Galactosylceramide sulfotransferase

Overview
NameGalactosylceramide sulfotransferase
Smed IDSMED30007891
Length (bp)2454
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Galactosylceramide sulfotransferase (SMED30007891) t-SNE clustered cells

Violin plots show distribution of expression levels for Galactosylceramide sulfotransferase (SMED30007891) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Galactosylceramide sulfotransferase (SMED30007891) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Galactosylceramide sulfotransferase (SMED30007891) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007891

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007891SMESG000021672.1 SmedASXL_015780SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007891SMESG000021672.1 dd_Smed_v4_13130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007891SMESG000021672.1 dd_Smed_v4_13130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007891SMESG000021672.1 dd_Smed_v4_13130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007891SMESG000021672.1 dd_Smed_v4_13130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007891SMESG000021672.1 dd_Smed_v6_13130_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007891SMESG000021672.1 dd_Smed_v4_13130_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Human
Match: C3orf20 (chromosome 3 open reading frame 20 [Source:HGNC Symbol;Acc:HGNC:25320])

HSP 1 Score: 76.6406 bits (187), Expect = 1.267e-13
Identity = 104/494 (21.05%), Postives = 198/494 (40.08%), Query Frame = 3
Query:  930 HDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEING--IIAIFSIESKGII---FDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSM-FSAENNNLLSNIP---YSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKV----RLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNN 2372
            +DG+  ++YP+G +A+  +P       I    ++I G  ++A+F+ E +G +     T   Y+ I +D++     +    +  +  W       L  S+    N  +     G+++I V   F+   + V   +      + M +    N  +SN+    Y  + A    KK F+    + I    N +     L + +   K     ++ F  R      RL    +  G +     + +  ++I  T +    +   S +R   K  +      + K+   +S    +A+           CPLV++  ++  +     K      CL      P ++D+EL +F+         +     +      + S   +        + +  ++  +     PCI     SYRL  YD+ +    L     L+++K+ ++ GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP D++ S  N
Sbjct:  380 YDGSSFVYYPSGNVAVCQIPTCCRGRTITCLFNDIPGFSLLALFNTEGQGCVHYNLKTSCPYVLI-LDEEGGTTNDQQGYVVHKWSWTSRTETLL--SLEYKVNEEMKLKVLGQDSITVT--FTSLNETVTLTVSANNCPHGMAYDKRLNRRISNMDDKVYKMSRALAEIKKRFQKTVTQFI----NSILLAAGLFTIEYPTKKEEEEFVRFKMRSRTHPERLPKLSLYSGESLLRSQSGHLESSIAETLKDEPESAPVSPVRKTTKIHTKAKVTSRGKAREGRSPTRWAALPSD--------CPLVLRKLMLKEDTRAGCK------CLVKA---PLVSDVELERFL---------LAPRDPSQVLVFGIISSQNYTSTGQLQWLLNTLYNHQQRGRGSPCIQCRYDSYRLLQYDLDSP---LQEDPPLMVKKNSVVQGMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKFSVPN 835          
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Human
Match: C3orf20 (chromosome 3 open reading frame 20 [Source:HGNC Symbol;Acc:HGNC:25320])

HSP 1 Score: 76.6406 bits (187), Expect = 1.288e-13
Identity = 104/494 (21.05%), Postives = 199/494 (40.28%), Query Frame = 3
Query:  930 HDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEING--IIAIFSIESKGII---FDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSM-FSAENNNLLSNIP---YSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKV----RLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNN 2372
            +DG+  ++YP+G +A+  +P       I    ++I G  ++A+F+ E +G +     T   Y+ I +D++     +    +  +  W       L  S+    N  +     G+++I V   F+   + V   +      + M +    N  +SN+    Y  + A    KK F+    + I    N +     L + +   K     ++ F  R      RL    +  G +     + +  ++I  T +    +   S +R   K  +      + K+   +S    +A+         + CPLV++  ++  +     K      CL      P ++D+EL +F+         +     +      + S   +        + +  ++  +     PCI     SYRL  YD+ +    L     L+++K+ ++ GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP D++ S  N
Sbjct:  258 YDGSSFVYYPSGNVAVCQIPTCCRGRTITCLFNDIPGFSLLALFNTEGQGCVHYNLKTSCPYVLI-LDEEGGTTNDQQGYVVHKWSWTSRTETLL--SLEYKVNEEMKLKVLGQDSITVT--FTSLNETVTLTVSANNCPHGMAYDKRLNRRISNMDDKVYKMSRALAEIKKRFQKTVTQFI----NSILLAAGLFTIEYPTKKEEEEFVRFKMRSRTHPERLPKLSLYSGESLLRSQSGHLESSIAETLKDEPESAPVSPVRKTTKIHTKAKVTSRGKAREGRSPTRWAALP--------SDCPLVLRKLMLKEDTRAGCK------CLVK---APLVSDVELERFL---------LAPRDPSQVLVFGIISSQNYTSTGQLQWLLNTLYNHQQRGRGSPCIQCRYDSYRLLQYDLDSP---LQEDPPLMVKKNSVVQGMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKFSVPN 713          
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Human
Match: C3orf20 (chromosome 3 open reading frame 20 [Source:HGNC Symbol;Acc:HGNC:25320])

HSP 1 Score: 76.6406 bits (187), Expect = 1.288e-13
Identity = 104/494 (21.05%), Postives = 199/494 (40.28%), Query Frame = 3
Query:  930 HDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEING--IIAIFSIESKGII---FDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSM-FSAENNNLLSNIP---YSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKV----RLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNN 2372
            +DG+  ++YP+G +A+  +P       I    ++I G  ++A+F+ E +G +     T   Y+ I +D++     +    +  +  W       L  S+    N  +     G+++I V   F+   + V   +      + M +    N  +SN+    Y  + A    KK F+    + I    N +     L + +   K     ++ F  R      RL    +  G +     + +  ++I  T +    +   S +R   K  +      + K+   +S    +A+         + CPLV++  ++  +     K      CL      P ++D+EL +F+         +     +      + S   +        + +  ++  +     PCI     SYRL  YD+ +    L     L+++K+ ++ GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP D++ S  N
Sbjct:  258 YDGSSFVYYPSGNVAVCQIPTCCRGRTITCLFNDIPGFSLLALFNTEGQGCVHYNLKTSCPYVLI-LDEEGGTTNDQQGYVVHKWSWTSRTETLL--SLEYKVNEEMKLKVLGQDSITVT--FTSLNETVTLTVSANNCPHGMAYDKRLNRRISNMDDKVYKMSRALAEIKKRFQKTVTQFI----NSILLAAGLFTIEYPTKKEEEEFVRFKMRSRTHPERLPKLSLYSGESLLRSQSGHLESSIAETLKDEPESAPVSPVRKTTKIHTKAKVTSRGKAREGRSPTRWAALP--------SDCPLVLRKLMLKEDTRAGCK------CLVK---APLVSDVELERFL---------LAPRDPSQVLVFGIISSQNYTSTGQLQWLLNTLYNHQQRGRGSPCIQCRYDSYRLLQYDLDSP---LQEDPPLMVKKNSVVQGMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKFSVPN 713          
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Xenopus
Match: tdrd3 (tudor domain containing 3 [Source:Xenbase;Acc:XB-GENE-949075])

HSP 1 Score: 93.5893 bits (231), Expect = 6.810e-19
Identity = 58/187 (31.02%), Postives = 91/187 (48.66%), Query Frame = 3
Query: 1797 VCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQ 2357
             CP+V+Q  ++               C C+   IP +TD+E  + IN   +    ++           V+S+    E   S  + ++ ++        PC+     S+RL  YDI +  +   S   LLL++H + PGM LM+ +GKL+FA+YIFNGY  +  DL KQI   +   Q G+ LPSDF+
Sbjct:  736 TCPVVLQRLILGEEG---------GMCRCSNHQIPNITDLEYDKLINMKMTPTEQILV-------VCVVSSRNS--EEDQSTDVLNLLYERKNRYRSMPCMQSRLDSFRLLKYDINSCTELTESKVPLLLQRHSVAPGMFLMYIRGKLLFANYIFNGYSRSVKDLQKQIVKTRSDYQMGYSLPSDFK 904          
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Mouse
Match: 4930590J08Rik (RIKEN cDNA 4930590J08 gene [Source:MGI Symbol;Acc:MGI:2685917])

HSP 1 Score: 73.9442 bits (180), Expect = 6.653e-13
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 2046 ITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFN 2369
            + D  +  L+     PCI      YRL  YD+ +    L     L+++K  +I GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP +++   +
Sbjct:  723 LMDTLYSHLQQGRSSPCIQCRHDPYRLLRYDLDSP---LQKDPPLMVKKFAVIHGMVLMFAGGKLLFGGCVLNGYGFSKQNLLKQIFRAQQDCKMGYFLPDNYKFKHD 827          
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Mouse
Match: 4930590J08Rik (RIKEN cDNA 4930590J08 gene [Source:MGI Symbol;Acc:MGI:2685917])

HSP 1 Score: 73.9442 bits (180), Expect = 6.653e-13
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 2046 ITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFN 2369
            + D  +  L+     PCI      YRL  YD+ +    L     L+++K  +I GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP +++   +
Sbjct:  723 LMDTLYSHLQQGRSSPCIQCRHDPYRLLRYDLDSP---LQKDPPLMVKKFAVIHGMVLMFAGGKLLFGGCVLNGYGFSKQNLLKQIFRAQQDCKMGYFLPDNYKFKHD 827          
BLAST of Galactosylceramide sulfotransferase vs. UniProt/SwissProt
Match: sp|Q8ND61|CC020_HUMAN (Uncharacterized protein C3orf20 OS=Homo sapiens OX=9606 GN=C3orf20 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 6.084e-13
Identity = 104/494 (21.05%), Postives = 198/494 (40.08%), Query Frame = 3
Query:  930 HDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEING--IIAIFSIESKGII---FDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSM-FSAENNNLLSNIP---YSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKV----RLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNN 2372
            +DG+  ++YP+G +A+  +P       I    ++I G  ++A+F+ E +G +     T   Y+ I +D++     +    +  +  W       L  S+    N  +     G+++I V   F+   + V   +      + M +    N  +SN+    Y  + A    KK F+    + I    N +     L + +   K     ++ F  R      RL    +  G +     + +  ++I  T +    +   S +R   K  +      + K+   +S    +A+           CPLV++  ++  +     K      CL      P ++D+EL +F+         +     +      + S   +        + +  ++  +     PCI     SYRL  YD+ +    L     L+++K+ ++ GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP D++ S  N
Sbjct:  380 YDGSSFVYYPSGNVAVCQIPTCCRGRTITCLFNDIPGFSLLALFNTEGQGCVHYNLKTSCPYVLI-LDEEGGTTNDQQGYVVHKWSWTSRTETLL--SLEYKVNEEMKLKVLGQDSITVT--FTSLNETVTLTVSANNCPHGMAYDKRLNRRISNMDDKVYKMSRALAEIKKRFQKTVTQFI----NSILLAAGLFTIEYPTKKEEEEFVRFKMRSRTHPERLPKLSLYSGESLLRSQSGHLESSIAETLKDEPESAPVSPVRKTTKIHTKAKVTSRGKAREGRSPTRWAALPSD--------CPLVLRKLMLKEDTRAGCK------CLVKA---PLVSDVELERFL---------LAPRDPSQVLVFGIISSQNYTSTGQLQWLLNTLYNHQQRGRGSPCIQCRYDSYRLLQYDLDSP---LQEDPPLMVKKNSVVQGMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKFSVPN 835          
BLAST of Galactosylceramide sulfotransferase vs. UniProt/SwissProt
Match: sp|Q8CDN1|CC020_MOUSE (Uncharacterized protein C3orf20 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.654e-12
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 2046 ITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFN 2369
            + D  +  L+     PCI      YRL  YD+ +    L     L+++K  +I GM LMF  GKL+F   + NGYG +K +LLKQI   +Q  + G+ LP +++   +
Sbjct:  723 LMDTLYSHLQQGRSSPCIQCRHDPYRLLRYDLDSP---LQKDPPLMVKKFAVIHGMVLMFAGGKLLFGGCVLNGYGFSKQNLLKQIFRAQQDCKMGYFLPDNYKFKHD 827          
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Match: A0A384BTM6 (uncharacterized protein C3orf20 homolog isoform X7 OS=Ursus maritimus OX=29073 GN=LOC103660116 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.752e-23
Identity = 123/513 (23.98%), Postives = 228/513 (44.44%), Query Frame = 3
Query:  933 DGTRCIHYPNGKLALL--YVPKPNGNVLILNNGSEI--NGIIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKE-----KPV---YFP--IHEWLFSN-SMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIK----------SNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINK-GRAKSAISNRNKTNNILF----TSQKMNRN-----ISTSIIRPREKTFSSNLFRLKEKSYSIKSQR-PQSAIDKTDSSF-SVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQL 2360
            DG+   +YP+G+LA+   Y   P G  +  N  S++    I+  F+    G I    ++ + +  +QD     +    + RE  WP     KL + +++  N F++   SG+  I + +++  +       PV   +FP  + E  F + +  S E   L              T+  + +   + +K          S  +++  ++ L   + K+K IL +W+++Y+  + ++   I K  +    +  R K ++  F    + ++ + N        S ++ +     + LF  ++   S +S R P   I   D+ F S  +CP+V++  L  +             C C+  +IP++TD+E    I+   SS   +I         + V S  K   +  +  +  +Y   L  S   PCI      +RL  Y+I ++ K       LL+++H +IPG+ LM+ +GKL+FA++IFNGY ++  DL KQI   K     G+ LP DF++
Sbjct:  108 DGSSLTYYPSGRLAVCQSYSSLPGGG-MYTNIFSDLPNQVILGTFTPFGCGSISFPNSRIISMMFNQDGGMVISKKGNIVREWMWPSK--GKLDDPVDVWVNRFITVEISGRFAITLVYKWYSQSLKLSLAPVKCNFFPPCLSEEPFPDVNPISTEARELFKAYKVKCKHLKSTTQDKYPSSLTDTMKIATFDPVMDISPFSDIPTVIKLRGLQKKVKHILFHWLDYYRFALGIESLHIGKMPKFPKKVIRRQKVSSARFPLKQSVEEKDENKEYLRYRNSFLKLKGVFKPAPLFHTQKTPVSNQSFRFPPPPIKSKDAWFASQLLCPVVLRRTLCGQEG---------GTCQCSTYNIPEVTDLEYDHLISHQLSSMDQLI--------IVHVFSASKM--DKTTKEMAKVY-RKLNRSKSMPCIQSCSDPFRLLKYNITSACKLTGGCCPLLVQRHNVIPGIFLMYIRGKLVFANFIFNGYSTSAKDLQKQIVKTKSDYCTGYFLPDDFRI 597          
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Match: A0A384BTN0 (uncharacterized protein C3orf20 homolog isoform X8 OS=Ursus maritimus OX=29073 GN=LOC103660116 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.816e-23
Identity = 123/513 (23.98%), Postives = 228/513 (44.44%), Query Frame = 3
Query:  933 DGTRCIHYPNGKLALL--YVPKPNGNVLILNNGSEI--NGIIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKE-----KPV---YFP--IHEWLFSN-SMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIK----------SNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINK-GRAKSAISNRNKTNNILF----TSQKMNRN-----ISTSIIRPREKTFSSNLFRLKEKSYSIKSQR-PQSAIDKTDSSF-SVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQL 2360
            DG+   +YP+G+LA+   Y   P G  +  N  S++    I+  F+    G I    ++ + +  +QD     +    + RE  WP     KL + +++  N F++   SG+  I + +++  +       PV   +FP  + E  F + +  S E   L              T+  + +   + +K          S  +++  ++ L   + K+K IL +W+++Y+  + ++   I K  +    +  R K ++  F    + ++ + N        S ++ +     + LF  ++   S +S R P   I   D+ F S  +CP+V++  L  +             C C+  +IP++TD+E    I+   SS   +I         + V S  K   +  +  +  +Y   L  S   PCI      +RL  Y+I ++ K       LL+++H +IPG+ LM+ +GKL+FA++IFNGY ++  DL KQI   K     G+ LP DF++
Sbjct:  105 DGSSLTYYPSGRLAVCQSYSSLPGGG-MYTNIFSDLPNQVILGTFTPFGCGSISFPNSRIISMMFNQDGGMVISKKGNIVREWMWPSK--GKLDDPVDVWVNRFITVEISGRFAITLVYKWYSQSLKLSLAPVKCNFFPPCLSEEPFPDVNPISTEARELFKAYKVKCKHLKSTTQDKYPSSLTDTMKIATFDPVMDISPFSDIPTVIKLRGLQKKVKHILFHWLDYYRFALGIESLHIGKMPKFPKKVIRRQKVSSARFPLKQSVEEKDENKEYLRYRNSFLKLKGVFKPAPLFHTQKTPVSNQSFRFPPPPIKSKDAWFASQLLCPVVLRRTLCGQEG---------GTCQCSTYNIPEVTDLEYDHLISHQLSSMDQLI--------IVHVFSASKM--DKTTKEMAKVY-RKLNRSKSMPCIQSCSDPFRLLKYNITSACKLTGGCCPLLVQRHNVIPGIFLMYIRGKLVFANFIFNGYSTSAKDLQKQIVKTKSDYCTGYFLPDDFRI 594          
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Match: A0A384BUV7 (uncharacterized protein C3orf20 homolog isoform X6 OS=Ursus maritimus OX=29073 GN=LOC103660116 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.880e-23
Identity = 123/513 (23.98%), Postives = 227/513 (44.25%), Query Frame = 3
Query:  933 DGTRCIHYPNGKLALL--YVPKPNGNVLILNNGSEING--IIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKE-----KPV---YFP--IHEWLFSN-SMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIK----------SNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINK-GRAKSAISNRNKTNNILFTSQKM--NRNISTSIIRPREKTF-------SSNLFRLKEKSYSIKSQR-PQSAIDKTDSSF-SVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQL 2360
            DG+   +YP+G+LA+   Y   P G  +  N  S++    I+  F+    G I    ++ + +  +QD     +    + RE  WP     KL + +++  N F++   SG+  I + +++  +       PV   +FP  + E  F + +  S E   L              T+  + +   + +K          S  +++  ++ L   + K+K IL +W+++Y+  + ++   I K  +    +  R K ++  F  ++    ++ +   +R R            + LF  ++   S +S R P   I   D+ F S  +CP+V++  L  +             C C+  +IP++TD+E    I+   SS   +I         + V S  K   +  +  +  +Y   L  S   PCI      +RL  Y+I ++ K       LL+++H +IPG+ LM+ +GKL+FA++IFNGY ++  DL KQI   K     G+ LP DF++
Sbjct:  124 DGSSLTYYPSGRLAVCQSYSSLPGGG-MYTNIFSDLPNQVILGTFTPFGCGSISFPNSRIISMMFNQDGGMVISKKGNIVREWMWPSK--GKLDDPVDVWVNRFITVEISGRFAITLVYKWYSQSLKLSLAPVKCNFFPPCLSEEPFPDVNPISTEARELFKAYKVKCKHLKSTTQDKYPSSLTDTMKIATFDPVMDISPFSDIPTVIKLRGLQKKVKHILFHWLDYYRFALGIESLHIGKMPKFPKKVIRRQKVSSARFPLKQSVEEKDENKEYLRYRNSFLKLKGVFKPAPLFHTQKTPVSNQSFRFPPPPIKSKDAWFASQLLCPVVLRRTLCGQEG---------GTCQCSTYNIPEVTDLEYDHLISHQLSSMDQLI--------IVHVFSASKM--DKTTKEMAKVY-RKLNRSKSMPCIQSCSDPFRLLKYNITSACKLTGGCCPLLVQRHNVIPGIFLMYIRGKLVFANFIFNGYSTSAKDLQKQIVKTKSDYCTGYFLPDDFRI 613          
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Match: A0A2T7NVI0 (Tr-type G domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15677 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.802e-22
Identity = 124/533 (23.26%), Postives = 233/533 (43.71%), Query Frame = 3
Query: 1041 IIAIFSIESKGIIF-DTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINIT------FNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSMF-SAENNNLLSNIPYSSNFATEITKKSFKNPK------------------KEAIKSNENELKYILDLES------FKTKIKDILSNWINFYKRKVRLKD-FLINKGRAKSAISNRNKTN------------------NILFTSQKMNRNIS-----TSIIRPREKTF------SSNLFRLK---EKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLS----FNNESKQWLEEGAYSKIQTFNAP 2432
            ++A F+    G+ +  +GN  ++    +   +   S+ +LER+ KWP       P  + IT       +S++SF C  ++++ + F   +KE    FP+H     ++ + S EN+ LL+N  + S  A ++ +     PK                   E +KS + + K + D E+       + K ++++ +W+  Y+  + L    L     + + +  R +T                   +I ++S K+ R  S     TS I   E  F       S+L R K   + + S+  Q   S++   D   ++T+CP  +   ++++            QC C++ +IP + D+E  ++I+       + I         + ++S      N    +I  IY    +N + +PC+      +R+  YDI ++ +    +Q LLL +H ++PGM L++  GKL+F D+I NGYG T+ D  KQ+   +    +G  LPSDF+ S     +     W  E   + + +F +P
Sbjct:  927 MLACFTPSGCGVCYHSSGN--VRFLAHRKGGRLAESNGRLERKWKWP-------PGGVKITVPVAFQLSSYISFRCVSESHMILFFN-CQKET-ARFPVHAAPGVSAPYGSDENDQLLTNFTFISRAARDLLR--LFAPKVKTNKSKLKKKDKLGRQLAELVKSVDTQEKSLYDSEADKELARLQRKTRNLIDDWMEHYRLTIGLHSPHLSMMSDSPTRLRQRRQTQSAKPLDGDRTERCEMLGMDITYSSSKILRAPSAPSGKTSKIDFVEIPFLKRNKNVSSLLRSKSAMQLTRSLVRQETASSLQDHDLLPNMTLCPNAVHQLMLHQPRP---------QCRCSRHAIPVIRDVEYDRYISKEAPPSQLQI---------IMIHSSLYPNTNPAEPMINRIYATQNRNRT-RPCLQSRTDMFRILKYDINSATEDCTHSQPLLLTRHNVVPGMFLIYAGGKLLFCDHILNGYGYTQKDFKKQVMKSRYDFLHGQSLPSDFRFSPSKGCHGPRSAWGGEIGGTGVDSFGSP 1427          
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Match: F6Z411 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.312e-21
Identity = 80/236 (33.90%), Postives = 114/236 (48.31%), Query Frame = 3
Query: 1674 IRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQ---CLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNS---KGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLS 2363
            IR R  T SS +    +KS    S      + +   S +   CP+V       RN + Y+ S  PD+   C C+K  IP++ DIE   +I  V     +V+  I        VNS        E  L NL    Y D  KN + KPC+      YR+  YD+  +    N T  LLL +H ++PGM LM+  G+L+FAD+IFNGYG+ ++D  KQ+   +Q    G  LP DF+ +
Sbjct:   52 IRSRPATHSSRILIRPQKSSMRASSVASHKVGEKSWSPAPECCPVV------TRNKKIYTDSKGPDRPFSCKCSKHRIPQINDIEFDCYIRLVAPPSQVVVISI--------VNSLYPDAAPYEAMLDNL----YLDKNKNRT-KPCMQSRHDLYRILRYDLAVAKSGTNRTTPLLLGRHNVVPGMTLMYCGGRLIFADHIFNGYGNARNDFKKQVYKTRQEYLMGHLLPDDFRFT 268          
BLAST of Galactosylceramide sulfotransferase vs. Planmine SMEST
Match: SMESG000021672.1 (SMESG000021672.1)

HSP 1 Score: 1127.46 bits (2915), Expect = 0.000e+0
Identity = 577/577 (100.00%), Postives = 577/577 (100.00%), Query Frame = 3
Query:  717 NASTNNEKQKSWICKAQVLYYKQTQKELINTKTAPNISNINEFFKHLISNLSFDNTTDNKSTAEKLKDSISHDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEINGIIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINXXXXXXXXXXXXXXXXXXALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNNESKQWLEEGAYSKIQTFNAPQNVTS 2447
            NASTNNEKQKSWICKAQVLYYKQTQKELINTKTAPNISNINEFFKHLISNLSFDNTTDNKSTAEKLKDSISHDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEINGIIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINSVKSSQIIVIGVISTGSSALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNNESKQWLEEGAYSKIQTFNAPQNVTS
Sbjct:  219 NASTNNEKQKSWICKAQVLYYKQTQKELINTKTAPNISNINEFFKHLISNLSFDNTTDNKSTAEKLKDSISHDGTRCIHYPNGKLALLYVPKPNGNVLILNNGSEINGIIAIFSIESKGIIFDTGNQYMQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCSGKNNIYVKFEFSEKEKPVYFPIHEWLFSNSMFSAENNNLLSNIPYSSNFATEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRKVRLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFSSNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECYSKSLSPDQCLCNKQSIPKLTDIELFQFINSVKSSQIIVIGVISTGSSALQVNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTSGKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQINLCKQLSQNGFHLPSDFQLSFNNESKQWLEEGAYSKIQTFNAPQNVTS 795          

HSP 2 Score: 333.569 bits (854), Expect = 5.951e-102
Identity = 218/221 (98.64%), Postives = 220/221 (99.55%), Query Frame = 1
Query:   19 MNYFFHQKNFKCKVRIPIKNDLVPXXXXXXXXXXXXXXXXXXYSCVNTSDKPIISNPSPQVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIILEYDDFVLAYPTKVHYLNVENILEYTCESINMGDMTKPSKVNPVNNSITYLHNEIPKEDELPKEKFSTNINLSTLENKLTVPAIQFVLSSPKSNDYLTDLNLELTFSAFDWAIKKLRSTLNHMLAT 681
            MNYFFHQKNFKCKVRIPIKNDLVPNIFSNENNSEIIDIKNNIYSCVNTSDKPIISNPSPQVYAKSSEKSAALSLEKLFKKFRKLSLSLLEELGIILEYDDFVLAYPTKVHYLNVENILEYTCESINMGDMTKPSKVNPVNNSITYLHNEIPKEDELPKEKFSTNINLSTLENKLTVPAIQFVLSSPKSNDYLTDLNLELTFSAFDWAIKKLRSTLNH+ A+
Sbjct:    1 MNYFFHQKNFKCKVRIPIKNDLVPNIFSNENNSEIIDIKNNIYSCVNTSDKPIISNPSPQVYAKSSEKSAALSLEKLFKKFRKLSLSLLEELGIILEYDDFVLAYPTKVHYLNVENILEYTCESINMGDMTKPSKVNPVNNSITYLHNEIPKEDELPKEKFSTNINLSTLENKLTVPAIQFVLSSPKSNDYLTDLNLELTFSAFDWAIKKLRSTLNHINAS 221          
The following BLAST results are available for this feature:
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C3orf201.267e-1321.05chromosome 3 open reading frame 20 [Source:HGNC Sy... [more]
C3orf201.288e-1321.05chromosome 3 open reading frame 20 [Source:HGNC Sy... [more]
C3orf201.288e-1321.05chromosome 3 open reading frame 20 [Source:HGNC Sy... [more]
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdrd36.810e-1931.02tudor domain containing 3 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
4930590J08Rik6.653e-1334.26RIKEN cDNA 4930590J08 gene [Source:MGI Symbol;Acc:... [more]
4930590J08Rik6.653e-1334.26RIKEN cDNA 4930590J08 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Galactosylceramide sulfotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8ND61|CC020_HUMAN6.084e-1321.05Uncharacterized protein C3orf20 OS=Homo sapiens OX... [more]
sp|Q8CDN1|CC020_MOUSE4.654e-1234.26Uncharacterized protein C3orf20 homolog OS=Mus mus... [more]
back to top
BLAST of Galactosylceramide sulfotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A384BTM61.752e-2323.98uncharacterized protein C3orf20 homolog isoform X7... [more]
A0A384BTN01.816e-2323.98uncharacterized protein C3orf20 homolog isoform X8... [more]
A0A384BUV71.880e-2323.98uncharacterized protein C3orf20 homolog isoform X6... [more]
A0A2T7NVI01.802e-2223.26Tr-type G domain-containing protein OS=Pomacea can... [more]
F6Z4112.312e-2133.90Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galactosylceramide sulfotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021672.15.951e-102100.00SMESG000021672.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007891 ID=SMED30007891|Name=Galactosylceramide sulfotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2454bp
CCGTTTTTAATTTTGGATATGAATTACTTTTTTCATCAAAAAAATTTTAA
ATGTAAAGTTAGAATACCAATAAAAAATGATTTAGTACCTAATATTTTTT
CTAATGAAAATAATTCAGAAATTATTGACATAAAAAATAATATATATAGT
TGTGTGAATACATCAGATAAACCAATTATTTCAAATCCATCTCCTCAAGT
TTATGCTAAATCATCCGAAAAATCTGCAGCTTTGTCATTAGAAAAATTGT
TTAAAAAATTTCGAAAATTAAGTCTATCTCTGTTAGAAGAACTGGGTATA
ATTTTAGAATACGATGATTTTGTACTAGCATATCCTACAAAAGTACACTA
TCTAAATGTAGAAAATATTTTGGAATATACATGTGAAAGTATTAATATGG
GAGATATGACGAAGCCGTCTAAAGTTAATCCTGTAAATAATTCCATTACA
TATTTACATAATGAAATACCAAAAGAAGATGAATTGCCAAAAGAGAAATT
TTCTACTAATATTAATTTGTCCACATTGGAAAATAAATTAACTGTTCCTG
CTATTCAATTTGTTTTATCTTCACCGAAATCCAATGATTATCTAACGGAT
TTGAATCTAGAATTAACATTTTCTGCATTTGATTGGGCGATTAAAAAACT
GAGATCGACTTTGAACCACATGTTAGCTACTTTATTAAATACAATTGTTG
TCAATCGTGATATAGCAACGCATCAACTAATAATGAAAAACAAAAGTCAT
GGATTTGTAAAGCACAAGTTCTTTATTACAAACAAACTCAAAAAGAATTG
ATCAATACGAAAACAGCTCCAAATATAAGCAATATCAATGAGTTTTTCAA
ACATCTCATTTCTAATTTGTCCTTCGATAATACCACTGACAACAAATCGA
CTGCCGAGAAATTGAAAGACTCAATATCTCATGATGGAACTCGATGTATA
CATTATCCAAATGGAAAATTGGCTCTCCTTTACGTACCAAAACCTAATGG
AAACGTATTAATCCTCAATAATGGTAGTGAAATAAATGGCATCATTGCTA
TTTTTTCAATTGAGAGCAAAGGAATAATTTTTGATACTGGGAATCAGTAT
ATGCAAATTTATATAGATCAAGATTCTTGCAAATTTTTCAATTCCAGTTG
TCAATTAGAACGGGAAATGAAATGGCCCAGAAATATCAATAACAAATTAC
CAAATTCAATTAATATCACCTTTAATTCTTTTTTGTCATTTCATTGTTCA
GGAAAAAATAATATTTATGTAAAGTTCGAATTTTCCGAAAAAGAAAAACC
CGTATATTTTCCGATTCACGAATGGCTTTTTAGCAATTCCATGTTTTCGG
CAGAAAATAATAACTTACTTTCAAATATTCCATATTCATCAAACTTTGCA
ACGGAAATTACTAAAAAAAGTTTTAAAAATCCCAAAAAAGAAGCAATTAA
ATCAAATGAAAATGAACTAAAGTATATTTTGGATCTAGAAAGTTTTAAAA
CCAAAATAAAAGATATTTTATCAAATTGGATTAACTTCTACAAGAGAAAA
GTAAGATTAAAAGATTTTTTAATAAACAAAGGAAGAGCCAAGTCGGCAAT
AAGCAACAGAAACAAAACTAATAACATATTGTTTACCAGTCAGAAAATGA
ACAGAAATATATCAACGTCAATTATAAGACCACGTGAGAAAACTTTTTCA
AGCAACTTATTCAGATTAAAAGAAAAAAGTTATTCAATTAAATCCCAAAG
ACCGCAGTCAGCTATTGATAAAACTGATAGCTCGTTTTCAGTAACCGTTT
GTCCTCTCGTTATTCAAATTGATCTTATGAACCGAAATAATGAATGCTAT
TCCAAATCTTTAAGCCCCGACCAGTGTTTGTGTAATAAACAAAGCATTCC
AAAGTTAACCGATATCGAACTATTTCAATTTATAAATTCCGTCAAATCTA
GTCAAATAATAGTAATTGGCGTCATCTCAACTGGATCCTCAGCTCTTCAG
GTAAACTCGAAAGGAAAATTTATTGAAAATTCACTTTCCAATTTGATCAC
CGATATTTATTTTGATGATTTAAAAAACTCTAGCCAAAAACCATGCATAA
TATATAGTCGAAAATCATACCGATTGTTTTTGTACGATATCCGCACGTCT
GGGAAATATCTTAACAGCACTCAATCTTTATTGTTAAGAAAACATCAGAT
TATTCCAGGAATGTGCCTAATGTTTCAGCAAGGAAAACTTATGTTTGCAG
ATTACATATTCAATGGTTACGGTTCTACTAAAAGTGATTTATTAAAACAA
ATAAATTTGTGCAAACAACTTTCTCAAAATGGATTTCATCTTCCTAGTGA
TTTTCAATTAAGTTTTAATAATGAAAGCAAGCAATGGCTGGAAGAAGGTG
CTTATTCCAAAATCCAAACTTTTAATGCTCCTCAAAATGTGACATCATAA
CTAC
back to top

protein sequence of SMED30007891-orf-1

>SMED30007891-orf-1 ID=SMED30007891-orf-1|Name=SMED30007891-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MQIYIDQDSCKFFNSSCQLEREMKWPRNINNKLPNSINITFNSFLSFHCS
GKNNIYVKFEFSEKEKPVYFPIHEWLFSNSMFSAENNNLLSNIPYSSNFA
TEITKKSFKNPKKEAIKSNENELKYILDLESFKTKIKDILSNWINFYKRK
VRLKDFLINKGRAKSAISNRNKTNNILFTSQKMNRNISTSIIRPREKTFS
SNLFRLKEKSYSIKSQRPQSAIDKTDSSFSVTVCPLVIQIDLMNRNNECY
SKSLSPDQCLCNKQSIPKLTDIELFQFINSVKSSQIIVIGVISTGSSALQ
VNSKGKFIENSLSNLITDIYFDDLKNSSQKPCIIYSRKSYRLFLYDIRTS
GKYLNSTQSLLLRKHQIIPGMCLMFQQGKLMFADYIFNGYGSTKSDLLKQ
INLCKQLSQNGFHLPSDFQLSFNNESKQWLEEGAYSKIQTFNAPQNVTS*
back to top

protein sequence of SMED30007891-orf-2

>SMED30007891-orf-2 ID=SMED30007891-orf-2|Name=SMED30007891-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
PFLILDMNYFFHQKNFKCKVRIPIKNDLVPNIFSNENNSEIIDIKNNIYS
CVNTSDKPIISNPSPQVYAKSSEKSAALSLEKLFKKFRKLSLSLLEELGI
ILEYDDFVLAYPTKVHYLNVENILEYTCESINMGDMTKPSKVNPVNNSIT
YLHNEIPKEDELPKEKFSTNINLSTLENKLTVPAIQFVLSSPKSNDYLTD
LNLELTFSAFDWAIKKLRSTLNHMLATLLNTIVVNRDIATHQLIMKNKSH
GFVKHKFFITNKLKKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001733galactosylceramide sulfotransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0009247glycolipid biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029281FAM194_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR23093:SF16coord: 20..423
NoneNo IPR availablePANTHERPTHR23093FAMILY NOT NAMEDcoord: 20..423