDGTEWSWKNLNTLCWAIGSISGAMHEDDEKRFLVTVIKDLLGLCEQKRGKDNKAIVASNIMYVVGQYPRFLRAHWRFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIEEILNGINTIICDLQPQQVHTFYEAVGMMISAQNDQVAQEHLIERYLLLPNQVWDGIINQATQNVEVLKDPDAVKQLGNILKTNVRACKALGHPYVVQLGRIYLDMLNVYKVMSENISSAIATNGETVTKQPLIRSMRTVKKETLKLISGWVSRSTDPQMVAENFIPPLLDAVLLDYQRNVSAAREPEVLSTMATIVNRLEGNITKDIPQIFDAVFECTLEMINKDFEDFPEHRTNFFLLLQSVTAHCFQAYLNIPPEQFKLVLDSVIWAFKHTMRNVADTGLDILYTLLQNVAN--HEEAAQSFYQTYFTDILQHVFSVVTDSSHTAGLTIQATILAYMFSLLENGKITVTLAPT-SGPSM----QNVPYIQQFLMNLLKAAFPHLNEPQIKIFIEGLFSFDQDIAAFKEHLRDFLVQIREFAGEDNQDLFLEEREQAIKQAQEEKRKIQMSVPGILGPHEIQEDMQD 1069          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Match: A0A1S3IRI2 (exportin-1 OS=Lingula unguis OX=7574 GN=LOC106166719 PE=4 SV=1)

HSP 1 Score: 1497.64 bits (3876), Expect = 0.000e+0
Identity = 716/1083 (66.11%), Postives = 867/1083 (80.06%), Query Frame = 3
Query:   78 MSPMAINENT--ASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDI-------PQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            M P ++   T  A++LLDF QKLDI+LLD VV CMY+G G  Q++A+++LTTLKEHPDAW RVD+ILE SNNQQTKYYALQILENVIK +WKVLPR QCEGIKKYIVGLIIKTSS+ + LE EKVYLGKLNMILVQILK+EWPKNWP+FI DIVG+S++NE+LCQNNM I+K+LSEE+FDFS GQMTQ K KHLKDSMC+EF+ IF LCQ+VL +SQNA LV STL+TL++F+ WIPLGYIFET L  TLI KFLNVPMFRNVTL+CLTE+A VS ++Y   F+ +F  T   LK+ML   TNIK+AY +GQDDEQKFIQN+SLF  +    H  L+E K+ L   L +A  Y++ ISEVEETEIFKICLE WN + +DLYR   E  ++ +Q  + I       P R   Y P+LS++R++MISRMA+PEEVLVVENEQGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F++EIL  IN II DL+PQQVHTFYEA+G++++A+TD   Q  L+ K   LPNQVWD II QA +N+E+L++P+ VKQ+ NILKTN  ACK+LG  YV QL  IY+DMLNVYKV+SENI+IA+  +GE V KQP+IR+MR VKKE LK+IS WV +S D  MVAENFIPP+L+A+L DYQRN+  AREPEVLS++ATI+N+L   I + +P I DAVFECTL MINKD EE+PEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++ GL+I+  LLQNV    E+ A Q FY+ +F ++L H+FSVVTDSS +G LT+  +IL+ MF  +E GKITV+LS             NV +VQ  L  LLK AFP L D Q++VFIEGLFSF+QD+  F+E++RDFLVQIREFAG+D SDLFLEE+E+ IR+AQ+EK++ + +VPGIL PHE+TEDM D
Sbjct:    1 MPPASMTALTEQATKLLDFNQKLDINLLDHVVGCMYSGEGQTQRVAQEVLTTLKEHPDAWTRVDTILEYSNNQQTKYYALQILENVIKTRWKVLPRTQCEGIKKYIVGLIIKTSSDPETLEREKVYLGKLNMILVQILKYEWPKNWPSFIYDIVGASKTNESLCQNNMAILKILSEEIFDFSSGQMTQAKAKHLKDSMCTEFAQIFTLCQFVLDNSQNAPLVGSTLDTLMRFLTWIPLGYIFETKLITTLIYKFLNVPMFRNVTLKCLTEIAGVSVTQYDEQFLQLFNLTMTQLKQMLPTSTNIKDAYAHGQDDEQKFIQNLSLFLCTFLKEHGTLVEKKQELHDVLMEALHYLILISEVEETEIFKICLEYWNTLAADLYR---ESPFSASQTPLLIGRMADVPPSRRALYTPVLSKVRRVMISRMAKPEEVLVVENEQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYQDTENIMTEKLTNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIEEILNSINTIICDLNPQQVHTFYEAVGLMISAQTDQGAQEHLVEKYMMLPNQVWDTIINQATQNVEVLKDPEAVKQLANILKTNVRACKALGHPYVLQLGRIYLDMLNVYKVMSENISIAIATNGENVTKQPLIRSMRTVKKETLKLISGWVSRSNDSQMVAENFIPPLLEAVLMDYQRNVPLAREPEVLSTMATIVNKLEGSITKDVPQIFDAVFECTLEMINKDFEEFPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADMGLSIMYTLLQNVG--QEENAAQSFYQTYFTDILQHIFSVVTDSSQSGGLTMHASILAYMFTLVEMGKITVSLSPNHQA------SQNVQFVQEFLVNLLKAAFPHLNDTQLRVFIEGLFSFDQDIQAFKEHLRDFLVQIREFAGEDNSDLFLEERESAIREAQDEKRKQQMAVPGILGPHEVTEDMQD 1072          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Match: A0A1S3JY87 (exportin-1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177129 PE=4 SV=1)

HSP 1 Score: 1497.64 bits (3876), Expect = 0.000e+0
Identity = 716/1083 (66.11%), Postives = 866/1083 (79.96%), Query Frame = 3
Query:   78 MSPMAINENT--ASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDI-------PQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            M P ++   T  A++LLDF QKLDI+LLD VV CMY+G G  Q++A+++LTTLKEHPDAW RVD+ILE SNNQQTKYYALQILENVIK +WKVLPR QCEGIKKYIVGLIIKTSS+ + LE EKVYLGKLNMILVQILK+EWPKNWP+FI DIVG+S++NE+LCQNNM I+K+LSEE+FDFS GQMTQ K KHLKDSMC+EF+ IF LCQ+VL +SQNA LV STL+TL++F+ WIPLGYIFET L  TLI KFLNVPMFRNVTL+CLTE+A VS ++Y   F+ +F  T   LK+ML   TNIK+AY +GQDDEQKFIQN+SLF  +    H  L+E K+ L   L +A  Y++ ISEVEETEIFKICLE WN + +DLYR   E  ++ +Q  + I       P R   Y P+LS++R +MISRMA+PEEVLVVENEQGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT+ IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F++EIL  IN II DL+PQQVHTFYEA+G++++A+TD   Q  L+ K   LPNQVWD II QA +N+E+L++P+ VKQ+ NILKTN  ACK+LG  YV QL  IY+DMLNVYKV+SENI+IA+  +GE V KQP+IR+MR VKKE LK+IS WV +S D  MVAENFIPP+L+A+L DYQRN+  AREPEVLS++ATI+N+L   I + +P I DAVFECTL MINKD EE+PEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++ GL+I+  LLQNV    E+ A Q FY+ +F ++L H+FSVVTDSS +G LT+  +IL+ MF  +E GKITV+LS             NV +VQ  L  LLK AFP L D Q++VFIEGLFSF+QD+  F+E++RDFLVQIREFAG+D SDLFLEE+E+ IR+AQ+EK++ + +VPGIL PHE+TEDM D
Sbjct:    1 MPPASMTALTEQATKLLDFNQKLDINLLDHVVGCMYSGEGQTQRVAQEVLTTLKEHPDAWTRVDTILEYSNNQQTKYYALQILENVIKTRWKVLPRTQCEGIKKYIVGLIIKTSSDPETLEREKVYLGKLNMILVQILKYEWPKNWPSFIYDIVGASKTNESLCQNNMAILKILSEEIFDFSSGQMTQAKAKHLKDSMCTEFAQIFTLCQFVLDNSQNAPLVGSTLDTLMRFLTWIPLGYIFETKLITTLIYKFLNVPMFRNVTLKCLTEIAGVSVTQYDEQFLQLFNLTMTQLKQMLPTSTNIKDAYAHGQDDEQKFIQNLSLFLCTFLKEHGTLVEKKQELHDVLMEALHYLILISEVEETEIFKICLEYWNTLAADLYR---ESPFSASQTPLLIGRMADVPPSRRALYTPVLSKVRGVMISRMAKPEEVLVVENEQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYQDTENIMTEKLTNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIEEILNSINTIICDLNPQQVHTFYEAVGLMISAQTDQAAQEHLVEKYMMLPNQVWDTIINQATQNVEVLKDPEAVKQLANILKTNVRACKALGHPYVLQLGRIYLDMLNVYKVMSENISIAIATNGENVTKQPLIRSMRTVKKETLKLISGWVSRSNDSQMVAENFIPPLLEAVLMDYQRNVPLAREPEVLSTMATIVNKLEGSITKDVPQIFDAVFECTLEMINKDFEEFPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADMGLSIMYTLLQNVG--QEENAAQSFYQTYFTDILQHIFSVVTDSSQSGGLTMHASILAYMFTLVEMGKITVSLSPNHQA------SQNVQFVQEFLVNLLKAAFPHLNDTQLRVFIEGLFSFDQDIQAFKEHLRDFLVQIREFAGEDNSDLFLEERESAIREAQDEKRKQQMAVPGILGPHEVTEDMQD 1072          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Match: A0A3Q3J0Q4 (Exportin 1 (CRM1 homolog, yeast) b OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 1494.56 bits (3868), Expect = 0.000e+0
Identity = 708/1074 (65.92%), Postives = 862/1074 (80.26%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI+LLD VV+C+Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A+VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + NQH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR F+ +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINK+ EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  +LQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKIT+ LS        ASP +N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +I+ SVPGILNPHEI E+M D
Sbjct:    8 LADHAAQQLLDFNQKLDINLLDNVVNCLYHGVGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILETVIKTRWKILPRTQCEGIKKYVVGLIIKTSSDASNVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQMTQIKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIASVSVSQYEEQFVTLFTLTMCQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGNQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFIQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITSEIPQIFDAVFECTLNMINKNFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTMLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKITMALSP-------ASPTNNQVFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKIQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Match: A0A401NGJ7 (Importin N-terminal domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0014092 PE=4 SV=1)

HSP 1 Score: 1494.17 bits (3867), Expect = 0.000e+0
Identity = 709/1074 (66.01%), Postives = 865/1074 (80.54%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDFTQKLDI+LLD VV+C+Y G G++Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILENVIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TLI KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ S+LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMTDKL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +G+ V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+V L+ T       +P  N +++Q+ +A LLK AFP LQ+ Q+K+F+ GLFS NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +I+ SVPGILNPHEI E+M+D
Sbjct:    8 LADHAARQLLDFTQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPVNIEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVQATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMIQLKQMLPLNTNIRVAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLASELYRESPFSTPASPVLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTDKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMMLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGDVVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITSEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISVTLNPT-------NPVTNHVFIQDYVANLLKSAFPHLQEAQVKLFVTGLFSLNQDIAAFKEHLRDFLVQIKEFAGEDSADLFLEEREAALRQAQEEKHKIQMSVPGILNPHEIPEEMVD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:103021592])

HSP 1 Score: 1484.93 bits (3843), Expect = 0.000e+0
Identity = 703/1074 (65.46%), Postives = 858/1074 (79.89%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI+LLD VV+C+Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS+GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E  A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI++ L+         +P  N  ++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    8 LADHAARQLLDFNQKLDINLLDNVVNCLYHGVGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDAANVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSIGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITTEIPQIFDAVFECTLNMINKDFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEDAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISMTLNP-------GNPVSNQAFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTTDLFLEEREASLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1071          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:103021592])

HSP 1 Score: 1395.18 bits (3610), Expect = 0.000e+0
Identity = 661/1006 (65.71%), Postives = 804/1006 (79.92%), Query Frame = 3
Query:  297 KYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            KYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS+GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E  A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI++ L+         +P  N  ++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:   40 KYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDAANVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSIGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITTEIPQIFDAVFECTLNMINKDFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEDAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISMTLNP-------GNPVSNQAFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTTDLFLEEREASLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 1035          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Match: xpo1a (exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Acc:ZDB-GENE-050309-201])

HSP 1 Score: 1271.14 bits (3288), Expect = 0.000e+0
Identity = 608/958 (63.47%), Postives = 748/958 (78.08%), Query Frame = 3
Query:  465 MILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLF--------HSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            MILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDS    F      C ++ F        +SQNA LV STLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS ++Y   F+++F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSW+NLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ V+Q+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+L+A+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EE+PEHRT+FF LL+AVN + F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI+V L+         +P +N  Y+Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +I+ SVPGILNPHE+ E+M D
Sbjct:    1 MILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSFGKTFC-----CAFLTFACVCLFQENSQNAPLVHSTLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVNQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRHLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWRNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVRQLGSILKTNVRACKAVGHPFVVQLGRIYLDMLNVYKCLSENISSAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLEAVLIDYQRNVPAAREPEVLSTMATIVNKLGAHITGEIPQIFDAVFECTLNMINKDFEEFPEHRTHFFYLLQAVNSQCFPAFLTIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISVALNT-------GTPVNNQAYMQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKIQMSVPGILNPHELPEEMCD 943          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:103021592])

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 604/951 (63.51%), Postives = 740/951 (77.81%), Query Frame = 3
Query:  465 MILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIK-HLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            MILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS+GQMTQ K+  HLK +   E             +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + +QH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EEYPEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E  A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKI++ L+         +P  N  ++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +++ SVPGILNPHEI E+M D
Sbjct:    1 MILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSIGQMTQVKMNLHLKLTAFQE-------------NSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGSQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITTEIPQIFDAVFECTLNMINKDFEEYPEHRTHFFYLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEDAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISMTLNP-------GNPVSNQAFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTTDLFLEEREASLRQAQEEKHKLQMSVPGILNPHEIPEEMCD 928          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Match: ENSAMXT00000049124.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:4185746:4186726:-1 gene:ENSAMXG00000029769.1 transcript:ENSAMXT00000049124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 3.922e-22
Identity = 42/67 (62.69%), Postives = 56/67 (83.58%), Query Frame = 3
Query:   99 ENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTK 299
            ++TA QLLDF+QKLDI+LLD VV+ MY   GS+Q++A+++LT LK+HPDAW RVD+ILE S N +TK
Sbjct:   10 DHTARQLLDFSQKLDINLLDNVVNSMYYDVGSQQRLAQEVLTNLKDHPDAWTRVDTILEFSQNMKTK 76          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Match: XPO1 (exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825])

HSP 1 Score: 1436.01 bits (3716), Expect = 0.000e+0
Identity = 683/1073 (63.65%), Postives = 846/1073 (78.84%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYN----MNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI LLD VV C+Y G G +Q++A+++LT LKEHPDAW RVD+ILE S N  TKYYALQILEN IK +WK+LPR QCEGIKKY+V LIIKTS   Q +E EKVYLGKLNMILVQILK EWPKNWPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS IFQLCQ+V+  SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRN+TL+CLTE+A ++  +Y   FI +F  T   LK+ML   TNI+ AY  G+ D ++ +     F +S   +H  ++         L DA  YM+ ISEVEETEIFKICLE WNH+ S+LYR++   N      +  H+ ++P R   Y P+LS++R IM+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+M+E+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKI+ KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G +++A+TD ++Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ NILKTN  AC+++G  +V QL  +Y+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VKKE LK+IS WV +S DP +VA+NF+PP+LDA+L DYQRN+A AREPEVLS++ATI+N+L  HI   IP I DAVFECTL+MINKD EE+PEHRTNFF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL+IL  LLQNV    E  A Q FY+ +F ++L H+FSVVTD+SH   LT+  TIL++MF  +E+ +IT  L+ T   P ++    N  ++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDL+LEE+E  +RQA +EK++I+ SVPGILNPHE+ E+M D
Sbjct:    8 LGDHAARQLLDFGQKLDIGLLDNVVSCLYQGEGPQQRVAQEVLTQLKEHPDAWTRVDTILEFSQNMNTKYYALQILENAIKTRWKILPRNQCEGIKKYVVYLIIKTSQEPQTMEKEKVYLGKLNMILVQILKQEWPKNWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQLTQVKAKHLKDSMCNEFSQIFQLCQFVMESSQNAPLVAATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNLTLKCLTEIAGLTVVQYEEQFITLFTLTMIQLKQMLPLNTNIRLAYSSGRADLRETLMEFPYFVNSFSQSHDNMLSLTLYKSKILFDALHYMVLISEVEETEIFKICLEYWNHLASELYRESPMPNSPSPLLLGNHHPEVPPRRQIYLPVLSKVRLIMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHAQVNGTEWSWKNLNTLCWAIGSISGAMYEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKISQKCRRHFVQVQVGEVMPFIDEILSSINTIICDLQPQQVHTFYEAVGYMISAQTDPIVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGNILKTNVRACRAVGHPFVTQLGRVYLDMLNVYKCLSENISAAILANGEVVTKQPLIRSMRTVKKETLKLISDWVSRSNDPKLVADNFVPPLLDAVLIDYQRNVAAAREPEVLSTMATIVNKLGGHITASIPQIFDAVFECTLDMINKDFEEFPEHRTNFFLLLQAVNSNCFPAFLNIPPAQFKLVLDSIIWAFKHTMRNVADTGLSILYALLQNVG--QEAVAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHATILANMFSLVEENRITAPLNPT--SPAIS----NQPFIQEYVANLLKSAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLYLEEREQSLRQANDEKRKIQLSVPGILNPHEMPEEMCD 1072          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009965.1 (pep scaffold:Pmarinus_7.0:GL491986:346:5450:-1 gene:ENSPMAG00000009019.1 transcript:ENSPMAT00000009965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 432.95 bits (1112), Expect = 3.084e-144
Identity = 201/265 (75.85%), Postives = 230/265 (86.79%), Query Frame = 3
Query: 1290 PILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECL--VYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMH-ETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQA 2075
            P+L+++R +M+ RMA+PEEVLVVEN+QGEVVREFMKDTDSI+LYKNMRE L  VYLTHLDY DT++IMT+KL  Q+ G EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAIVASNIMYVVGQYPRFL+AHW+FLKTV+ KLFEFMH ETHDGVQDMACDTFIKIA KCRR FV +Q+GE+  F+DEIL GIN II DL PQQVHTFYEA+G ++ A+TD V+Q  LI K   LPNQVWD II QA
Sbjct:    2 PVLAQVRLVMVCRMAKPEEVLVVENDQGEVVREFMKDTDSISLYKNMRETLGAVYLTHLDYTDTERIMTEKLQAQVSGVEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIVASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHAETHDGVQDMACDTFIKIAQKCRRHFVQVQAGEVMPFIDEILNGINTIICDLQPQQVHTFYEAVGYMIGAQTDQVLQERLIEKYMLLPNQVWDSIIHQA 266          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009826.1 (pep scaffold:Pmarinus_7.0:GL487448:15916:39998:1 gene:ENSPMAG00000008887.1 transcript:ENSPMAT00000009826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 373.629 bits (958), Expect = 7.732e-122
Identity = 174/246 (70.73%), Postives = 210/246 (85.37%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITK 830
            + ++TA QLLDF+Q+LDI+LLD+VV  +Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILENVIK +WK+LPR QC+GIKKY+VGL+IKTS     LE EKVY+GKLNMILVQILK EWPKNWPTFI DIVG+SR++E+LCQNNM I+KLLSEEVFDFS GQ+TQ K KHLKDSMC+EFS +FQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L   L+ K
Sbjct:    8 LGDHTARQLLDFSQRLDINLLDSVVSWLYQGEGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILENVIKTRWKILPRNQCDGIKKYVVGLVIKTSQEPINLEKEKVYIGKLNMILVQILKQEWPKNWPTFISDIVGASRTSESLCQNNMAILKLLSEEVFDFSSGQLTQFKAKHLKDSMCNEFSQVFQLCQFVMENSQNAPLVAATLETLLRFLNWIPLGYIFETKLISVLVYK 253          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003995.1 (pep scaffold:Pmarinus_7.0:GL489327:281:2303:1 gene:ENSPMAG00000003656.1 transcript:ENSPMAT00000003995.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 3.288e-46
Identity = 78/142 (54.93%), Postives = 106/142 (74.65%), Query Frame = 3
Query: 2874 GNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
              LT+  TIL+ MF   ++G++TV L    N  + AS  +NV +VQ  +A LLK AFP LQD Q+K+F+ GLFS N D+  F+E++RDFLVQI+EFAG+D SDL+LEE+E+ +RQA EEK++++ SVPGILNPHEI +DM D
Sbjct:    1 AGLTMHATILAYMFSLAKEGRVTVPL----NPAMPAS--NNVPFVQEYIANLLKSAFPHLQDAQVKLFVTGLFSLNHDIPAFKEHLRDFLVQIKEFAGEDTSDLYLEERESSLRQANEEKRKVQMSVPGILNPHEIGDDMCD 136          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Match: si:ch211-233m11.2 (exportin 5 [Source:HGNC Symbol;Acc:HGNC:17675])

HSP 1 Score: 63.5438 bits (153), Expect = 2.609e-10
Identity = 55/227 (24.23%), Postives = 107/227 (47.14%), Query Frame = 3
Query:  282 NNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFS---------------------LGQMTQTKIKH------LKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIF--ETNLNQTLITKFLNVPMFRNVTLQCL 875
            N    +++ LQ+LE+ IK +W  + +V+   +K+ ++GL+ K + ++  LE E      ++ ++V+++K EWP+ WP  +Q++  +S+  E   +  ++++  L+E+V  F                      LG +    I+H      LKDS   E        +    H + A    +TL TL  F+ W+ + ++   +  L +TL +  L  P F+    +CL
Sbjct:   59 NAGIVRHFGLQLLEHCIKFRWNNMSQVEKCQVKENVMGLLSKGTKHL--LEEEPYIKDAVSRLMVEMIKREWPQQWPEMLQELFATSKLGETQAELMLLVLLRLAEDVVAFQALPQQRRRDIMQALTHKNVMLLGFLLDILIEHSNKFQQLKDSPTEEAQ------KQATTHCRVA---CATLATLAGFVEWVNMTHLAFKDCALLRTLCS-LLGEPRFQLEAAECL 273          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Yeast
Match: CRM1 (Major karyopherin; involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin [Source:SGD;Acc:S000003450])

HSP 1 Score: 955.666 bits (2469), Expect = 0.000e+0
Identity = 479/1084 (44.19%), Postives = 694/1084 (64.02%), Query Frame = 3
Query:  117 LLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVF----IDIFENTTNVLKEMLAPQT-NIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEM---------NYNMNQHNID-------------IPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITE 3287
            +LDF+  LDI+LLD VV   Y G+G +QK A++ILT  +++PDAW + D IL+ S N Q+K+ AL IL+ +I  KWK+LP     GI+ ++VG+II    + ++ + +K  + K ++ LVQILK EWP+NWP FI +++GSS S+  +C+NNM+++KLLSEEVFDFS  QMTQ K  HLK+SM  EF  IF+LC  VL    ++ L+V+TLE+LL+++HWIP  YI+ETN+ + L TKF+  P  R +TL+CLTE++N+   +  ++     +  F+NT   +   + P T ++K  Y     ++Q F+Q++++F ++    +  L+ES E+LR  L +A +Y++ +S++EE E+FK  L+ W+++V+DL+ + Q +           ++    I               P +   Y  I S+LR ++I  M RPEEVLVVEN++GE+VREF+K++D+I LYK+ RE LVYLTHL+  DT++IM  KL +Q+DGSEWSW N+NTL WAIGSISG+M ED E+RF+V  I+DLL L  +KRGKDNKA+VAS+IMYVVGQYPRFLKAHW FL+TVI KLFEFMHETH+GVQDMACDTFIKI  KC+  FV  Q  E   F+  I+  I    +DL PQQVHTFY+A G++++ E     ++ L++ L  LPN  WD I+ Q+  N  +L + + VK I NI+KTN + C S+GA +  QL HIY +ML +Y+ +S  I+  V   G    K P +R +R +KKE LK++ +++ K+ +   V +  + P+L+A+L DY  N+  AR+ EVL+ + T++ ++   I + +  IL +VFECTL+MINKD  EYPEHR  F+ LL+ +N+KSF AF  LP   FKL +D+I WA KH  R V   GL I L+L++N+E +        F+KN+F   +   F V+TDS H    + Q  +L  +   + D KI+V L      P   S   N +Y+   LA +L  AFP L   QI  F+  L    +DL  F+  +RDFLVQI+E  GD    LF E+KE  + +    ++   A + G+L P E+ +
Sbjct:    4 ILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTNPQSKFIALSILDKLITRKWKLLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKALHLKNSMSKEFEQIFKLCFQVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLSTKFMTSPDTRAITLKCLTEVSNLKIPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKATYANANGNDQSFLQDLAMFLTTYLARNRALLESDESLRELLLNAHQYLIQLSKIEERELFKTTLDYWHNLVADLFYEVQRLPATEMSPLIQLSVGSQAISTGSGALNPEYMKRFPLKKHIYEEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKESDTIQLYKSEREVLVYLTHLNVIDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDTEKRFVVTVIKDLLDLTVKKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTVILKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQVHTFYKACGIIISEERSVAERNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFYPQLGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNLDDVVKVLVEPLLNAVLEDYMNNVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLMKLISLVYDNKISVPLYQEAEVPQGTS---NQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQYKDLVVFKGTLRDFLVQIKEVGGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPSELDD 1084          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Nematostella
Match: EDO44035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWU3])

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 651/1079 (60.33%), Postives = 816/1079 (75.63%), Query Frame = 3
Query:  108 ASQLLDFTQKLDISLLDAVV----DCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVL----PRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYN---MNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQ----DNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            ASQLLDF+QKLDI+LLD+VV     C      S Q       +  K++      V+S LE S  Q+  YYALQILE VIK +WK+      +    GIKKYIVGLIIK SS    +E EK YL KLNMILV++LKHEWP  WP FI DIVG+S++NE+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMCSEFS IF LCQ+V+ +SQN  LV STLETLLKF++WIPLGYIFET L  +LI KFLNVP+FRNVTL+CLTE+A +S S+Y   F+ +F  T + LK+ML    NIKEAY  G+DDEQKFIQN+SLF  S    H QL+E K         A  Y++ ISEVEETEIFKICLE WN + SDLYR+N   + +   +   N  +P R   Y  +LS++R IMISRMA+PEEVLVVEN+QGEVVREFMKDTD+INLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCE KRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F++EIL    +II DL P QVHTFYEA+G +++A+TD V+   LI K   LPNQ WD+I+ +A  NI+ L++ +VVKQ+ NILKTN   CKS+G  +V QL  IY+DMLNVY+ +SENI++A++ +GE V KQP+IRAMR VK E L++IS+WV KS DP +V +NFIPP+LDA+L DYQRN+  AREPEVLS++AT IN+L  ++ E++P I DAVFECTLNMINKD EE+PEHRTNFF LL+AV Q  F A   +P E+FKL+LDSI+WA KHTMR V++TGL+IL +LL+N+E    +EA Q FY+ +++ ++ H+ SVVTD+SH   LT+  TIL+ MF   E GKIT         PL  S +     N  Y+Q  +A +L+QAFP LQD QIK+ ++GLF+ NQD+  F+E++RDFLVQI+E+  +D +DL+LEE+ET+++ A+EEK++++ SVPGI+NPH++ E+M D
Sbjct:   11 ASQLLDFSQKLDINLLDSVVILSKRCNLKPICSYQPFVMFFFS--KDNSQNVTLVESTLEVSLTQKKLYYALQILEMVIKTRWKIFQASNEKYLSLGIKKYIVGLIIKISSESTEMEKEKTYLSKLNMILVEVLKHEWPTKWPMFISDIVGASKANESLCQNNMIILKLLSEEVFDFSSGQMTQAKAKHLKDSMCSEFSQIFTLCQFVMDNSQNVTLVESTLETLLKFLNWIPLGYIFETKLISSLIYKFLNVPLFRNVTLKCLTEIAAISASQYDEQFVVLFSLTMSQLKQMLPLTINIKEAYANGRDDEQKFIQNLSLFLCSFLKEHGQLVEKKVRFYCSPTQALHYLVLISEVEETEIFKICLEYWNTLASDLYRENPFSSTSSPLLIAQNQQVPPRRQLYLSVLSKIRVIMISRMAKPEEVLVVENDQGEVVREFMKDTDAINLYKNMRETLVYLTHLDYQDTERIMTEKLQNQVNGIEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEIKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIEEILNSTQSIICDLQPLQVHTFYEAVGSMISAQTDAVVMERLIEKYMSLPNQAWDNIVREATRNIDHLRDLEVVKQLGNILKTNVRGCKSIGHPFVTQLGRIYLDMLNVYRCLSENISMAISENGELVMKQPLIRAMRTVKTEVLRLISTWVSKSNDPKLVCDNFIPPLLDAVLGDYQRNVPGAREPEVLSTMATFINKLEANVTENVPQIFDAVFECTLNMINKDFEEFPEHRTNFFLLLQAVVQHCFQALLKIPPEQFKLVLDSIVWAFKHTMRNVADTGLHILYSLLKNMEA---EEASQSFYQTYYITIVQHVLSVVTDTSHTAGLTMHATILAHMFSLAESGKIT--------QPLFNSSEAQYASNQAYIQEYIANVLRQAFPHLQDAQIKITVQGLFNLNQDISAFKEHLRDFLVQIKEYRSEDSTDLYLEERETQLKSAEEEKRKVQLSVPGIVNPHDMPEEMQD 1076          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Nematostella
Match: EDO26923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAP8])

HSP 1 Score: 432.95 bits (1112), Expect = 1.231e-141
Identity = 217/434 (50.00%), Postives = 302/434 (69.59%), Query Frame = 3
Query: 2001 VIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLA-ALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            V+   LI K   LPNQ WD+I+ +A  NI+ L++ +VVKQ+ NILKTN   CKS+G  +V QL  IY+DMLNVY+ +SENI++A++ +GE V KQP+IRAMR VK E L++IS+WV KS DP +V +NFIPP+LDA+L DYQRN+  AREPEVLS++AT IN+L  ++ E++  I DAVFECTLNMINKD EE+PEHRTNFF LL+AV Q  F A   +P E+FKL+LDSI+WA KHTMR V++TGL+IL +LL+N+E    +EA Q FY+ +++ ++ H+ SVVTD+SH   LT+  TIL+ MF   E GKIT         PL  S +    Y  N +  A        L + + + F  G+F   Q   R+  + +     I+E+  +D +DL+LEE+ET+++ A+EEK++++ SVPGI+NPH++ E+M D
Sbjct:    3 VVMERLIEKYMSLPNQAWDNIVREATRNIDHLRDLEVVKQLGNILKTNVRGCKSIGHPFVTQLGRIYLDMLNVYRCLSENISMAISENGELVMKQPLIRAMRTVKTEVLRLISTWVSKSNDPKLVCDNFIPPLLDAVLGDYQRNVPGAREPEVLSTMATFINKLEANVTENVSQIFDAVFECTLNMINKDFEEFPEHRTNFFLLLQAVVQHCFQALLKIPPEQFKLVLDSIVWAFKHTMRNVADTGLHILYSLLKNMEA---EEASQSFYQTYYITIVQHVLSVVTDTSHTAGLTMHATILAHMFSLAESGKIT--------QPLFNSSEAQ--YASNQVCTACFVIDRSSLGEARTQDFSWGVFILGQ--ARWFASAK-----IKEYRSEDSTDLYLEERETQLKSAEEEKRKVQLSVPGIVNPHDMPEEMQD 416          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Nematostella
Match: EDO35677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKU4])

HSP 1 Score: 45.8246 bits (107), Expect = 6.360e-6
Identity = 22/87 (25.29%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  282 NNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGK--LNMILVQILKHEWPKNWPTFIQDIVG 536
            N+   ++  LQ++E+ +K  W  + +  C   K+ ++ L++  +  M    +E+ Y  K  L  ++ ++ K EWP++W  F+ D+ G
Sbjct:   24 NSAMVRHIGLQLMEHSVKFNWGSMQQNDCAVFKQRVMSLLVNGTKPM----SEEPYHLKESLARLVAEVAKREWPQSWENFLSDLNG 106          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:101170539])

HSP 1 Score: 1490.32 bits (3857), Expect = 0.000e+0
Identity = 706/1074 (65.74%), Postives = 859/1074 (79.98%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDF QKLDI+LLD VV+C+Y G G +Q+MA+++LT LKEHPDAW RVD+ILE S N  TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + NQH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR F+ +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINK+ EE+PEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKIT  LS        A+P  N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +I+ SVPGILNPHE+ E+M D
Sbjct:   21 LADHAAQQLLDFNQKLDINLLDNVVNCLYHGVGPQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYALQILETVIKARWKILPRNQCEGIKKYVVGLIIKTSSDASNVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMCQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGNQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFIQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITSEIPQIFDAVFECTLNMINKNFEEFPEHRTHFFYLLQAVNSHCFAAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKITAPLSP-------ANPSSNQVFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKIQMSVPGILNPHEMPEEMCD 1084          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Match: xpo1a (exportin-1 [Source:NCBI gene;Acc:101175126])

HSP 1 Score: 1450.65 bits (3754), Expect = 0.000e+0
Identity = 689/1069 (64.45%), Postives = 852/1069 (79.70%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            + ++ A QLLDFTQ+LDI+LLD VV+ M+   GS+Q++A+++LT LK+HPDAW RVD+ILE S N +TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS    LE E VY+ KLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS ++Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++   + +      D+P R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTD+INLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLN LCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++ + V+Q+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ AV ++GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+L+A+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EE+PEHRT+FF LL+A   + F AF  +   +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  TIL+ MF  +E+ K++V LS T        P +N+L+V+  +A LLK AFP LQD Q+KVF+ GL S NQD+  F+E++RDFLVQI+EFAG+D +DLFLEE+E  +RQAQEEK +++ SVPGILNPHE+ E+M D
Sbjct:    8 LADHPARQLLDFTQRLDINLLDNVVNSMHHDIGSQQRVAQEVLTNLKDHPDAWTRVDTILEFSQNMKTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSEPGSLETEGVYISKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLINTLVYKFLNVPMFRNVTLKCLTEIAGVSVNQYEEQFVSLFTLTMCQLKQMLPLNTNIRMAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRHNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLSAELYRES-PFSTSSTPLLSDVPPRRHLYLAVLSQVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDAINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNMLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDLSVQELLIEKYMLLPNQVWDSIIQQATKNVDILKDAETVRQLGSILKTNVRACKAVGHPFVAQLGRIYLDMLNVYKCLSENISSAVQSNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLEAVLIDYQRNVPAAREPEVLSTMATIVNKLGVHITGEIPKIFDAVFECTLNMINKDFEEFPEHRTHFFYLLQAATSQCFPAFLAIAPAQFKLILDSIIWAFKHTMRNVADTGLQILYTLLQNVSA--EEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHATILAYMFNLVEENKVSVALSTTH-------PTNNLLHVREYVANLLKMAFPHLQDAQVKVFVTGLSSLNQDIPAFKEHLRDFLVQIKEFAGEDTTDLFLEEREAVLRQAQEEKHKLQLSVPGILNPHELPEEMCD 1066          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Match: xpo1a (exportin-1 [Source:NCBI gene;Acc:101175126])

HSP 1 Score: 1381.7 bits (3575), Expect = 0.000e+0
Identity = 657/1021 (64.35%), Postives = 811/1021 (79.43%), Query Frame = 3
Query:   93 INENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIR 3155
            + ++ A QLLDFTQ+LDI+LLD VV+ M+   GS+Q++A+++LT LK+HPDAW RVD+ILE S N +TKYYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS    LE E VY+ KLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNM+I+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS ++Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++   + +      D+P R   Y  +LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTD+INLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLN LCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR FV +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++ + V+Q+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ AV ++GE V KQP+IR+MR VK+E LK+IS WV +S DP MVAENF+PP+L+A+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINKD EE+PEHRT+FF LL+A   + F AF  +   +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  TIL+ MF  +E+ K++V LS T        P +N+L+V+  +A LLK AFP LQD Q+KVF+ GL S NQD+  F+E++RDFLVQI+
Sbjct:    8 LADHPARQLLDFTQRLDINLLDNVVNSMHHDIGSQQRVAQEVLTNLKDHPDAWTRVDTILEFSQNMKTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSEPGSLETEGVYISKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLINTLVYKFLNVPMFRNVTLKCLTEIAGVSVNQYEEQFVSLFTLTMCQLKQMLPLNTNIRMAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRHNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLSAELYRES-PFSTSSTPLLSDVPPRRHLYLAVLSQVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDAINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNMLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDLSVQELLIEKYMLLPNQVWDSIIQQATKNVDILKDAETVRQLGSILKTNVRACKAVGHPFVAQLGRIYLDMLNVYKCLSENISSAVQSNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLEAVLIDYQRNVPAAREPEVLSTMATIVNKLGVHITGEIPKIFDAVFECTLNMINKDFEEFPEHRTHFFYLLQAATSQCFPAFLAIAPAQFKLILDSIIWAFKHTMRNVADTGLQILYTLLQNVSA--EEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHATILAYMFNLVEENKVSVALSTTH-------PTNNLLHVREYVANLLKMAFPHLQDAQVKVFVTGLSSLNQDIPAFKEHLRDFLVQIK 1018          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:101170539])

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 645/988 (65.28%), Postives = 785/988 (79.45%), Query Frame = 3
Query:  354 PRV-QCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            PR  +   IKKY+VGLIIKTSS+   +E EKVY+GKLNMILVQILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQMTQ K KHLKDSMC+EFS IFQLCQ+V+ +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + NQH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR F+ +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINK+ EE+PEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKIT  LS        A+P  N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +I+ SVPGILNPHE+ E+M D
Sbjct:   33 PRAGRPASIKKYVVGLIIKTSSDASNVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQMTQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMCQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGNQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFIQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITSEIPQIFDAVFECTLNMINKNFEEFPEHRTHFFYLLQAVNSHCFAAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKITAPLSP-------ANPSSNQVFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKIQMSVPGILNPHEMPEEMCD 1010          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Match: xpo1b (exportin-1 [Source:NCBI gene;Acc:101170539])

HSP 1 Score: 1320.84 bits (3417), Expect = 0.000e+0
Identity = 637/1006 (63.32%), Postives = 780/1006 (77.53%), Query Frame = 3
Query:  297 KYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMN-----YNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            +YYALQILE VIK +WK+LPR QCEGIKKY+VGLIIKTSS+   +E+            +QILK EWPK+WPTFI DIVG+SR++E+LCQNNMVI+KLLSEEVFDFS GQMTQ  +KH        F  +F    Y+  +SQNA LV +TLETLL+F++WIPLGYIFET L  TL+ KFLNVPMFRNVTL+CLTE+A VS S+Y   F+ +F  T   LK+ML   TNI+ AY  G+DDEQ FIQN+SLF  +    H QLIE + NLR  L +A  YML +SEVEETEIFKICLE WNH+ ++LYR++          + NQH  D+P R   Y P+LS++R +M+SRMA+PEEVLVVEN+QGEVVREFMKDTDSINLYKNMRE LVYLTHLDY DT++IMT+KL  Q++G+EWSWKNLNTLCWAIGSISG+MHE+DE+RFLV  I+DLL LCEQKRGKDNKAI+ASNIMY+VGQYPRFL+AHW+FLKTV+ KLFEFMHETHDGVQDMACDTFIKIA KCRR F+ +Q GE+  F+DEIL  IN II DL PQQVHTFYEA+G ++ A+TD  +Q  LI K   LPNQVWD II QA +N++IL++P+ VKQ+ +ILKTN  ACK++G  +V QL  IY+DMLNVYK +SENI+ A+  +GE V KQP+IR+MR VK+E LK+IS WV +S DP MV ENF+PP+LDA+L DYQRN+  AREPEVLS++ATI+N+L  HI   IP I DAVFECTLNMINK+ EE+PEHRT+FF LL+AVN   F AF  +P  +FKL+LDSIIWA KHTMR V++TGL IL  LLQNV    E+ A Q FY+ +F ++L H+FSVVTD+SH   LT+  +IL+ MF  +E+GKIT  LS        A+P  N +++Q  +A LLK AFP LQD Q+KVF+ GLFS NQD+  F+E++RDFLVQI+EFAG+D SDLFLEE+E  +RQAQEEK +I+ SVPGILNPHE+ E+M D
Sbjct:    3 QYYALQILETVIKARWKILPRNQCEGIKKYVVGLIIKTSSDASNVEHPVC-------PCLQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQMTQ--VKH--------FLQLFVSAVYLQENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTLKCLTEIAGVSVSQYEEQFVTLFTLTMCQLKQMLPLNTNIRLAYANGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLSGNQH-FDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFIQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQTNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLDAVLIDYQRNVPAAREPEVLSTMATIVNKLGGHITSEIPQIFDAVFECTLNMINKNFEEFPEHRTHFFYLLQAVNSHCFAAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVA--QEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKITAPLSP-------ANPSSNQVFIQEYVANLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREASLRQAQEEKHKIQMSVPGILNPHEMPEEMCD 981          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Planmine SMEST
Match: SMESG000025559.1 (SMESG000025559.1)

HSP 1 Score: 2229.14 bits (5775), Expect = 0.000e+0
Identity = 1074/1074 (100.00%), Postives = 1074/1074 (100.00%), Query Frame = 3
Query:   78 MSPMAINENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 3299
            MSPMAINENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID
Sbjct:    1 MSPMAINENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISGSMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVNQKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVETIMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLEDGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVFIEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQEEKQRIKASVPGILNPHEITEDMID 1074          
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Planmine SMEST
Match: SMESG000045533.1 (SMESG000045533.1)

HSP 1 Score: 166.777 bits (421), Expect = 1.198e-41
Identity = 205/954 (21.49%), Postives = 432/954 (45.28%), Query Frame = 3
Query:  186 TGSEQKMAEKILTTLKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGIKKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKN-WPTFIQDIVGSSRSNEALCQNNMVIMKLLSEEVFDFSLG-QMTQTKIKHLKDSMCSEFSHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLITKFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQTNIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFEYMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRNLF--YAPILSRLRKIMISRMARPEEVLVVENEQGEVVRE-----FMKDTDSI-NLYKNMRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAI----------GSISGSMHED------DERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLKAHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGEMYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINKLFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASYVQQLSHI---YMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEALKIIS------SWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIATIINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAV--NQKSFIA-FTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVET-IMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLED 2930
            +G   K   +IL   K   +AW+  + +   +N++   +Y L IL ++IK KW  +   Q E I  +I+G ++K S+N  ++  E++ L K N  L++I   +W  + WP FI +++ S   NE LCQNN+++ K L E VF   L   +++ K++ LK  + S F  I +L   ++  S+N  LV+ +L+ L  F+   P   I + +     ++  L V + R   ++  T +A     +  N  +D  +  +  L +++     +++ +   + D++ F+    +  + L    +     +++ R+ L DA+ ++L ++ +E  +I  IC + W+ + SD+  + + +N          P+ N +   A  L+ +  I++S  +     L     Q  V+ E     F     SI N+Y+NM +       L+ +   + + ++    +   + S K L ++  +I            +  +  +D      D  RF   +   L++L  Q     ++  ++ +++Y++G Y      H    + ++ +L++++   +D +++MA D+F K ++     F++  S +  T +  +L  I +   +L+  Q+  F+E++ M+++   D   Q     + F LPN  W  I+ +  E++  L +  V+  +  IL  N   C  L  +Y+ QL  I     D+LN+  +    I+ +    GE   ++P +  + ++   +L +I       SW  +      +++  IP ++ A    Y +         +L ++  +     +       ++L  V   +   I+    E     ++   LL+++  N  S I   T++P  +   ++D ++W +K  + +  +T  +I+  +LQ  E+  +    ++ F + F++    H+   V  SS  G   L+  I  S+ + L +
Sbjct:   27 SGESCKSLNEILINFKNKRNAWMESECLFN-TNDEMQIFYGLIILIDLIKYKWNCISAEQQECISSFILGKVLKLSTNPSLIPQEELILRKFNHCLLEIFFVKWSNDEWPVFIDELIDSCNGNEFLCQNNILVFKNLYELVFQNDLSVNLSKEKLEKLKFYLTSLFDKILKLILSIIDISRNVTLVLRSLDLLELFISIKP-DIIKDYDKIFMHLSNLLLVSVIRKDAIK--TIIAFCRQIKPSNKVVDYLKVVSEQLTKIIPSSIVLQDIFSDCKCDDKTFL----ILIADLLAEFIVKFYKEDSCRNHLEDAWLFLLRLTAIENDDISTICFDYWSQL-SDIVYKGKSLN----------PEDNFYSKAAVYLNEVSDIIVS--SNCSASLNALQMQSTVICEISIVYFELRLQSIQNIYQNMFK-------LNPNICIEQIKNRFNNLLISPQVSIKELYSVSRSIDFVLNDSEIQAKLKANSDQDLVNLLIDLMRF---SFNSLMTLQAQMLTFKDQIPISCSLVYLIGSYSVLGNFHLELSRCMLKRLYQYLTIGNDLMKNMALDSFKKWSISNCFYFIS-NSEKGVTILSYLLNNIGSRSVNLNQAQIVAFHESICMIISKIDDPDSQEMYTKQFFKLPNDAWKKILNRITEDVTSLLDTRVLSSLRMILDINIRCCTCLKTAYINQLLEINEQLYDLLNLIFLSLHRIS-SKCCRGEIELQKPPLSHLISLYDISLSLIQTYLYNISWTNEVY--LEISKLLIPLLMSA----YCKFSGTLSCCTILITLNMVFEA-GEVAYALASSVLTRVIPPSQLFIDAAAFEDINDSSHILILLKSIMRNYVSIITNSTLVPFIELIHVIDFVLWGLKAVLNETRQTCYSIIELILQYFESDRVNSHQRKKFIRQFYM----HIIQTVLISSLDGVRVLEDDIFVSVVRILSN 936          
The following BLAST results are available for this feature:
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XPO10.000e+065.27exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
XPO10.000e+065.27exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
XPO10.000e+065.27exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
XPO11.402e-8373.53exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
XPO12.142e-5469.92exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo-10.000e+047.53EXPOrtin (Nuclear export receptor) [Source:UniPro... [more]
xpo-10.000e+047.53EXPOrtin (Nuclear export receptor) [Source:UniPro... [more]
xpo-10.000e+047.53EXPOrtin (Nuclear export receptor) [Source:UniPro... [more]
xpo-17.381e-1952.56EXPOrtin (Nuclear export receptor) [Source:UniPro... [more]
xpo-17.381e-1952.56EXPOrtin (Nuclear export receptor) [Source:UniPro... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
emb0.000e+058.77gene:FBgn0020497 transcript:FBtr0079663[more]
emb0.000e+058.77gene:FBgn0020497 transcript:FBtr0346708[more]
Ranbp217.159e-620.96gene:FBgn0031051 transcript:FBtr0340614[more]
Ranbp217.159e-620.96gene:FBgn0031051 transcript:FBtr0074759[more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo1b0.000e+065.55exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Ac... [more]
xpo1b0.000e+065.55exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Ac... [more]
xpo1a0.000e+064.62exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Ac... [more]
xpo1a0.000e+069.22exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Ac... [more]
xpo1b7.069e-8664.68exportin 1 (CRM1 homolog, yeast) b [Source:ZFIN;Ac... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XPO10.000e+065.83uncharacterized LOC100145274 [Source:Xenbase;Acc:X... [more]
XPO10.000e+063.41uncharacterized LOC100145274 [Source:Xenbase;Acc:X... [more]
XPO10.000e+062.33uncharacterized LOC100145274 [Source:Xenbase;Acc:X... [more]
XPO11.146e-2262.32uncharacterized LOC100145274 [Source:Xenbase;Acc:X... [more]
hdac15.789e-822.83histone deacetylase 1 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xpo10.000e+065.55exportin 1 [Source:MGI Symbol;Acc:MGI:2144013][more]
Xpo10.000e+065.55exportin 1 [Source:MGI Symbol;Acc:MGI:2144013][more]
Xpo10.000e+065.55exportin 1 [Source:MGI Symbol;Acc:MGI:2144013][more]
Xpo10.000e+065.55exportin 1 [Source:MGI Symbol;Acc:MGI:2144013][more]
Xpo11.711e-10959.21exportin 1 [Source:MGI Symbol;Acc:MGI:2144013][more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80U96|XPO1_RAT0.000e+065.64Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 P... [more]
sp|Q6P5F9|XPO1_MOUSE0.000e+065.55Exportin-1 OS=Mus musculus OX=10090 GN=Xpo1 PE=1 S... [more]
sp|O14980|XPO1_HUMAN0.000e+065.27Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV... [more]
sp|Q9TVM2|XPO1_DROME0.000e+058.77Exportin-1 OS=Drosophila melanogaster OX=7227 GN=e... [more]
sp|P14068|XPO1_SCHPO0.000e+048.69Exportin-1 OS=Schizosaccharomyces pombe (strain 97... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RK330.000e+067.44Exportin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10... [more]
A0A1S3IRI20.000e+066.11exportin-1 OS=Lingula unguis OX=7574 GN=LOC1061667... [more]
A0A1S3JY870.000e+066.11exportin-1 isoform X1 OS=Lingula unguis OX=7574 GN... [more]
A0A3Q3J0Q40.000e+065.92Exportin 1 (CRM1 homolog, yeast) b OS=Monopterus a... [more]
A0A401NGJ70.000e+066.01Importin N-terminal domain-containing protein OS=S... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo1b0.000e+065.46exportin-1 [Source:NCBI gene;Acc:103021592][more]
xpo1b0.000e+065.71exportin-1 [Source:NCBI gene;Acc:103021592][more]
xpo1a0.000e+063.47exportin 1 (CRM1 homolog, yeast) a [Source:ZFIN;Ac... [more]
xpo1b0.000e+063.51exportin-1 [Source:NCBI gene;Acc:103021592][more]
ENSAMXT00000049124.13.922e-2262.69pep primary_assembly:Astyanax_mexicanus-2.0:12:418... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XPO10.000e+063.65exportin 1 [Source:HGNC Symbol;Acc:HGNC:12825][more]
ENSPMAT00000009965.13.084e-14475.85pep scaffold:Pmarinus_7.0:GL491986:346:5450:-1 gen... [more]
ENSPMAT00000009826.17.732e-12270.73pep scaffold:Pmarinus_7.0:GL487448:15916:39998:1 g... [more]
ENSPMAT00000003995.13.288e-4654.93pep scaffold:Pmarinus_7.0:GL489327:281:2303:1 gene... [more]
si:ch211-233m11.22.609e-1024.23exportin 5 [Source:HGNC Symbol;Acc:HGNC:17675][more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CRM10.000e+044.19Major karyopherin; involved in export of proteins,... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO440350.000e+060.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269231.231e-14150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356776.360e-625.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo1b0.000e+065.74exportin-1 [Source:NCBI gene;Acc:101170539][more]
xpo1a0.000e+064.45exportin-1 [Source:NCBI gene;Acc:101175126][more]
xpo1a0.000e+064.35exportin-1 [Source:NCBI gene;Acc:101175126][more]
xpo1b0.000e+065.28exportin-1 [Source:NCBI gene;Acc:101170539][more]
xpo1b0.000e+063.32exportin-1 [Source:NCBI gene;Acc:101170539][more]
back to top
BLAST of Exportin 1 (CRM1 homolog, yeast) b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000025559.10.000e+0100.00SMESG000025559.1[more]
SMESG000045533.11.198e-4121.49SMESG000045533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007894 ID=SMED30007894|Name=Exportin 1 (CRM1 homolog, yeast) b|organism=Schmidtea mediterranea sexual|type=transcript|length=3401bp
TATCATTATTTTTAAGCAATCCAGAAGTCATATTTTTTGATAAATTAATA
CTTATTTTGTAGTTTAATTGAAAGCAAATGTCACCAATGGCCATAAATGA
AAATACGGCTTCTCAACTGTTAGACTTTACTCAAAAACTTGACATAAGTC
TTCTTGATGCTGTTGTCGATTGTATGTATACAGGGACTGGTTCTGAACAA
AAGATGGCGGAAAAGATTTTAACTACTTTAAAAGAGCATCCTGACGCTTG
GATTCGCGTTGATTCGATTCTTGAATGCAGCAATAACCAACAAACAAAAT
ATTACGCTTTACAAATTTTAGAAAATGTTATTAAATGTAAATGGAAAGTT
TTGCCAAGAGTACAATGTGAAGGGATTAAAAAGTATATCGTAGGATTAAT
AATTAAGACATCTAGTAATATGCAAATGTTGGAAAATGAAAAAGTTTATC
TAGGAAAGCTTAATATGATTTTAGTTCAGATACTGAAACATGAATGGCCT
AAAAATTGGCCGACATTCATTCAAGATATTGTTGGCAGTAGTCGTAGCAA
TGAGGCATTGTGTCAAAATAACATGGTTATTATGAAATTGCTGAGTGAAG
AAGTGTTTGATTTCTCGCTCGGTCAAATGACACAAACGAAAATAAAACAT
TTGAAAGACTCAATGTGTAGTGAATTCTCTCATATTTTCCAATTGTGTCA
ATATGTGTTGTTCCATTCTCAAAATGCTATGCTTGTCGTGTCGACTCTGG
AAACATTATTGAAATTTATGCACTGGATACCATTGGGATACATTTTCGAA
ACAAATCTCAATCAGACTTTAATAACAAAGTTTCTCAACGTTCCGATGTT
TAGGAATGTCACGTTGCAATGTTTAACAGAAATGGCCAACGTGTCCGGTA
GTGAGTATGTCAATGTTTTTATCGACATTTTCGAGAATACCACAAACGTT
TTGAAAGAAATGTTAGCCCCACAAACTAATATCAAAGAGGCTTACATGTA
CGGACAAGACGATGAACAGAAATTCATCCAAAACATGTCATTATTCTATT
CCAGTTTGTTCATGAATCATTTGCAATTGATCGAATCGAAAGAGAATTTG
CGATCTCAGCTAAATGACGCATTTGAGTATATGCTTAACATATCGGAGGT
CGAGGAAACGGAAATATTCAAAATCTGCCTCGAATTGTGGAATCATATTG
TTTCAGATTTATACCGACAAAACCAGGAAATGAATTACAACATGAACCAA
CACAATATCGATATTCCCCAGAGAAATCTATTCTATGCCCCGATATTGAG
TAGGCTGAGGAAAATTATGATTTCTCGAATGGCTCGACCCGAAGAAGTGC
TCGTTGTCGAGAATGAGCAAGGAGAAGTTGTCCGGGAATTCATGAAAGAT
ACCGACAGTATAAACCTGTATAAGAACATGAGAGAGTGCTTAGTTTATTT
GACTCATTTGGATTATCATGATACAGATCAGATTATGACTGATAAATTGG
GTAAACAAATGGACGGTTCAGAGTGGTCATGGAAAAATCTCAACACTCTC
TGTTGGGCTATCGGTAGTATTTCCGGTTCAATGCATGAGGATGATGAGCG
ACGATTTCTTGTCGTTGCCATCCGAGATTTGTTGAGTCTATGTGAACAAA
AACGTGGCAAAGACAACAAAGCCATAGTTGCCAGTAATATCATGTATGTT
GTCGGGCAATATCCGAGATTTTTAAAAGCCCATTGGCGATTTTTGAAAAC
CGTTATAACGAAACTATTTGAGTTCATGCATGAAACCCACGACGGCGTAC
AAGACATGGCCTGTGACACGTTCATTAAAATCGCCGTTAAATGTCGCCGA
CAATTCGTAACGCTACAGTCCGGTGAAATGTATACGTTTGTCGATGAGAT
CCTCGGCGGAATAAACAACATAATTAGCGATTTGCATCCACAACAAGTCC
ACACGTTCTATGAGGCAATGGGAATGGTCGTTGCCGCTGAGACCGACACA
GTTATACAGAGTGAATTGATCAATAAACTATTTTACCTTCCAAACCAAGT
ATGGGACGATATCATCACGCAGGCCCATGAAAATATTGAGATTCTTCAAA
ATCCAGATGTCGTTAAACAAATCGTCAATATTCTGAAGACCAATTATAGC
GCCTGCAAATCTCTTGGGGCTTCATATGTCCAGCAGTTGAGTCACATTTA
TATGGATATGCTCAATGTGTACAAGGTGATTTCGGAAAATATCAATATTG
CTGTTACTAATCACGGAGAGCAAGTTGCTAAGCAACCGGTTATTCGTGCA
ATGCGCGCAGTGAAAAAAGAAGCTTTAAAAATCATTTCGAGTTGGGTTCA
AAAGTCCGTTGATCCTGCAATGGTGGCCGAGAATTTTATTCCACCGATGC
TCGACGCCATTTTGTTCGATTATCAACGAAACATTGCCCCGGCTAGGGAA
CCGGAAGTGCTCAGTTCGATTGCAACGATTATCAACCGGTTGCATCAACA
CATCAATGAGCACATACCGACGATTTTGGATGCGGTTTTCGAATGCACCT
TGAACATGATCAATAAAGATATGGAAGAATATCCAGAACATCGAACGAAT
TTTTTCACGCTTCTTGAAGCCGTTAACCAGAAAAGCTTCATCGCATTTAC
AGTTTTACCGGCGGAAAAATTCAAATTGCTTCTCGATTCGATTATTTGGG
CGGTGAAACACACGATGAGACAGGTGAGCGAAACGGGTTTGAATATATTA
TTAAACTTGCTGCAAAATGTCGAAACCATAATGGAACAGGAAGCTAAACA
GGTCTTTTATAAAAACTTCTTCCTTGAGGTGTTGCATCATATGTTTTCCG
TCGTCACGGATTCTTCTCATGCTGGAAATCTTACTCTGCAATGCACGATT
TTGAGTTCCATGTTCAAATGTCTTGAAGATGGGAAAATCACCGTCAACTT
ATCGGTCACCCAAAACGGGCCGCTATTGGCCAGTCCCCAAGACAACGTGC
TGTATGTACAGAATTCTCTCGCAGCTCTTCTCAAACAAGCATTTCCTCAA
CTCCAAGATCCTCAAATTAAAGTTTTCATTGAAGGCTTGTTTTCTTTCAA
TCAAGATTTGGGCAGATTCCGAGAGAACATGAGGGATTTTCTAGTCCAGA
TTCGAGAATTTGCTGGCGATGATTTATCAGATTTGTTTTTGGAAGAAAAA
GAGACCGAAATCAGGCAAGCTCAAGAAGAGAAACAACGGATTAAAGCTTC
TGTTCCTGGAATTTTGAATCCTCACGAGATTACCGAGGATATGATTGATT
GATGCGCGCTCTTTGTGTTCTGTGTTTGTTGCTCGACTGATTGCAGACAT
TATTCATATTTTCAATAAATAAATAGAAGTTGTAACGTTGTTGAGTCTTC
G
back to top

protein sequence of SMED30007894-orf-1

>SMED30007894-orf-1 ID=SMED30007894-orf-1|Name=SMED30007894-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1075bp
MSPMAINENTASQLLDFTQKLDISLLDAVVDCMYTGTGSEQKMAEKILTT
LKEHPDAWIRVDSILECSNNQQTKYYALQILENVIKCKWKVLPRVQCEGI
KKYIVGLIIKTSSNMQMLENEKVYLGKLNMILVQILKHEWPKNWPTFIQD
IVGSSRSNEALCQNNMVIMKLLSEEVFDFSLGQMTQTKIKHLKDSMCSEF
SHIFQLCQYVLFHSQNAMLVVSTLETLLKFMHWIPLGYIFETNLNQTLIT
KFLNVPMFRNVTLQCLTEMANVSGSEYVNVFIDIFENTTNVLKEMLAPQT
NIKEAYMYGQDDEQKFIQNMSLFYSSLFMNHLQLIESKENLRSQLNDAFE
YMLNISEVEETEIFKICLELWNHIVSDLYRQNQEMNYNMNQHNIDIPQRN
LFYAPILSRLRKIMISRMARPEEVLVVENEQGEVVREFMKDTDSINLYKN
MRECLVYLTHLDYHDTDQIMTDKLGKQMDGSEWSWKNLNTLCWAIGSISG
SMHEDDERRFLVVAIRDLLSLCEQKRGKDNKAIVASNIMYVVGQYPRFLK
AHWRFLKTVITKLFEFMHETHDGVQDMACDTFIKIAVKCRRQFVTLQSGE
MYTFVDEILGGINNIISDLHPQQVHTFYEAMGMVVAAETDTVIQSELINK
LFYLPNQVWDDIITQAHENIEILQNPDVVKQIVNILKTNYSACKSLGASY
VQQLSHIYMDMLNVYKVISENINIAVTNHGEQVAKQPVIRAMRAVKKEAL
KIISSWVQKSVDPAMVAENFIPPMLDAILFDYQRNIAPAREPEVLSSIAT
IINRLHQHINEHIPTILDAVFECTLNMINKDMEEYPEHRTNFFTLLEAVN
QKSFIAFTVLPAEKFKLLLDSIIWAVKHTMRQVSETGLNILLNLLQNVET
IMEQEAKQVFYKNFFLEVLHHMFSVVTDSSHAGNLTLQCTILSSMFKCLE
DGKITVNLSVTQNGPLLASPQDNVLYVQNSLAALLKQAFPQLQDPQIKVF
IEGLFSFNQDLGRFRENMRDFLVQIREFAGDDLSDLFLEEKETEIRQAQE
EKQRIKASVPGILNPHEITEDMID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001878response to yeast
GO:0051168nuclear export
GO:0006886intracellular protein transport
GO:0000054ribosomal subunit export from nucleus
GO:0000055ribosomal large subunit export from nucleus
GO:0000056ribosomal small subunit export from nucleus
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006611protein export from nucleus
GO:0006810transport
GO:0010824regulation of centrosome duplication
GO:0015031protein transport
GO:0034504protein localization to nucleus
GO:0042176regulation of protein catabolic process
GO:0042493response to drug
GO:0046825regulation of protein export from nucleus
GO:0051028mRNA transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041235Exp1_repeat_2
IPR041123CRM1_repeat
IPR040485XPO1_repeat_3
IPR011989ARM-like
IPR016024ARM-type_fold
IPR014877XPO1_C_dom
IPR001494Importin-beta_N
IPR013598Exportin-1/Importin-b-like
Vocabulary: molecular function
TermDefinition
GO:0008536Ran GTPase binding
GO:0005488binding
GO:0003723RNA binding
GO:0005049nuclear export signal receptor activity
GO:0005487nucleocytoplasmic transporter activity
GO:0005515protein binding
GO:0008565protein transporter activity
GO:0019904protein domain specific binding
Vocabulary: cellular component
TermDefinition
GO:0000776kinetochore
GO:0005634nucleus
GO:0005642annulate lamellae
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0015030Cajal body
GO:0016020membrane
GO:0030529intracellular ribonucleoprotein complex
GO:0031965nuclear membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1038..1058
NoneNo IPR availablePANTHERPTHR11223:SF4EXPORTIN 1 (CRM1 HOMOLOG, YEAST) Bcoord: 7..1074
NoneNo IPR availablePANTHERPTHR11223EXPORTIN 1/5coord: 7..1074
IPR001494Importin-beta, N-terminal domainSMARTSM00913IBN_N_2coord: 44..110
e-value: 5.3E-9
score: 45.9
IPR001494Importin-beta, N-terminal domainPFAMPF03810IBN_Ncoord: 44..109
e-value: 6.4E-12
score: 45.2
IPR001494Importin-beta, N-terminal domainPROSITEPS50166IMPORTIN_B_NTcoord: 44..110
score: 13.919
IPR014877Exportin-1, C-terminalSMARTSM01102CRM1_C_2coord: 703..1030
e-value: 4.8E-159
score: 544.4
IPR014877Exportin-1, C-terminalPFAMPF08767CRM1_Ccoord: 703..1030
e-value: 1.9E-114
score: 382.1
IPR041235Exportin-1, repeat 2PFAMPF18784CRM1_repeat_2coord: 400..466
e-value: 9.8E-36
score: 121.2
IPR041123Chromosome region maintenance repeatPFAMPF18777CRM1_repeatcoord: 344..379
e-value: 3.4E-16
score: 58.5
IPR013598Exportin-1/Importin-beta-likePFAMPF08389Xpo1coord: 122..266
e-value: 6.0E-36
score: 123.8
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 3..1058
e-value: 0.0
score: 1367.5
IPR040485Exportin-1, repeat 3PFAMPF18787CRM1_repeat_3coord: 479..529
e-value: 1.0E-28
score: 99.2
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 26..1035