SMED30007879

Overview
NameSMED30007879
Smed IDSMED30007879
Length (bp)964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007879 (SMED30007879) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007879 (SMED30007879) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007879 (SMED30007879) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007879 (SMED30007879) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007879

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007879SMESG000014356.1 dd_Smed_v4_4641_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007879 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002641:19387..20401 -4724
Homology
BLAST of SMED30007879 vs. Ensembl Human
Match: PPP1R3B (protein phosphatase 1 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:14942])

HSP 1 Score: 48.1358 bits (113), Expect = 3.766e-8
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV +R + + W S+ D+  ++   T++ S  D FSF I +      +   +EFA+ Y
Sbjct:   58 KVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVYY 214          

HSP 2 Score: 28.8758 bits (63), Expect = 3.766e-8
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  215 ECNGQTYWDSNRGKNYRIIRA 235          
BLAST of SMED30007879 vs. Ensembl Human
Match: PPP1R3B (protein phosphatase 1 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:14942])

HSP 1 Score: 48.1358 bits (113), Expect = 3.766e-8
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV +R + + W S+ D+  ++   T++ S  D FSF I +      +   +EFA+ Y
Sbjct:   58 KVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVYY 214          

HSP 2 Score: 28.8758 bits (63), Expect = 3.766e-8
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  215 ECNGQTYWDSNRGKNYRIIRA 235          
BLAST of SMED30007879 vs. Ensembl Human
Match: PPP1R3B (protein phosphatase 1 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:14942])

HSP 1 Score: 48.1358 bits (113), Expect = 3.766e-8
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV +R + + W S+ D+  ++   T++ S  D FSF I +      +   +EFA+ Y
Sbjct:   58 KVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVYY 214          

HSP 2 Score: 28.8758 bits (63), Expect = 3.766e-8
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  215 ECNGQTYWDSNRGKNYRIIRA 235          
BLAST of SMED30007879 vs. Ensembl Human
Match: PPP1R3B (protein phosphatase 1 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:14942])

HSP 1 Score: 48.1358 bits (113), Expect = 3.766e-8
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV +R + + W S+ D+  ++   T++ S  D FSF I +      +   +EFA+ Y
Sbjct:   58 KVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVYY 214          

HSP 2 Score: 28.8758 bits (63), Expect = 3.766e-8
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  215 ECNGQTYWDSNRGKNYRIIRA 235          
BLAST of SMED30007879 vs. Ensembl Celegans
Match: H18N23.2 (Protein phosphatase 1 regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q400N3])

HSP 1 Score: 49.2914 bits (116), Expect = 4.848e-7
Identity = 53/184 (28.80%), Postives = 81/184 (44.02%), Query Frame = 2
Query:  278 LSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSNT----------PSP-------DIFPDFV-YTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICV-SSVCCVFGAVIEFAICYNV 772
            L   E  K RKSV FAD+ G E+ +    T      P    S L+++R  +          P+P           D+V +  N E+       + V L++V L+        + G I V N   +K+VFVR + N WIS++D  + +  + S   D F F + + SSV  +    IEF IC+  
Sbjct:  105 LELKEEEKLRKSVRFADDCGHELYMVRVATEPSNCPPKLSPSVLRRYRGESFEEEEMTTREPAPVWNLMFKQPAADYVRFRENMET-------NKVSLENVILNNEAYK---VMGTIKVGNIAFEKSVFVRYTMNGWISYMDKAAIYQPSTSKIQDTFKFDLDLPSSVEKIH--QIEFCICFKA 276          

HSP 2 Score: 22.7126 bits (47), Expect = 4.848e-7
Identity = 7/13 (53.85%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  775 GQEFWDNNNDINY 813
            G E+WD+N+  NY
Sbjct:  278 GTEYWDSNSGTNY 290          
BLAST of SMED30007879 vs. Ensembl Celegans
Match: H18N23.2 (Protein phosphatase 1 regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q400N3])

HSP 1 Score: 49.2914 bits (116), Expect = 4.953e-7
Identity = 53/184 (28.80%), Postives = 81/184 (44.02%), Query Frame = 2
Query:  278 LSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSNT----------PSP-------DIFPDFV-YTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICV-SSVCCVFGAVIEFAICYNV 772
            L   E  K RKSV FAD+ G E+ +    T      P    S L+++R  +          P+P           D+V +  N E+       + V L++V L+        + G I V N   +K+VFVR + N WIS++D  + +  + S   D F F + + SSV  +    IEF IC+  
Sbjct:  127 LELKEEEKLRKSVRFADDCGHELYMVRVATEPSNCPPKLSPSVLRRYRGESFEEEEMTTREPAPVWNLMFKQPAADYVRFRENMET-------NKVSLENVILNNEAYK---VMGTIKVGNIAFEKSVFVRYTMNGWISYMDKAAIYQPSTSKIQDTFKFDLDLPSSVEKIH--QIEFCICFKA 298          

HSP 2 Score: 22.7126 bits (47), Expect = 4.953e-7
Identity = 7/13 (53.85%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  775 GQEFWDNNNDINY 813
            G E+WD+N+  NY
Sbjct:  300 GTEYWDSNSGTNY 312          
BLAST of SMED30007879 vs. Ensembl Celegans
Match: H18N23.2 (Protein phosphatase 1 regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q400N3])

HSP 1 Score: 48.9062 bits (115), Expect = 5.829e-7
Identity = 53/184 (28.80%), Postives = 81/184 (44.02%), Query Frame = 2
Query:  278 LSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSNT----------PSP-------DIFPDFV-YTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICV-SSVCCVFGAVIEFAICYNV 772
            L   E  K RKSV FAD+ G E+ +    T      P    S L+++R  +          P+P           D+V +  N E+       + V L++V L+        + G I V N   +K+VFVR + N WIS++D  + +  + S   D F F + + SSV  +    IEF IC+  
Sbjct:  115 LELKEEEKLRKSVRFADDCGHELYMVRVATEPSNCPPKLSPSVLRRYRGESFEEEEMTTREPAPVWNLMFKQPAADYVRFRENMET-------NKVSLENVILNNEAYK---VMGTIKVGNIAFEKSVFVRYTMNGWISYMDKAAIYQPSTSKIQDTFKFDLDLPSSVEKIH--QIEFCICFKA 286          

HSP 2 Score: 22.7126 bits (47), Expect = 5.829e-7
Identity = 7/13 (53.85%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  775 GQEFWDNNNDINY 813
            G E+WD+N+  NY
Sbjct:  288 GTEYWDSNSGTNY 300          
BLAST of SMED30007879 vs. Ensembl Zebrafish
Match: ppp1r3da (protein phosphatase 1, regulatory subunit 3Da [Source:ZFIN;Acc:ZDB-GENE-080204-75])

HSP 1 Score: 58.9214 bits (141), Expect = 1.574e-9
Identity = 50/176 (28.41%), Postives = 83/176 (47.16%), Query Frame = 2
Query:  275 SLSFTENIKSRKSVSFADNHGIEVD-IRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVK---LKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKF-CSTFSSS---VDQFSFQICVSSVCCVFGAVIEFAICYNVLA 778
            S S    +  R +V F D+ G++++ ++VF + + P +P++VL  L        S  +     Y     S+   D    V+    + V L +++  +  I GI+ V N   +K V VR S   W S  + ++ +  S F+S+    D F F + V       GAV+EFAICY V+ 
Sbjct:   75 SPSERRRLSRRANVRFVDSLGLDLENVKVFKSGEDPFIPEHVLFRLLMNAELASSKRMEISLPYLKPLFSIQPGDSSDFVERLCFQQVCLERVLCYEPGIIGIVQVVNLAFEKEVSVRYSFTNWKSCSETKAYWVASKFNSNGPCCDTFRFHLPVPPFILHPGAVLEFAICYKVMG 250          
BLAST of SMED30007879 vs. Ensembl Zebrafish
Match: ppp1r3db (protein phosphatase 1, regulatory subunit 3Db [Source:ZFIN;Acc:ZDB-GENE-110201-1])

HSP 1 Score: 49.2914 bits (116), Expect = 2.841e-6
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 2
Query:  314 VSFADNHGIEV-DIRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVY-THNFESVIDKDLDSIVKL---KHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKF-CSTFSSSV--DQFSFQICVSSVCCVFGAVIEFAICYNV 772
            V F D+ G+++ D++ F +++ P VP +V++ L          ++     Y   +F   +  D+ +  +    + V L Q+   +  I G   V N C +K V VR S   W S  D  + + CS     +  D F F + V       GAV++FAIC+ V
Sbjct:  100 VRFVDSLGLQLEDVKFFKSSEDPLVPVHVITRLLASSELASKKNLELSLPYFQPSFPDNMTTDVSAFSRRLCRQRVCLEQVFCSELGITGTAQVLNLCFQKEVIVRYSFTDWRSSADCRAGWVCSVRRGDLESDVFRFLLPVPPFIMQPGAVLQFAICFRV 260          
BLAST of SMED30007879 vs. Ensembl Zebrafish
Match: ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:NCBI gene;Acc:327285])

HSP 1 Score: 43.1282 bits (100), Expect = 8.619e-6
Identity = 48/174 (27.59%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVDI-RVFDTNQLP-EVPD----YVLSSLKKFRS--------NTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICYNV 772
            +++K VSFAD+ G+ + + ++F     P ++PD    +  SSL             + PS D          F   I+ D        HV L   ++ +  I G + V N   +K+V +R + N W +  D E ++   T++ S  D FSF+  +          IEFAICY V
Sbjct:   63 RAKKHVSFADHKGLALTVVKIFSEFDDPIDIPDNIDNFFTSSLTVSEGKDKLTLDFDQPSADYL-------KFRQRIEND--------HVCLEHCMLKEKSIMGTVKVKNISFEKSVKLRITFNTWKNHTDVECQYVKDTYTGSNRDTFSFEASLPEQVPSH-ERIEFAICYEV 220          

HSP 2 Score: 25.409 bits (54), Expect = 8.619e-6
Identity = 9/18 (50.00%), Postives = 12/18 (66.67%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRVVKS 828
            G   WDNN   NYR+++S
Sbjct:  222 GDTLWDNNQGKNYRIIQS 239          
BLAST of SMED30007879 vs. Ensembl Zebrafish
Match: ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:NCBI gene;Acc:327285])

HSP 1 Score: 43.1282 bits (100), Expect = 8.619e-6
Identity = 48/174 (27.59%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVDI-RVFDTNQLP-EVPD----YVLSSLKKFRS--------NTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICYNV 772
            +++K VSFAD+ G+ + + ++F     P ++PD    +  SSL             + PS D          F   I+ D        HV L   ++ +  I G + V N   +K+V +R + N W +  D E ++   T++ S  D FSF+  +          IEFAICY V
Sbjct:   63 RAKKHVSFADHKGLALTVVKIFSEFDDPIDIPDNIDNFFTSSLTVSEGKDKLTLDFDQPSADYL-------KFRQRIEND--------HVCLEHCMLKEKSIMGTVKVKNISFEKSVKLRITFNTWKNHTDVECQYVKDTYTGSNRDTFSFEASLPEQVPSH-ERIEFAICYEV 220          

HSP 2 Score: 25.409 bits (54), Expect = 8.619e-6
Identity = 9/18 (50.00%), Postives = 12/18 (66.67%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRVVKS 828
            G   WDNN   NYR+++S
Sbjct:  222 GDTLWDNNQGKNYRIIQS 239          
BLAST of SMED30007879 vs. Ensembl Zebrafish
Match: ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:NCBI gene;Acc:327285])

HSP 1 Score: 43.1282 bits (100), Expect = 8.619e-6
Identity = 48/174 (27.59%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVDI-RVFDTNQLP-EVPD----YVLSSLKKFRS--------NTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICYNV 772
            +++K VSFAD+ G+ + + ++F     P ++PD    +  SSL             + PS D          F   I+ D        HV L   ++ +  I G + V N   +K+V +R + N W +  D E ++   T++ S  D FSF+  +          IEFAICY V
Sbjct:   63 RAKKHVSFADHKGLALTVVKIFSEFDDPIDIPDNIDNFFTSSLTVSEGKDKLTLDFDQPSADYL-------KFRQRIEND--------HVCLEHCMLKEKSIMGTVKVKNISFEKSVKLRITFNTWKNHTDVECQYVKDTYTGSNRDTFSFEASLPEQVPSH-ERIEFAICYEV 220          

HSP 2 Score: 25.409 bits (54), Expect = 8.619e-6
Identity = 9/18 (50.00%), Postives = 12/18 (66.67%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRVVKS 828
            G   WDNN   NYR+++S
Sbjct:  222 GDTLWDNNQGKNYRIIQS 239          
BLAST of SMED30007879 vs. Ensembl Xenopus
Match: nbl1 (NBL1, DAN family BMP antagonist [Source:Xenbase;Acc:XB-GENE-479181])

HSP 1 Score: 61.2326 bits (147), Expect = 2.280e-10
Identity = 45/157 (28.66%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  308 KSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDV--IYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            + VSFAD  G + V ++ FDT ++P     ++S L  +   T   +   +F  T +F      D+   V+ K V L  + +      + GII V N   +K  +VR S + W ++ D  +++   +F+   DQF+F I +       GA ++F ICY
Sbjct:   63 RKVSFADAFGFDLVSVKEFDTWEVP-----IVSQLLSYEVET---NYIEEFYLTASFTLPSADDIIGKVQAKKVLLESIDMTPGTSSMKGIIRVLNVSYEKQTYVRMSLDDWQTYYDLTAEYIPYSFNGDTDQFAFTITLVPPYQKEGASVQFCICY 211          

HSP 2 Score: 23.483 bits (49), Expect = 2.280e-10
Identity = 7/13 (53.85%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  784 FWDNNNDINYRVV 822
            FWDNN+  NY ++
Sbjct:  218 FWDNNDGQNYTLI 230          
BLAST of SMED30007879 vs. Ensembl Xenopus
Match: ppp1r3b (Xenopus tropicalis protein phosphatase 1 regulatory subunit 3B (ppp1r3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001015950])

HSP 1 Score: 44.2838 bits (103), Expect = 3.266e-7
Identity = 60/225 (26.67%), Postives = 103/225 (45.78%), Query Frame = 2
Query:  134 KVKQIDKCTKSALNSDSTHVSKSE-RLSRKEQCDRLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIEVD-IRVF----DTNQLP----EVPDYV--LSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFC-STFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K   +D   K  L S      + E R++RK          T +      LS  EN K +K VSFAD+ G+ +  ++V+    D  ++P    E+ D +  L++++K R        F DFV      S    D  + ++ + V L   ++ D  + G + V N   +K+V +R + + W ++ DY+  +   T++ S  D FSF + +        A IEFA+C+
Sbjct:   31 KTMAVDIAMKFYLRSPPLRRDRVECRIARKSNEPLRPCIQTTNKTLLSELSNQEN-KVKKRVSFADSRGLALTMVKVYSDFDDELEIPFNISELIDNIVNLTTVEKER-------FFLDFVQP----SADYLDFRNRLQAESVCLENCMLKDKALVGTVKVKNLAFQKSVKIRMTCDSWQTYKDYDCLYVKDTYAGSDKDTFSFDVSLPE-GIQSSASIEFAVCF 242          

HSP 2 Score: 29.6462 bits (65), Expect = 3.266e-7
Identity = 10/21 (47.62%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  763 LQCAGQEFWDNNNDINYRVVK 825
             +C G+ FWD+N  +NYR+V+
Sbjct:  242 FECEGRIFWDSNKGLNYRIVR 262          
BLAST of SMED30007879 vs. Ensembl Xenopus
Match: ppp1r3b (Xenopus tropicalis protein phosphatase 1 regulatory subunit 3B (ppp1r3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001015950])

HSP 1 Score: 44.2838 bits (103), Expect = 3.379e-7
Identity = 60/225 (26.67%), Postives = 103/225 (45.78%), Query Frame = 2
Query:  134 KVKQIDKCTKSALNSDSTHVSKSE-RLSRKEQCDRLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIEVD-IRVF----DTNQLP----EVPDYV--LSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K   +D   K  L S      + E R++RK          T +      LS  EN K +K VSFAD+ G+ +  ++V+    D  ++P    E+ D +  L++++K R        F DFV      S    D  + ++ + V L   ++ D  + G + V N   +K+V +R + + W ++ DY+  +   T++ S  D FSF + +        A IEFA+C+
Sbjct:   20 KTMAVDIAMKFYLRSPPLRRDRVECRIARKSNEPLRPCIQTTNKTLLSELSNQEN-KVKKRVSFADSRGLALTMVKVYSDFDDELEIPFNISELIDNIVNLTTVEKER-------FFLDFVQP----SADYLDFRNRLQAESVCLENCMLKDKALVGTVKVKNLAFQKSVKIRMTCDSWQTYKDYDCLYVKDTYAGSDKDTFSFDVSLPE-GIQSSASIEFAVCF 231          

HSP 2 Score: 29.6462 bits (65), Expect = 3.379e-7
Identity = 10/21 (47.62%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  763 LQCAGQEFWDNNNDINYRVVK 825
             +C G+ FWD+N  +NYR+V+
Sbjct:  231 FECEGRIFWDSNKGLNYRIVR 251          
BLAST of SMED30007879 vs. Ensembl Mouse
Match: Ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:MGI Symbol;Acc:MGI:2177268])

HSP 1 Score: 50.8322 bits (120), Expect = 5.270e-9
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV      S    D  + ++  HV L   V+ D  I G + V N   +K V +R + + W SF D+  ++   T++ S  D FSF I +      +   +EFA+CY
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAES--ESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVCY 213          

HSP 2 Score: 28.4906 bits (62), Expect = 5.270e-9
Identity = 9/21 (42.86%), Postives = 15/21 (71.43%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR+ ++
Sbjct:  214 ECNGQAYWDSNKGKNYRITRA 234          
BLAST of SMED30007879 vs. Ensembl Mouse
Match: Ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:MGI Symbol;Acc:MGI:2177268])

HSP 1 Score: 50.8322 bits (120), Expect = 5.270e-9
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV      S    D  + ++  HV L   V+ D  I G + V N   +K V +R + + W SF D+  ++   T++ S  D FSF I +      +   +EFA+CY
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAES--ESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVCY 213          

HSP 2 Score: 28.4906 bits (62), Expect = 5.270e-9
Identity = 9/21 (42.86%), Postives = 15/21 (71.43%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR+ ++
Sbjct:  214 ECNGQAYWDSNKGKNYRITRA 234          
BLAST of SMED30007879 vs. Ensembl Mouse
Match: Ppp1r3b (protein phosphatase 1, regulatory subunit 3B [Source:MGI Symbol;Acc:MGI:2177268])

HSP 1 Score: 50.8322 bits (120), Expect = 5.270e-9
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV      S    D  + ++  HV L   V+ D  I G + V N   +K V +R + + W SF D+  ++   T++ S  D FSF I +      +   +EFA+CY
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAES--ESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVCY 213          

HSP 2 Score: 28.4906 bits (62), Expect = 5.270e-9
Identity = 9/21 (42.86%), Postives = 15/21 (71.43%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR+ ++
Sbjct:  214 ECNGQAYWDSNKGKNYRITRA 234          
BLAST of SMED30007879 vs. Ensembl Mouse
Match: Ppp1r3a (protein phosphatase 1, regulatory subunit 3A [Source:MGI Symbol;Acc:MGI:2153588])

HSP 1 Score: 48.1358 bits (113), Expect = 1.144e-6
Identity = 49/171 (28.65%), Postives = 73/171 (42.69%), Query Frame = 2
Query:  308 KSVSFADNHGIE-VDIRVFDTNQLPEVP-DYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIY-----------GIINVFNFCPKKTVFVRCSTNKWISFIDYESKFC-STFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNVLA 778
            + VSFAD+ G   V ++ FD  +LP V  D+ LS            D+F      H  E V+    D +   K   + QL +   V+            GII V N   +K V+VR S + W +  D  +++  ++     DQFSF+I +       G  +EF I Y   A
Sbjct:   64 RRVSFADSLGFSLVSVKEFDCWELPSVSTDFDLSG-----------DVF------HTDEYVLSPLFD-LPSSKEKLMEQLQVQKAVLESAEHLPGSSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKEGGKVEFCIRYETSA 216          

HSP 2 Score: 23.483 bits (49), Expect = 1.144e-6
Identity = 8/13 (61.54%), Postives = 9/13 (69.23%), Query Frame = 1
Query:  784 FWDNNNDINYRVV 822
            FW NNN  NY +V
Sbjct:  219 FWSNNNGTNYILV 231          
BLAST of SMED30007879 vs. UniProt/SwissProt
Match: sp|A6QNP3|PPR3B_BOVIN (Protein phosphatase 1 regulatory subunit 3B OS=Bos taurus OX=9913 GN=PPP1R3B PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.073e-8
Identity = 50/161 (31.06%), Postives = 76/161 (47.20%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICYN 769
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV VR + + W SF D+   +   T++ S  D FSF I +      +   +EFA+CY 
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDSIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQTDHVCLENCVLKDRSIAGTVKVQNLAFEKTVKVRMTFDTWKSFTDFPCWYVKDTYAGSDKDTFSFDISLPEKIQSY-ERMEFAVCYE 214          

HSP 2 Score: 29.6462 bits (65), Expect = 1.073e-8
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  214 ECNGQTYWDSNKGKNYRIIRA 234          
BLAST of SMED30007879 vs. UniProt/SwissProt
Match: sp|Q8C767|PPR3B_MOUSE (Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.108e-8
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV      S    D  + ++  HV L   V+ D  I G + V N   +K V +R + + W SF D+  ++   T++ S  D FSF I +      +   +EFA+CY
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAES--ESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVCY 213          

HSP 2 Score: 28.4906 bits (62), Expect = 3.108e-8
Identity = 9/21 (42.86%), Postives = 15/21 (71.43%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR+ ++
Sbjct:  214 ECNGQAYWDSNKGKNYRITRA 234          
BLAST of SMED30007879 vs. UniProt/SwissProt
Match: sp|Q6IN01|PPR3B_RAT (Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 6.244e-8
Identity = 47/160 (29.38%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV      S    D  + ++  HV L   V+ +  I G + V N   +K V +R + + W SF D+  ++   T++ S  D FSF I +      +   +EFA+CY
Sbjct:   57 KVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAES--ESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVCY 213          

HSP 2 Score: 28.8758 bits (63), Expect = 6.244e-8
Identity = 9/21 (42.86%), Postives = 15/21 (71.43%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR+ ++
Sbjct:  214 ECNGQSYWDSNKGKNYRITRA 234          
BLAST of SMED30007879 vs. UniProt/SwissProt
Match: sp|Q86XI6|PPR3B_HUMAN (Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 1.612e-7
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  299 KSRKSVSFADNHGIEVD-IRVFDTNQLP-EVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSS-VDQFSFQICVSSVCCVFGAVIEFAICY 766
            K +K VSFADN G+ +  ++VF     P ++P  +   L    S T +      FV   +  S    D  + ++  HV L   V+ D  I G + V N   +KTV +R + + W S+ D+  ++   T++ S  D FSF I +      +   +EFA+ Y
Sbjct:   58 KVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAES--ESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSY-ERMEFAVYY 214          

HSP 2 Score: 28.8758 bits (63), Expect = 1.612e-7
Identity = 9/21 (42.86%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKS 828
            +C GQ +WD+N   NYR++++
Sbjct:  215 ECNGQTYWDSNRGKNYRIIRA 235          
BLAST of SMED30007879 vs. UniProt/SwissProt
Match: sp|Q00756|PPR3A_RABIT (Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.040e-7
Identity = 45/160 (28.12%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  308 KSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDK-DLDSIVKLKHVFLH--QLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFC-STFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNV 772
            + VSFADN G   V ++ FDT +LP V          F++         ++V +  F+    K DL   ++++   L   + V     + GII V N   +K V+VR S + W +  D  +++  ++     DQFSF+I +       G+ +EF I Y  
Sbjct:   64 RRVSFADNFGFNLVSVKEFDTWELPSVSTTFELGKDAFQTE--------EYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYET 215          

HSP 2 Score: 24.2534 bits (51), Expect = 6.040e-7
Identity = 8/13 (61.54%), Postives = 9/13 (69.23%), Query Frame = 1
Query:  784 FWDNNNDINYRVV 822
            FW NNN  NY +V
Sbjct:  220 FWSNNNGTNYTLV 232          
BLAST of SMED30007879 vs. TrEMBL
Match: A0A3N0XRC7 (Protein phosphatase 1 regulatory subunit 3E OS=Anabarilius grahami OX=495550 GN=DPX16_20044 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.472e-14
Identity = 58/189 (30.69%), Postives = 100/189 (52.91%), Query Frame = 2
Query:  233 RLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFR---------SNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            R K   T + +    ++  ++  S+K V FAD+ G++ + I+ FD + +PEVP+ ++   KK R         SNT S  +F + ++T N  S+ D  LD ++ LK V L  +   +  + GI+ V N   +K V++R S N W +F+D  + +   +     D+FSF+I ++     FG  ++FAI Y
Sbjct:   83 RCKSLPTPAERAKLEIARVQSPSSQKKVRFADSLGLDLISIKHFDDSDMPEVPERIIDKFKKARALHLNNFDKSNTSSQSVFMELLFT-NPGSLPDF-LDRVIALK-VLLESVQADEFSLSGIVRVLNLAFEKNVYLRYSLNNWTTFVDILASYVPHSNDGQTDKFSFKI-ITPTFLEFGGTLQFAIRY 267          

HSP 2 Score: 28.8758 bits (63), Expect = 2.472e-14
Identity = 11/17 (64.71%), Postives = 12/17 (70.59%), Query Frame = 1
Query:  769 CAGQEFWDNNNDINYRV 819
              G EFWDNNN  NYR+
Sbjct:  269 VGGGEFWDNNNGSNYRI 285          
BLAST of SMED30007879 vs. TrEMBL
Match: A0A498LU78 (Phosphatase 1 regulatory subunit 3E-like protein OS=Labeo rohita OX=84645 GN=ROHU_035300 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.138e-14
Identity = 60/192 (31.25%), Postives = 100/192 (52.08%), Query Frame = 2
Query:  224 QCDRLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFR---------SNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFS-SSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            Q  R K   T++ +    ++ + +  S+K V FAD+ G++ + I+ FD   +PEVPD ++   KK R         SNT S  +F + ++T N  S+ D  LD +   K V L  +   +  + GI+ VFN   +K V++R + N W +F+D  + +    S    D+FSF+I ++     FG  ++FAI Y
Sbjct:   73 QRRRCKSLPTSAERAKLEIARSRSPSSQKKVRFADSLGLDLISIKHFDDTDMPEVPDRIIDKFKKARALHLNNFDKSNTSSQSVFMELLFT-NPGSLPDF-LDRVTAAK-VLLETVQADEFSLSGIVRVFNLAFEKKVYLRYTLNNWSTFMDILASYVPHSSDGQTDKFSFKI-ITPTFLEFGGTLQFAIKY 260          

HSP 2 Score: 28.4906 bits (62), Expect = 3.138e-14
Identity = 12/15 (80.00%), Postives = 12/15 (80.00%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRV 819
            G EFWDNNN  NYRV
Sbjct:  264 GGEFWDNNNGNNYRV 278          
BLAST of SMED30007879 vs. TrEMBL
Match: A0A553MRA9 (CBM21 domain-containing protein OS=Danionella translucida OX=623744 GN=DNTS_010289 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.856e-12
Identity = 58/190 (30.53%), Postives = 93/190 (48.95%), Query Frame = 2
Query:  224 QCDRLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFRS-------NTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFS-SSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            Q  R K   T++ +    ++ T +  S+K V FAD+ G+E + ++ FD   +PEVPD V+   +K R+          S  +F + ++T N  S+   D  S V    V L  +   +  + G++ V N   +K+V +R + N W SF D  + +    S    DQFSF+I   S    FG  ++FAI Y
Sbjct:   80 QRRRCKSLPTSAERAKLEIARTRSPSSQKKVRFADSLGLELISVKHFDDTDVPEVPDRVIDKFRKARALHLNNFDGASSQSVFVELLFT-NPGSL--PDFPSRVSAAKVSLESVQADEFSLAGLVRVLNLAFEKSVHLRYTLNNWSSFTDSLASYVPNSSDGQTDQFSFKIITPSF-LEFGGTLQFAIKY 265          

HSP 2 Score: 26.5646 bits (57), Expect = 2.856e-12
Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  772 AGQEFWDNNNDINYRV 819
             G EFWDNN+  NYRV
Sbjct:  268 GGCEFWDNNSGDNYRV 283          
BLAST of SMED30007879 vs. TrEMBL
Match: A0A5C6NKQ2 (Protein phosphatase 1 regulatory subunit OS=Takifugu flavidus OX=433684 GN=D4764_02G0011830 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.577e-11
Identity = 57/191 (29.84%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  233 RLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLK-----------KFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICY 766
            R K   T + +    +S T +  S+K V FAD+ G+E + I+ FD  + PEVP+ +L+ L            KF    P+  +F +  +T+     +     S+ ++K V L  +   +  + GI+ V N   +K+VF+R S N WI+F+D  + +    S  V D+F F+I V+      G  ++FAI Y
Sbjct:   72 RCKSLPTPTERAKLEISRTRSPTSQKKVRFADSLGLELITIKHFDDTEEPEVPERILAKLSNGPLHLNTMDTKF-PRAPAQTMFMELQFTN--PGTLPGFEQSVREVK-VLLESVETDEFSLSGIVRVLNLAFEKSVFLRYSLNNWITFMDSLASYVPCSSDGVTDKFRFKI-VTPTYLDSGGTLQFAIRY 257          

HSP 2 Score: 29.6462 bits (65), Expect = 1.577e-11
Identity = 11/16 (68.75%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  772 AGQEFWDNNNDINYRV 819
             G+EFWDNNN  NY+V
Sbjct:  260 GGEEFWDNNNGNNYKV 275          
BLAST of SMED30007879 vs. TrEMBL
Match: A0A4Z2BJ64 (Protein phosphatase 1 regulatory subunit OS=Takifugu bimaculatus OX=433685 GN=fugu_003479 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.985e-11
Identity = 57/191 (29.84%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  233 RLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLK-----------KFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICY 766
            R K   T + +    +S T +  S+K V FAD+ G+E + I+ FD  + PEVP+ +L+ L            KF    P+  +F +  +T+     +     S+ ++K V L  +   +  + GI+ V N   +K+VF+R S N WI+F+D  + +    S  V D+F F+I V+      G  ++FAI Y
Sbjct:   79 RCKSLPTPTERAKLEISRTRSPTSQKKVRFADSLGLELITIKHFDDTEEPEVPERILAKLSNGPLHLNTMDTKF-PRAPAQTMFMELQFTN--PGTLPGFEQSVREVK-VLLESVETDEFSLSGIVRVLNLAFEKSVFLRYSLNNWITFMDSLASYVPCSSDGVTDKFRFKI-VTPTYLDSGGTLQFAIRY 264          

HSP 2 Score: 29.261 bits (64), Expect = 1.985e-11
Identity = 11/16 (68.75%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  772 AGQEFWDNNNDINYRV 819
             G+EFWDNNN  NY+V
Sbjct:  267 GGEEFWDNNNGNNYKV 282          
BLAST of SMED30007879 vs. Ensembl Cavefish
Match: ENSAMXT00000026535.2 (pep primary_assembly:Astyanax_mexicanus-2.0:18:5639658:5645568:1 gene:ENSAMXG00000025809.2 transcript:ENSAMXT00000026535.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.942e-12
Identity = 43/170 (25.29%), Postives = 83/170 (48.82%), Query Frame = 2
Query:  302 SRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFRS---------NTPSPDIFPDFVYTH--NFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICYNV 772
            S+K V FAD+ G+E + ++ FD    PE+P+ V    +K R+            +  +F + ++++     S + +  D  V L+ V   +  +      G++ V N   +K+V +R + N W +F+D  + +    S  + D+F F+I V+ +    G  ++FA+ Y V
Sbjct:  113 SQKKVRFADSLGLELISVKHFDDADEPEIPERVTDRFRKARAMHLNTLGVPGASAQSVFMEVLFSNPCASPSFMQRVRDLRVSLERVDADEFCL-----SGLVRVLNMAFEKSVTLRYTINNWATFVDAPASYVPESSDGITDKFCFKI-VTPMFLEAGGTLQFAVKYRV 276          

HSP 2 Score: 34.2686 bits (77), Expect = 2.942e-12
Identity = 18/41 (43.90%), Postives = 25/41 (60.98%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRVVK-SIAHNLS*LFVCLIEVIAR*VYL 894
            GQEFWDNN   NYRV    I H    L+V ++ ++ R V++
Sbjct:  278 GQEFWDNNGGSNYRVKPFYICHT---LYVSIVSIVCRTVWV 315          
BLAST of SMED30007879 vs. Ensembl Cavefish
Match: ppp1r3da (protein phosphatase 1 regulatory subunit 3D-like [Source:NCBI gene;Acc:103042623])

HSP 1 Score: 53.1434 bits (126), Expect = 2.372e-8
Identity = 49/169 (28.99%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  305 RKSVSFADNHGIEVD-IRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKD----LDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYES-----KFCSTFSS--SVDQFSFQICVSSVCCVFGAVIEFAICYNVL 775
            R  V F D+ G++++ ++VF + + P VP++VL  L        S  +     Y     S    D    L+ + + K V L +++  +  I GI+ V N   +K V+VR S   W S  + ++     K+    S   S D F F + V       GAV+EFA+ Y VL
Sbjct:  131 RTGVRFVDSLGMDLENVKVFKSGEDPFVPEHVLFRLLMNAELAASKGLEISLPYLKPVFSEQPGDSANFLERLFRQK-VCLERVLCYEPGIIGIVQVLNLAFEKEVYVRYSFTNWKSCSETKANWVGNKYMEGLSDGCSCDSFRFHLPVPPFLLHPGAVLEFAVRYKVL 298          

HSP 2 Score: 23.8682 bits (50), Expect = 2.372e-8
Identity = 8/14 (57.14%), Postives = 12/14 (85.71%), Query Frame = 1
Query:  781 EFWDNNNDINYRVV 822
            +FWDNN+  NY++V
Sbjct:  301 QFWDNNDGQNYKLV 314          
BLAST of SMED30007879 vs. Ensembl Cavefish
Match: ppp1r3db (protein phosphatase 1, regulatory subunit 3Db [Source:ZFIN;Acc:ZDB-GENE-110201-1])

HSP 1 Score: 47.7506 bits (112), Expect = 3.056e-7
Identity = 45/176 (25.57%), Postives = 78/176 (44.32%), Query Frame = 2
Query:  299 KSRKS--VSFADNHGIEVD-IRVFDTNQLPEVPDYVLSSL---------KKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKL--KHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQ-----FSFQICVSSVCCVFGAVIEFAICYN 769
            K+R+   V F D+ G+E++ ++ F  ++ P VP +V+  L         K      P         +  +F   +    D + +L  +HV L Q+   +  I G + V N   +K V VR S   W S  + ++ + ST   + D+     F F++ V       GA ++FAIC+ 
Sbjct:   78 KARRGSQVRFVDSLGLELERVKFFKASEDPTVPVHVICRLLASSELAFGKHLELTLP--------YFQPSFPENMASQPDFLQRLCRQHVCLEQVHCSELGIIGTVQVLNLAFEKDVTVRYSFTDWKSSAESKACWVSTLHRNGDEPESDIFRFRLPVPPFILKPGATLQFAICFQ 245          

HSP 2 Score: 25.7942 bits (55), Expect = 3.056e-7
Identity = 9/19 (47.37%), Postives = 13/19 (68.42%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVV 822
            Q  G E+WDNN+  NY++ 
Sbjct:  245 QSQGVEYWDNNDGHNYKLA 263          
BLAST of SMED30007879 vs. Ensembl Nematostella
Match: EDO47072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN47])

HSP 1 Score: 55.0694 bits (131), Expect = 1.102e-9
Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  557 VIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCS-TFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            V+ G+I V+N   +K VFVR ST+ W S++D  ++F S +   ++D++ F++ ++ V    G  IEFA+CY
Sbjct:   32 VLVGLIRVWNIAYEKKVFVRYSTDNWSSYVDLPAEFMSQSHEGTIDKYVFKL-LAPVGLAVGDTIEFAVCY 101          
BLAST of SMED30007879 vs. Ensembl Nematostella
Match: EDO41629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S413])

HSP 1 Score: 44.669 bits (104), Expect = 2.663e-7
Identity = 25/77 (32.47%), Postives = 37/77 (48.05%), Query Frame = 2
Query:  554 DVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKF-CSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNVLAK 781
            + I G I V N    K V VR + + W SF D  + +   +F  + D+FSF + +       G  I+FAIC+    K
Sbjct:   45 NTIMGTIKVKNISYHKEVLVRYTLDSWHSFTDVPASYVLDSFDGNSDRFSFAVTIPEYFMASGGNIDFAICFRADGK 121          

HSP 2 Score: 27.335 bits (59), Expect = 2.663e-7
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRV 819
            G+EFWDNN+  NY+V
Sbjct:  120 GKEFWDNNSGQNYKV 134          
BLAST of SMED30007879 vs. Ensembl Nematostella
Match: EDO41624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S401])

HSP 1 Score: 41.9726 bits (97), Expect = 2.927e-6
Identity = 31/113 (27.43%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  431 PSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFID-YESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            P P   PDF         +++ L  +V L++ ++     ++  + G+I V N   +K VF R S + W++F D     F  T     D+F F++ +     V G  +EFA+C+
Sbjct:    8 PQPASRPDF---------LERMLTQMVCLENAYMGG--SLNVSLIGLIRVRNISYEKEVFARYSIDHWVNFQDCMADHFMQTNGGEFDKFVFKLVLPKDFYV-GGTVEFAVCF 108          

HSP 2 Score: 26.1794 bits (56), Expect = 2.927e-6
Identity = 10/16 (62.50%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRVV 822
            GQE+WDNN+  NY V+
Sbjct:  112 GQEYWDNNDGNNYTVM 127          
BLAST of SMED30007879 vs. Ensembl Nematostella
Match: EDO48422 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJS3])

HSP 1 Score: 43.8986 bits (102), Expect = 5.494e-6
Identity = 30/113 (26.55%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  431 PSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFID-YESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            P P   PDF         +++    +V L++ ++     ++  + G+I V N   +K VF R S + WI F D   +    T     D+F F++ +   C   G  +EFA+C+
Sbjct:  106 PQPASSPDF---------LERMRTQMVCLENAYMGDSSNLE--LIGLIRVRNISYEKEVFARYSIDHWIHFQDCMAAHLLQTNEGKFDKFIFKLVLPK-CFYVGGTVEFAVCF 206          

HSP 2 Score: 23.483 bits (49), Expect = 5.494e-6
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  775 GQEFWDNNNDINYRV 819
            GQE+WDNN   N+ V
Sbjct:  210 GQEYWDNNRGNNFTV 224          
BLAST of SMED30007879 vs. Ensembl Medaka
Match: ENSORLT00000011971.2 (protein phosphatase 1 regulatory subunit 3E [Source:NCBI gene;Acc:101160970])

HSP 1 Score: 57.3806 bits (137), Expect = 1.530e-10
Identity = 47/170 (27.65%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  302 SRKSVSFADNHGIE-VDIRVFDTNQLPEVPDYVLSSLKKFR--------SNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICYNVLAK 781
            S+K V FAD+ G+E + ++ F+    PEVP+ +L+ L K             PS  +  +  +T+          +  V+   V L  +   +  + G + V N   +K+V +R S N WI+F+D  + +    S  V D+F F+I + +     GA ++FAI Y V  +
Sbjct:   60 SQKKVRFADSLGLELISVKHFNDADDPEVPERILAKLHKGNLHWLYTKFPRAPSQPVLMELQFTN---PGTLPGFEQKVREVKVLLESVEADEFSLSGFVRVLNMAFEKSVSLRYSLNNWITFMDSLATYVPNSSDGVTDKFCFKIVMPTYLDNGGA-LQFAIKYCVGGR 225          

HSP 2 Score: 26.9498 bits (58), Expect = 1.530e-10
Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 1
Query:  769 CAGQEFWDNNNDINYRV 819
              G+EFWDNN+  NY+V
Sbjct:  222 VGGREFWDNNHGNNYKV 238          
BLAST of SMED30007879 vs. Ensembl Medaka
Match: ENSORLT00000017811.2 (pep primary_assembly:ASM223467v1:7:21121925:21128746:1 gene:ENSORLG00000014198.2 transcript:ENSORLT00000017811.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 6.275e-8
Identity = 41/167 (24.55%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  296 IKSRKSVSFADNHGIE-VDIR---VFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDD---VIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFC-STFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNV 772
            + + K VSFAD  G + VD+R    FD++   +   +      K+R     P   P +     F++     L  +V+   V +  +   +D      G+I V N    K V++R + + W ++ D+ +++   + +   DQFSF++C +      G+ IEF + Y  
Sbjct:   52 LAAGKRVSFADTTGGDLVDVREFVAFDSDDESDSAKWEHEQ-AKYRK----PHREPTYSLHPEFQTPSHGALLHVVRKNKVEVEHIAPSEDDPLAFRGVIRVLNVSFHKAVYIRSTMDDWATYFDHPAEYVQGSHNEDTDQFSFKLCFAPPFTNHGSRIEFVVRYET 213          

HSP 2 Score: 22.3274 bits (46), Expect = 6.275e-8
Identity = 8/19 (42.11%), Postives = 12/19 (63.16%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVV 822
            + A  +FW NN+ +NY V 
Sbjct:  212 ETAEGDFWANNSSLNYGVT 230          
BLAST of SMED30007879 vs. Ensembl Medaka
Match: ppp1r3db (protein phosphatase 1, regulatory subunit 3Db [Source:ZFIN;Acc:ZDB-GENE-110201-1])

HSP 1 Score: 44.2838 bits (103), Expect = 1.971e-6
Identity = 49/169 (28.99%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  314 VSFADNHGIEVD-IRVFDTNQLPEVPDYVLSSL--KKFRSNTPSPDI-FPDF--VYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFC--------STFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNVLA 778
            V F D  G++++ I+VF   + P VP++V+  L     R+    P++  P F   +  N  +   + L ++V  K V L QL   D  I G I V N   +K V V  S   W +  D  + +         S  +   D F F + V       GAV+EFA+ Y+V  
Sbjct:   58 VRFIDALGLDLEEIKVFRVQEHPLVPEHVIFRLLMNSERAFGKLPELNLPYFKACFPENM-AAQPEFLPNLVSRK-VCLEQLTCSDHGITGTIRVLNLAYEKEVKVLYSFTNWRTRTDTTACWVMRGHEGDSSISALDTDLFRFHLPVPPFILQPGAVLEFAVRYHVTG 224          

HSP 2 Score: 26.1794 bits (56), Expect = 1.971e-6
Identity = 8/18 (44.44%), Postives = 12/18 (66.67%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRV 819
               G ++WDNNN  NY++
Sbjct:  221 HVTGHDYWDNNNGSNYKL 238          
BLAST of SMED30007879 vs. Planmine SMEST
Match: SMESG000014356.1 (SMESG000014356.1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.683e-155
Identity = 216/223 (96.86%), Postives = 217/223 (97.31%), Query Frame = 2
Query:  113 MEKETFFKVKQIDKCTKSALNSDSTHVSKSERLSRKEQCDRLKVESTNSNQKPRSLSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICYNVLAK 781
            MEKETFFKVKQIDKCTKSALNSDSTHVSKSERLSRKEQCDRLKVESTNSNQK RSLSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSN PSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICY    +
Sbjct:    1 MEKETFFKVKQIDKCTKSALNSDSTHVSKSERLSRKEQCDRLKVESTNSNQKLRSLSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLKKFRSNAPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICYKCAGQ 223          

HSP 2 Score: 59.6918 bits (143), Expect = 3.273e-10
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  766 QCAGQEFWDNNNDINYRVVKSIAHNLS 846
            +CAGQEFWDNNNDINYRVVKSIAHNLS
Sbjct:  219 KCAGQEFWDNNNDINYRVVKSIAHNLS 245          
BLAST of SMED30007879 vs. Planmine SMEST
Match: SMESG000033999.1 (SMESG000033999.1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.930e-9
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  308 KSVSFADNHGIEV-DIR-VFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFES-VIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICY 766
            K+V FAD  G+++ DIR VF+ +  P++P   +  L    S++ +        Y  NFE      D    V++ +V L      ++ + G I V N   +K V VR + N W S ID+ + +       V D+FSF   + + C   G  I+FAI +
Sbjct:  115 KAVRFADAFGLDLEDIRHVFNLDLPPKIPASAVQDLV-LDSDSDTAINEKGLNYRANFEQPGAASDFLRRVRMHNVALENAFFENNFLSGTIRVMNISFEKKVGVRITFNDWRSHIDFTANYVQDSHDGVTDRFSFSFLLPAECQTSGQRIQFAISF 270          
BLAST of SMED30007879 vs. Planmine SMEST
Match: SMESG000018209.1 (SMESG000018209.1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.930e-9
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  308 KSVSFADNHGIEV-DIR-VFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVYTHNFES-VIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSV-DQFSFQICVSSVCCVFGAVIEFAICY 766
            K+V FAD  G+++ DIR VF+ +  P++P   +  L    S++ +        Y  NFE      D    V++ +V L      ++ + G I V N   +K V VR + N W S ID+ + +       V D+FSF   + + C   G  I+FAI +
Sbjct:  115 KAVRFADAFGLDLEDIRHVFNLDLPPKIPASAVQDLV-LDSDSDTAINEKGLNYRANFEQPGAASDFLRRVRMHNVALENAFFENNFLSGTIRVMNISFEKKVGVRITFNDWRSHIDFTANYVQDSHDGVTDRFSFSFLLPAECQTSGQRIQFAISF 270          
BLAST of SMED30007879 vs. Planmine SMEST
Match: SMESG000061419.1 (SMESG000061419.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.782e-8
Identity = 46/182 (25.27%), Postives = 89/182 (48.90%), Query Frame = 2
Query:  242 VESTNSNQKPRSLSFTENIKSRKSVSFADNHGIEV-DIRVFDTNQLPEVPDYVLSSLKKFRSNTPSPDIFPDFVY-----THNFESVIDKDLDSIVKLKHVFLHQLVIMDDVIYGIINVFNFCPKKTVFVRCSTNKWISFID-YESKFCSTFSSSVDQFSFQICVSSVCCVFGAVIEFAICY 766
            ++ +N N++ +S    +  K RKSV FAD  G+++ +I+    + + + P    S++K    +           Y       + ++VI+  + + ++L+  ++  + +     +G I V N   +K V +R + N W+SF D Y S    + +  +D+FSF + V     V G+ IEFA+ Y
Sbjct:   99 IDFSNDNRRSKSQVNRKTDKCRKSVRFADALGLQLSEIKFIKNSDIEKAPVLTSSAIKDLHLDHNCHLAMQGIKYFCPCFKIDEKTVIENTMKNNIQLEKAYIQGMTL-----FGRIFVKNISYEKNVGIRITYNNWVSFKDIYASYILESSNGIIDKFSFSVVVPRSVIV-GSKIEFAVFY 274          

HSP 2 Score: 21.9422 bits (45), Expect = 2.782e-8
Identity = 10/22 (45.45%), Postives = 16/22 (72.73%), Query Frame = 1
Query:  778 QEFWDNNNDINYRVVKSIAHNL 843
            + FWDNN++ NY V++  A N+
Sbjct:  280 ETFWDNNSNQNY-VLECFAKNM 300          
BLAST of SMED30007879 vs. Planmine SMEST
Match: SMESG000078349.1 (SMESG000078349.1)

HSP 1 Score: 47.7506 bits (112), Expect = 9.686e-7
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  560 IYGIINVFNFCPKKTVFVRCSTN-KWISFIDYESKFCSTF---------SSSVDQFSFQICVSSVCCVFGAVIEFAIC 763
            I GII + N C +K VFVR S++ +W SF D+E+K+ S+          SS VD+F FQ+ + ++       +EF + 
Sbjct:  150 ITGIIKLINLCFEKRVFVRLSSDSRWTSFSDFEAKYKSSSNEFLPDTNESSDVDEFEFQVSLPNMEVGEATNLEFVVG 227          

HSP 2 Score: 23.483 bits (49), Expect = 9.686e-7
Identity = 8/12 (66.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  784 FWDNNNDINYRV 819
            +WDNNN+ NYR+
Sbjct:  236 YWDNNNEKNYRL 247          
The following BLAST results are available for this feature:
BLAST of SMED30007879 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PPP1R3B3.766e-829.38protein phosphatase 1 regulatory subunit 3B [Sourc... [more]
PPP1R3B3.766e-829.38protein phosphatase 1 regulatory subunit 3B [Sourc... [more]
PPP1R3B3.766e-829.38protein phosphatase 1 regulatory subunit 3B [Sourc... [more]
PPP1R3B3.766e-829.38protein phosphatase 1 regulatory subunit 3B [Sourc... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
H18N23.24.848e-728.80Protein phosphatase 1 regulatory subunit [Source:... [more]
H18N23.24.953e-728.80Protein phosphatase 1 regulatory subunit [Source:... [more]
H18N23.25.829e-728.80Protein phosphatase 1 regulatory subunit [Source:... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007879 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r3da1.574e-928.41protein phosphatase 1, regulatory subunit 3Da [Sou... [more]
ppp1r3db2.841e-627.33protein phosphatase 1, regulatory subunit 3Db [Sou... [more]
ppp1r3b8.619e-627.59protein phosphatase 1, regulatory subunit 3B [Sour... [more]
ppp1r3b8.619e-627.59protein phosphatase 1, regulatory subunit 3B [Sour... [more]
ppp1r3b8.619e-627.59protein phosphatase 1, regulatory subunit 3B [Sour... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nbl12.280e-1028.66NBL1, DAN family BMP antagonist [Source:Xenbase;Ac... [more]
ppp1r3b3.266e-726.67Xenopus tropicalis protein phosphatase 1 regulator... [more]
ppp1r3b3.379e-726.67Xenopus tropicalis protein phosphatase 1 regulator... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ppp1r3b5.270e-930.00protein phosphatase 1, regulatory subunit 3B [Sour... [more]
Ppp1r3b5.270e-930.00protein phosphatase 1, regulatory subunit 3B [Sour... [more]
Ppp1r3b5.270e-930.00protein phosphatase 1, regulatory subunit 3B [Sour... [more]
Ppp1r3a1.144e-628.65protein phosphatase 1, regulatory subunit 3A [Sour... [more]
back to top
BLAST of SMED30007879 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QNP3|PPR3B_BOVIN1.073e-831.06Protein phosphatase 1 regulatory subunit 3B OS=Bos... [more]
sp|Q8C767|PPR3B_MOUSE3.108e-830.00Protein phosphatase 1 regulatory subunit 3B OS=Mus... [more]
sp|Q6IN01|PPR3B_RAT6.244e-829.38Protein phosphatase 1 regulatory subunit 3B OS=Rat... [more]
sp|Q86XI6|PPR3B_HUMAN1.612e-729.38Protein phosphatase 1 regulatory subunit 3B OS=Hom... [more]
sp|Q00756|PPR3A_RABIT6.040e-728.13Protein phosphatase 1 regulatory subunit 3A OS=Ory... [more]
back to top
BLAST of SMED30007879 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3N0XRC72.472e-1430.69Protein phosphatase 1 regulatory subunit 3E OS=Ana... [more]
A0A498LU783.138e-1431.25Phosphatase 1 regulatory subunit 3E-like protein O... [more]
A0A553MRA92.856e-1230.53CBM21 domain-containing protein OS=Danionella tran... [more]
A0A5C6NKQ21.577e-1129.84Protein phosphatase 1 regulatory subunit OS=Takifu... [more]
A0A4Z2BJ641.985e-1129.84Protein phosphatase 1 regulatory subunit OS=Takifu... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000026535.22.942e-1225.29pep primary_assembly:Astyanax_mexicanus-2.0:18:563... [more]
ppp1r3da2.372e-828.99protein phosphatase 1 regulatory subunit 3D-like [... [more]
ppp1r3db3.056e-725.57protein phosphatase 1, regulatory subunit 3Db [Sou... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007879 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007879 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO470721.102e-938.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416292.663e-732.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416242.927e-627.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484225.494e-626.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30007879 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000011971.21.530e-1027.65protein phosphatase 1 regulatory subunit 3E [Sourc... [more]
ENSORLT00000017811.26.275e-824.55pep primary_assembly:ASM223467v1:7:21121925:211287... [more]
ppp1r3db1.971e-628.99protein phosphatase 1, regulatory subunit 3Db [Sou... [more]
back to top
BLAST of SMED30007879 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014356.12.683e-15596.86SMESG000014356.1[more]
SMESG000033999.12.930e-929.94SMESG000033999.1[more]
SMESG000018209.12.930e-929.94SMESG000018209.1[more]
SMESG000061419.12.782e-825.27SMESG000061419.1[more]
SMESG000078349.19.686e-735.90SMESG000078349.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007879 ID=SMED30007879|Name=SMED30007879|organism=Schmidtea mediterranea sexual|type=transcript|length=964bp
ACTATGCACACTTCTGTGTATCTTCTTAATGAAGCACATTTTTGCTGACC
AATCAATCAAATTTTGAACTTAATTTTGTACGTGACTTACCGATTTGAAT
GATATTTGGAAAATGGAGAAAGAAACATTTTTCAAAGTCAAACAAATCGA
CAAATGCACAAAGTCAGCACTGAATTCCGATTCCACTCACGTAAGCAAAT
CAGAAAGACTTTCTCGAAAAGAGCAATGTGACAGATTGAAAGTCGAATCG
ACAAATAGCAATCAAAAACCGAGATCTCTCTCTTTTACAGAAAACATAAA
AAGCCGAAAATCTGTCTCATTTGCTGATAATCACGGAATCGAAGTTGATA
TTCGAGTTTTTGACACTAACCAACTTCCGGAAGTGCCGGATTACGTTTTG
TCGAGTTTAAAAAAGTTTCGCAGCAACACCCCTTCTCCGGACATTTTCCC
TGACTTTGTTTACACTCACAACTTTGAATCCGTCATTGACAAAGATCTTG
ATAGTATTGTCAAATTAAAGCACGTATTTCTCCACCAATTAGTAATCATG
GACGACGTAATATATGGGATCATAAACGTCTTCAATTTCTGTCCGAAAAA
AACCGTTTTTGTTCGATGTAGCACAAATAAATGGATTTCATTTATTGATT
ACGAATCGAAATTTTGTTCAACCTTCTCATCGAGTGTCGATCAGTTTTCA
TTCCAAATTTGCGTTTCCTCCGTCTGCTGCGTTTTTGGGGCTGTAATCGA
ATTCGCAATCTGCTACAATGTGCTGGCCAAGAGTTCTGGGACAATAACAA
CGACATCAATTACAGAGTGGTCAAATCCATTGCTCACAATTTATCATGAT
TATTTGTTTGTTTGATTGAAGTAATTGCAAGATGAGTTTACTTATTTTCA
ATGACAATTTTTTTAAAAGTAAATCAATATTTTTAAATATCATATTTTTT
TGTTTGAAAAAAAA
back to top

protein sequence of SMED30007879-orf-1

>SMED30007879-orf-1 ID=SMED30007879-orf-1|Name=SMED30007879-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MEKETFFKVKQIDKCTKSALNSDSTHVSKSERLSRKEQCDRLKVESTNSN
QKPRSLSFTENIKSRKSVSFADNHGIEVDIRVFDTNQLPEVPDYVLSSLK
KFRSNTPSPDIFPDFVYTHNFESVIDKDLDSIVKLKHVFLHQLVIMDDVI
YGIINVFNFCPKKTVFVRCSTNKWISFIDYESKFCSTFSSSVDQFSFQIC
VSSVCCVFGAVIEFAICYNVLAKSSGTITTTSITEWSNPLLTIYHDYLFV
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR005036CBM21_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0005977glycogen metabolic process