ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30007869
Length (bp)3416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30007869) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30007869) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30007869) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30007869) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007869

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007869SMESG000069889.1 SmedASXL_014309SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007869SMESG000069889.1 dd_Smed_v4_10986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007869SMESG000069889.1 dd_Smed_v6_10986_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007869SMESG000069889.1 dd_Smed_v4_10986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 109.383 bits (272), Expect = 2.580e-23
Identity = 116/441 (26.30%), Postives = 196/441 (44.44%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDIC----KSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVI----HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLR---IDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDY 3053
            ++ GNTALH+A++ G  + V  L++ GA++NA+++   TPL+ AA+ +  ++   LLE GA  S A     T L +      + ++   +E   K    L    ++   D  +       +DH         N   +   G T LH AAH+   + V  LL+ R   +D   R+  G++PLH +S   +  ++ LL++ G  ++ K  D   PLH  C    G     + +++LL  GA L+ R    L P+H AA     + ++ LL        Q    ++ + L   +   +A   G     + LLD+    + N   + LR    GE  LH  A    + ++  L + GA ++ R     QT LH+A+ L   T+++ +L+Q  A  +A      TPL IS     +  A V++      ++    G T       Y
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDH---------NADVQSKSGFTPLHIAAHYGN-VNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLH--CAARSGHD---QVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL--------QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK----RANPNARALR----GETALHMAARAGQVEVVRCLLRNGALVDARA-REEQTPLHIASRL-GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY 478          

HSP 2 Score: 90.5077 bits (223), Expect = 1.628e-17
Identity = 110/421 (26.13%), Postives = 163/421 (38.72%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAF 3035
            G TALH+AA  G  + V CLL  GA V+AR R +QTPL  A+ +    I  +LL+  A    A     T L I                 S   G V   +  +     H   TK             +G T LH AA +      K LL  R   +     G++PLH ++   + ++  LL+E GA  +   ++   PLH A      +K+QM+    LL  GA       Q + P+H A+ +G  D++ LL                                         LD+G N           +  +G   LH  A  D +N+  +L K GAD +  +  +  T L +A H  +   + F+L Q GA+VNA      TPL  +  +       V++ +    N     G+TA 
Sbjct:  369 GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHI-----------------SAREGQVDVASVLLEAGAAHSLATK-------------KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAA-----KKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL-----------------------------------------LDKGANIH--------MSTKSGLTSLHLAAQEDKVNVADILTKHGADQDA-HTKLGYTPLIVACHYGNVKMVNFLLKQ-GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 703          

HSP 3 Score: 83.9593 bits (206), Expect = 1.340e-15
Identity = 117/435 (26.90%), Postives = 186/435 (42.76%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDV-------LEEVIHDHRTKLEPIFINLRS----RCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGF--ASCAQWLLDRGFN---------------FKENE---ANQLLR-----NVIT--GELVLH---GQALNDTLNLLLYKTGADINKRYPPMSQ----TALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            G T LH+A+  G+ + V  LL+ G  ++A+ R   TPL  AA    + +  +LLE GA +        + L +         ++   +  + +        DDV       L    H    ++  + ++ R+    R ++G T LH AA   +   V+ LL     V+ R  +  +PLH +S L   EI+ LL++  A  +    +   PLH +       + Q++   VLL  GA       +   P+H AA  G  DV +LLL      Q + A +    N + P    L V+  +     A  LL++G +                K+N+   A+ LL      N++T  G   LH    +   D + LLL K GA+I+     MS     T+LHLAA   D  ++  IL + GAD +A      TPL ++C
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV--------DDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISA-----REGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLL------QRRAAADSAGKNGLTP----LHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK-GANIH-----MSTKSGLTSLHLAAQ-EDKVNVADILTKHGADQDAHTKLGYTPLIVAC 641          

HSP 4 Score: 62.003 bits (149), Expect = 7.936e-9
Identity = 68/261 (26.05%), Postives = 105/261 (40.23%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN---LLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDY 2546
            ++ G T LH+AA  G  D    LL+  A  ++  +   TPL  AA  D + +  +LLE GA          T L I  K N ++  I      Y   +  V                               QG T LH A+    T  V  LL    +++     G++ LH ++  + +N   +L + GAD +   +    PL  AC YG       ++ +  LL +GAN+  +      P+H AA QG   +I +LL +
Sbjct:  465 TKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQ--IASTLLNYGAETNIVTK-----------------------------QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYG------NVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 688          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 106.301 bits (264), Expect = 1.047e-22
Identity = 129/481 (26.82%), Postives = 206/481 (42.83%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+     VNQ++ KG +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:   51 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 472          

HSP 2 Score: 72.0182 bits (175), Expect = 5.487e-12
Identity = 72/260 (27.69%), Postives = 111/260 (42.69%), Query Frame = 3
Query: 2220 AVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            AV+ LL    DVN RD    +PLH ++    ++    L+   ++VNV D      LH A +   GE      +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA +N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   33 AVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEM-----VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGAIVNQKNE-KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 270          

HSP 3 Score: 62.7734 bits (151), Expect = 3.077e-9
Identity = 108/452 (23.89%), Postives = 186/452 (41.15%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENIC-GILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRN-----------VITGELVLHGQALNDTLNLLLYKTGADI----NKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            L  A+SS  ++ +K L DL   D    N +    GNT LH+A  +G    V  L++CGA VN +N    TPL  AA      +C  +L+  GA+++  +   +T L +    +L     R        SG V+   D                           G+T LH AA +   L +  L+    D  +R   G+ PLH    S   +    L+ +G D++  D+     LH+A  G       +E + +LL  GA+   ++     P+H AA    +  +  L+    S       ++++    P  +++ A S     C ++LL        N+AN  +R+                L L   A    L++L+  +G D+    + R    + + LHLAA+      L  +L+Q+  D++  ++   TPL ++  +  ++   V+I
Sbjct:  154 LHAAASSGMISVVKYLLDL-GVDMNEPNAY----GNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHM---TALHGRFSRSQTIIQ--SGAVIDCEDK-------------------------NGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAG-----GNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVN-----DLDERGCTP--LHYAATSDTDGKCLEYLL-------RNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNR---ATISPLHLAAYHGHHQALE-VLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLI 547          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 106.686 bits (265), Expect = 1.490e-22
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+     VNQ++ KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 528          

HSP 2 Score: 74.3294 bits (181), Expect = 1.097e-12
Identity = 77/301 (25.58%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQM----------------------------EKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  + ++                             E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA +N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGAIVNQKNE-KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 326          

HSP 3 Score: 71.2478 bits (173), Expect = 1.014e-11
Identity = 99/389 (25.45%), Postives = 164/389 (42.16%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G     N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 346          

HSP 4 Score: 60.4622 bits (145), Expect = 2.309e-8
Identity = 75/278 (26.98%), Postives = 114/278 (41.01%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEI----SWANVRNQTVLDICKSNSLKAYIE----------RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN----LLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME---GANLIFRNNQFL-MPIHCAAMQGRFDVIELLLDYDKS 2555
            G TALH  A+ GH + V  LL+ GA    R+   +TP+  +A      + G LL+  A +    + A+    T L     N  +  +E           +   +S L   V++ N+   E +I      L    +N      +G T LH AA       ++ LL     VN  D  G +PL  +++    N    L+  A A++ ++D   N  LH AC          E   +L++E     NLI   N  L  P+H AA  G   V++ LL    S
Sbjct:  686 GRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLI----DTLGASIVNATDS--KGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLAC------SKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGAS 951          

HSP 5 Score: 57.7658 bits (138), Expect = 1.479e-7
Identity = 112/495 (22.63%), Postives = 181/495 (36.57%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENIC-----------GIL-----------LEWGAEISWANVRNQTVLDICKSNSLKAYIERK--FKFYSELSGFVVSGNDDVLEEVIHD----------HRTKLEPIFINLRSRCI-----QGSTLL-------HTAAHFSKTLAVKELLMLRID-------VNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLF----------------------------------ISCSRNDLQSAKVMI 2984
            + G + LH AA + ++  +  L+  GA VN  +    TPL  AA  D +  C           GI              +G  +    + ++T LD+    S    +         S L      G+   LE ++             RT L+         C+     QG+++L        T  H + T    E L L I        V+ +D  G +PL  S      + +  L+  GA+V+ KD+     LH  A  G E      E +  LL  GA  + R+++   PIH +A  G   V+  LL   +S    +A      N    ++++ A   G  +C + LL++   F++ E N            LH   +ND      +L+   GA I        +T LH AA  TD  + + +L+   A VN+ D+   TPL                                   ++CS+    SA +++
Sbjct:  436 KFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALL---QSAASMDANPATADNHGYTALHW-ACYNGHETCVELLLEQEV-FQKTEGNAFSP--------LHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAA-FTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLIL 910          

HSP 6 Score: 52.7582 bits (125), Expect = 4.247e-6
Identity = 100/405 (24.69%), Postives = 160/405 (39.51%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNR-FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGA--DVNVKDEDNN--QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL--IQAGADVNATDNEHCTPLFISCSRNDL 2963
            G T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA         +L+         N   Q  +DI   N             + L   V++G+ D +  +++           N+ ++   G T LH  A       V  LL        RD +G +P+H S+    + ++  L+++ A  D N    DN+    LH ACY   G ++ +E    LL+E             P+HCA +       E+L+D   +  +       +  L        A       C Q LL    N + N  +       TG+  L   A N   +T+ +L+    A++  +      TALHLA      T  + IL  I     +NAT+    TPL ++ +RN L
Sbjct:  583 GRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI--------GNAEPQNAVDIQDGNG-----------QTPLMLSVLNGHTDCVYSLLNK--------GANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACY--NGHETCVE----LLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPL------HAAAFTDHVECLQLLLSH--NAQVNSVDS------TGKTPLMMAAENGQTNTVEMLVSSASAELTLQ-DNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVA-ARNGL 938          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 106.686 bits (265), Expect = 1.490e-22
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+     VNQ++ KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 528          

HSP 2 Score: 74.3294 bits (181), Expect = 1.097e-12
Identity = 77/301 (25.58%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQM----------------------------EKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  + ++                             E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA +N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGAIVNQKNE-KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 326          

HSP 3 Score: 71.2478 bits (173), Expect = 1.014e-11
Identity = 99/389 (25.45%), Postives = 164/389 (42.16%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G     N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 346          

HSP 4 Score: 60.4622 bits (145), Expect = 2.309e-8
Identity = 75/278 (26.98%), Postives = 114/278 (41.01%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEI----SWANVRNQTVLDICKSNSLKAYIE----------RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN----LLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME---GANLIFRNNQFL-MPIHCAAMQGRFDVIELLLDYDKS 2555
            G TALH  A+ GH + V  LL+ GA    R+   +TP+  +A      + G LL+  A +    + A+    T L     N  +  +E           +   +S L   V++ N+   E +I      L    +N      +G T LH AA       ++ LL     VN  D  G +PL  +++    N    L+  A A++ ++D   N  LH AC          E   +L++E     NLI   N  L  P+H AA  G   V++ LL    S
Sbjct:  686 GRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLI----DTLGASIVNATDS--KGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLAC------SKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGAS 951          

HSP 5 Score: 57.7658 bits (138), Expect = 1.479e-7
Identity = 112/495 (22.63%), Postives = 181/495 (36.57%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENIC-----------GIL-----------LEWGAEISWANVRNQTVLDICKSNSLKAYIERK--FKFYSELSGFVVSGNDDVLEEVIHD----------HRTKLEPIFINLRSRCI-----QGSTLL-------HTAAHFSKTLAVKELLMLRID-------VNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLF----------------------------------ISCSRNDLQSAKVMI 2984
            + G + LH AA + ++  +  L+  GA VN  +    TPL  AA  D +  C           GI              +G  +    + ++T LD+    S    +         S L      G+   LE ++             RT L+         C+     QG+++L        T  H + T    E L L I        V+ +D  G +PL  S      + +  L+  GA+V+ KD+     LH  A  G E      E +  LL  GA  + R+++   PIH +A  G   V+  LL   +S    +A      N    ++++ A   G  +C + LL++   F++ E N            LH   +ND      +L+   GA I        +T LH AA  TD  + + +L+   A VN+ D+   TPL                                   ++CS+    SA +++
Sbjct:  436 KFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALL---QSAASMDANPATADNHGYTALHW-ACYNGHETCVELLLEQEV-FQKTEGNAFSP--------LHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAA-FTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLIL 910          

HSP 6 Score: 52.7582 bits (125), Expect = 4.247e-6
Identity = 100/405 (24.69%), Postives = 160/405 (39.51%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNR-FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGA--DVNVKDEDNN--QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL--IQAGADVNATDNEHCTPLFISCSRNDL 2963
            G T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA         +L+         N   Q  +DI   N             + L   V++G+ D +  +++           N+ ++   G T LH  A       V  LL        RD +G +P+H S+    + ++  L+++ A  D N    DN+    LH ACY   G ++ +E    LL+E             P+HCA +       E+L+D   +  +       +  L        A       C Q LL    N + N  +       TG+  L   A N   +T+ +L+    A++  +      TALHLA      T  + IL  I     +NAT+    TPL ++ +RN L
Sbjct:  583 GRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI--------GNAEPQNAVDIQDGNG-----------QTPLMLSVLNGHTDCVYSLLNK--------GANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACY--NGHETCVE----LLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPL------HAAAFTDHVECLQLLLSH--NAQVNSVDS------TGKTPLMMAAENGQTNTVEMLVSSASAELTLQ-DNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVA-ARNGL 938          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 103.219 bits (256), Expect = 1.823e-21
Identity = 117/438 (26.71%), Postives = 196/438 (44.75%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDIC----KSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVI----HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLR---IDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYD-----KSKQIQEALEI-------EKLNLIPPSMNF--LAVSGGFA----SCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLN----LLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            ++ GNTALH+A++ G  + V  L++ GA++NA+++   TPL+ AA+ +  ++   LLE GA  S A     T L +      + ++   +E   K    L    ++   D  +       +DH         N   +   G T LH AAH+   + V  LL+ R   +D   R+  G++PLH +S   +  ++ LL++ G  ++ K  D   PLH  C    G     + +++LL  GA L+ R  +    +H AA  G+ +V+  LL        ++++ Q  L I       E + L+   M     A + G+     S  +  +D      E  A   L     G   LH  A   +L+    LL  +  AD   +      T LH+AAH  D+  +  +L++ GA  +AT     TPL I+  +N +Q A  ++
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDH---------NADVQSKSGFTPLHIAAHYGN-VNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLH--CAARSGHD---QVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLA-TKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN---GLTPLHVAAHY-DNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLL 488          

HSP 2 Score: 93.5893 bits (231), Expect = 1.771e-18
Identity = 122/480 (25.42%), Postives = 181/480 (37.71%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHD----------------SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAF 3035
            + N    KLLL      D  T   LT L  + ++    HD                ++ G TALH+AA  G  + V CLL  GA V+AR R +QTPL  A+ +    I  +LL+  A    A     T L I                 S   G V   +  +     H   TK             +G T LH AA +      K LL  R   +     G++PLH ++   + ++  LL+E GA  +   ++   PLH A      +K+QM+    LL  GA       Q + P+H A+ +G  D++ LL                                         LD+G N           +  +G   LH  A  D +N+  +L K GAD +  +  +  T L +A H  +   + F+L Q GA+VNA      TPL  +  +       V++ +    N     G+TA 
Sbjct:  247 RGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARS---GHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHI-----------------SAREGQVDVASVLLEAGAAHSLATK-------------KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAA-----KKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL-----------------------------------------LDKGANIH--------MSTKSGLTSLHLAAQEDKVNVADILTKHGADQDA-HTKLGYTPLIVACHYGNVKMVNFLLKQ-GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 637          

HSP 3 Score: 83.5741 bits (205), Expect = 2.096e-15
Identity = 120/427 (28.10%), Postives = 183/427 (42.86%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGF--ASCAQWLLDRGFN---------------FKENE---ANQLLR-----NVIT--GELVLH---GQALNDTLNLLLYKTGADINKRYPPMSQ----TALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            S+ G T LH+AA  G+ +    LL  GA V+   R   TPL  A++    N+  +LL+ G +I  A  R+      C + S                     G+D V+E ++     +  P+     +R  +G T LH AA   +   V+ LL     V+ R  +  +PLH +S L   EI+ LL++  A  +    +   PLH +       + Q++   VLL  GA       +   P+H AA  G  DV +LLL      Q + A +    N + P    L V+  +     A  LL++G +                K+N+   A+ LL      N++T  G   LH    +   D + LLL K GA+I+     MS     T+LHLAA   D  ++  IL + GAD +A      TPL ++C
Sbjct:  201 SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQID-AKTRDGLTPLHCAARS---------------------GHDQVVELLLE----RGAPLL----ARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISA-----REGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLL------QRRAAADSAGKNGLTP----LHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK-GANIH-----MSTKSGLTSLHLAAQ-EDKVNVADILTKHGADQDAHTKLGYTPLIVAC 575          

HSP 4 Score: 59.3066 bits (142), Expect = 4.546e-8
Identity = 67/264 (25.38%), Postives = 110/264 (41.67%), Query Frame = 3
Query: 2223 VKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGEL---VLHGQALNDTLN----LLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            V E L   ID+N  +  G++ LH   +   + ++  L+  G+ V+   +  N  LH A         Q E +KVL+ EGAN+  ++     P++ AA +   DV++ LL+   ++                     A   GF   A   L +G N        LL N   G++    LH  A  D       LL     AD+  +      T LH+AAH  +  ++  +L+  GA V+ T     TPL ++  R +    K+++
Sbjct:   26 VVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLA-----GQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST-------------------ATEDGFTPLA-VALQQGHN---QAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKS---GFTPLHIAAHYGN-VNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLL 257          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 94.3597 bits (233), Expect = 4.489e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH-----------------------RSSDL-------------EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQ----------------------------MEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            GNTALH+A++ G    V  L+E GA+VN ++    TPL+ AA+ + E +   LL+ GA  + +     T L +         +   +E   K    L    + +  DD     +   ++H         N       G T LH AAH+      + LL    +VN +    +SPLH                       R+ DL             ++++LL+  GA ++ K ++   PLH A  G+  + ++                            +   K+LL   A+   R      P+H A  + R  V+ELLL Y      + A+E    + + P ++  A  G   +   +LL +G N             + GE  LH  A  +  +++  L + GA ++ +   + QT LH+A+ L + TD++ +L+QAGA+ NAT  ++ +PL I+      + A +++
Sbjct:   99 GNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---------NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY------RAAIEATTESGLTP-LHVAAFMGAI-NIVIYLLQQGANPD--------VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGN-TDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 2 Score: 87.8113 bits (216), Expect = 3.983e-17
Identity = 115/453 (25.39%), Postives = 183/453 (40.40%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI------------------NLRSRCIQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS--CAQWLLDRGFNFK----------------------------ENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G   LH+AA   H DA   LL   A V+       TPL  AA      +  +LL+  A+ +   +   T L I CK N +K  +E   K+ + +     SG               L P+ +                  N     ++G T LH AA  ++T  V+ L+    ++D   R+ +  +PLH +S L   +I+ LL++AGA+ N    DN  PLH A      ++ Q E   +LL   A+      +   P+H A+  G  +V+ LLL+          ++IE  N + P    L V+  + +   A  LL+ G + K                            + + N   R   T  L L  Q  +  ++ LL + G+D+  +      TA+HL A   D   +  IL   GA++N+  N   TPL ++C    L   K ++
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK-VVELLLKYRAAIEATTESG---------------LTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAA-----KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTP----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFT-PLHLSAQEGHKEISGLLIENGSDVGAKA-NNGLTAMHLCAQ-EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 3 Score: 80.4925 bits (197), Expect = 6.007e-15
Identity = 119/487 (24.44%), Postives = 211/487 (43.33%), Query Frame = 3
Query: 1686 LLKASSSNDVTTI----KLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF-----------YSELSGFVVSGNDDVLEEVI-HDHRTKLEPIFINLRSR--------------------CIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENEAN--QLL---RNVI-----TGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
             L+A+ + D+  +    +  TD+ +S+   +N         +LHLA+ +GH + V  L++  A V+A  R   T L  A+      I  IL+E GA ++  +V   T L +    + +  ++   K            ++ L+  +  G+D V+  ++ +D + K+    +++ ++                       G T LH AAH+      + LL    +VN +    +SPLH ++      + NLL+  GA ++ + +D   PLH  C    G     + + +L+++GA +  +    L P+H AA     D    LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N     +LL   R  I     +G   LH  A    +N+++Y  + GA+ +       +T LHLAA   + TD++ +LI+ GA V+A   E  TPL I+ 
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLN---------SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLH--CAARSGHD---QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAP--VDDVTVDYLTPL-----HVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET-VRGETPLHLAAR-ANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 4 Score: 79.7221 bits (195), Expect = 1.152e-14
Identity = 83/304 (27.30%), Postives = 125/304 (41.12%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI----NLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVK------------DED---------NN------------QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEA 2573
            T LH+A+  G+ D V+ LL+ GA+ NA  R   +PL  AA+   E + GILL+  A+ +    +  T L +         ++  +ER      E    V       L    H +  K+  + +    + ++    G T LH AA  ++      LL  + D N +   G +PLH S+     EI  LLIE G+DV  K             ED         NN             PLH AC+       Q+  +K L+  GA++  +      P+H AA QG  + +  LL+   S   Q A
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP-----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH-----FGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTA 786          

HSP 5 Score: 79.337 bits (194), Expect = 1.671e-14
Identity = 108/447 (24.16%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINW-------------HDSEM--GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLLK  ++ + TT   LT L  +   F+                D E   G T LHLAA     D V  L+  GA V+A+ R  QTPL  A+ +   +I  +LL+ GA  +     N + L I      +           E++G ++  N D                                      KTL  K              KG +PLH +S   +LE++ LL+E G  V+++ ++   PLH A +         +K+ +LL+E GA+          P+H AA + + ++   LL +      +       L+        L+   G    +  L++ G +      N L          +H  A  D + +  +LY  GA+IN +      T LH+A H     +++  L++ GADV        TPL
Sbjct:  402 KNRIKVVELLLKYRAAIEATTESGLTPLHVA--AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE-----------EVAGILLDHNAD--------------------------------------KTLLTK--------------KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH------YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH--------LSAQEGHKEISGLLIENGSDVGAKANNGL--------TAMHLCAQEDHVPVAQILYNNGAEINSKT-NAGYTPLHVACHF-GQLNMVKFLVENGADVGEKTRASYTPL 759          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 94.3597 bits (233), Expect = 4.489e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH-----------------------RSSDL-------------EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQ----------------------------MEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            GNTALH+A++ G    V  L+E GA+VN ++    TPL+ AA+ + E +   LL+ GA  + +     T L +         +   +E   K    L    + +  DD     +   ++H         N       G T LH AAH+      + LL    +VN +    +SPLH                       R+ DL             ++++LL+  GA ++ K ++   PLH A  G+  + ++                            +   K+LL   A+   R      P+H A  + R  V+ELLL Y      + A+E    + + P ++  A  G   +   +LL +G N             + GE  LH  A  +  +++  L + GA ++ +   + QT LH+A+ L + TD++ +L+QAGA+ NAT  ++ +PL I+      + A +++
Sbjct:   99 GNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---------NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY------RAAIEATTESGLTP-LHVAAFMGAI-NIVIYLLQQGANPD--------VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGN-TDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 2 Score: 87.8113 bits (216), Expect = 3.983e-17
Identity = 115/453 (25.39%), Postives = 183/453 (40.40%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI------------------NLRSRCIQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS--CAQWLLDRGFNFK----------------------------ENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G   LH+AA   H DA   LL   A V+       TPL  AA      +  +LL+  A+ +   +   T L I CK N +K  +E   K+ + +     SG               L P+ +                  N     ++G T LH AA  ++T  V+ L+    ++D   R+ +  +PLH +S L   +I+ LL++AGA+ N    DN  PLH A      ++ Q E   +LL   A+      +   P+H A+  G  +V+ LLL+          ++IE  N + P    L V+  + +   A  LL+ G + K                            + + N   R   T  L L  Q  +  ++ LL + G+D+  +      TA+HL A   D   +  IL   GA++N+  N   TPL ++C    L   K ++
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK-VVELLLKYRAAIEATTESG---------------LTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAA-----KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTP----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFT-PLHLSAQEGHKEISGLLIENGSDVGAKA-NNGLTAMHLCAQ-EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 3 Score: 80.4925 bits (197), Expect = 6.007e-15
Identity = 119/487 (24.44%), Postives = 211/487 (43.33%), Query Frame = 3
Query: 1686 LLKASSSNDVTTI----KLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF-----------YSELSGFVVSGNDDVLEEVI-HDHRTKLEPIFINLRSR--------------------CIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENEAN--QLL---RNVI-----TGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
             L+A+ + D+  +    +  TD+ +S+   +N         +LHLA+ +GH + V  L++  A V+A  R   T L  A+      I  IL+E GA ++  +V   T L +    + +  ++   K            ++ L+  +  G+D V+  ++ +D + K+    +++ ++                       G T LH AAH+      + LL    +VN +    +SPLH ++      + NLL+  GA ++ + +D   PLH  C    G     + + +L+++GA +  +    L P+H AA     D    LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N     +LL   R  I     +G   LH  A    +N+++Y  + GA+ +       +T LHLAA   + TD++ +LI+ GA V+A   E  TPL I+ 
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLN---------SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLH--CAARSGHD---QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAP--VDDVTVDYLTPL-----HVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET-VRGETPLHLAAR-ANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 4 Score: 79.7221 bits (195), Expect = 1.152e-14
Identity = 83/304 (27.30%), Postives = 125/304 (41.12%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI----NLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVK------------DED---------NN------------QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEA 2573
            T LH+A+  G+ D V+ LL+ GA+ NA  R   +PL  AA+   E + GILL+  A+ +    +  T L +         ++  +ER      E    V       L    H +  K+  + +    + ++    G T LH AA  ++      LL  + D N +   G +PLH S+     EI  LLIE G+DV  K             ED         NN             PLH AC+       Q+  +K L+  GA++  +      P+H AA QG  + +  LL+   S   Q A
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP-----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH-----FGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTA 786          

HSP 5 Score: 79.337 bits (194), Expect = 1.671e-14
Identity = 108/447 (24.16%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINW-------------HDSEM--GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLLK  ++ + TT   LT L  +   F+                D E   G T LHLAA     D V  L+  GA V+A+ R  QTPL  A+ +   +I  +LL+ GA  +     N + L I      +           E++G ++  N D                                      KTL  K              KG +PLH +S   +LE++ LL+E G  V+++ ++   PLH A +         +K+ +LL+E GA+          P+H AA + + ++   LL +      +       L+        L+   G    +  L++ G +      N L          +H  A  D + +  +LY  GA+IN +      T LH+A H     +++  L++ GADV        TPL
Sbjct:  402 KNRIKVVELLLKYRAAIEATTESGLTPLHVA--AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE-----------EVAGILLDHNAD--------------------------------------KTLLTK--------------KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH------YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH--------LSAQEGHKEISGLLIENGSDVGAKANNGL--------TAMHLCAQEDHVPVAQILYNNGAEINSKT-NAGYTPLHVACHF-GQLNMVKFLVENGADVGEKTRASYTPL 759          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 93.9745 bits (232), Expect = 5.616e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH-----------------------RSSDL-------------EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQ----------------------------MEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            GNTALH+A++ G    V  L+E GA+VN ++    TPL+ AA+ + E +   LL+ GA  + +     T L +         +   +E   K    L    + +  DD     +   ++H         N       G T LH AAH+      + LL    +VN +    +SPLH                       R+ DL             ++++LL+  GA ++ K ++   PLH A  G+  + ++                            +   K+LL   A+   R      P+H A  + R  V+ELLL Y      + A+E    + + P ++  A  G   +   +LL +G N             + GE  LH  A  +  +++  L + GA ++ +   + QT LH+A+ L + TD++ +L+QAGA+ NAT  ++ +PL I+      + A +++
Sbjct:   99 GNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---------NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY------RAAIEATTESGLTP-LHVAAFMGAI-NIVIYLLQQGANPD--------VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGN-TDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 2 Score: 87.4261 bits (215), Expect = 4.537e-17
Identity = 115/453 (25.39%), Postives = 183/453 (40.40%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI------------------NLRSRCIQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS--CAQWLLDRGFNFK----------------------------ENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G   LH+AA   H DA   LL   A V+       TPL  AA      +  +LL+  A+ +   +   T L I CK N +K  +E   K+ + +     SG               L P+ +                  N     ++G T LH AA  ++T  V+ L+    ++D   R+ +  +PLH +S L   +I+ LL++AGA+ N    DN  PLH A      ++ Q E   +LL   A+      +   P+H A+  G  +V+ LLL+          ++IE  N + P    L V+  + +   A  LL+ G + K                            + + N   R   T  L L  Q  +  ++ LL + G+D+  +      TA+HL A   D   +  IL   GA++N+  N   TPL ++C    L   K ++
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK-VVELLLKYRAAIEATTESG---------------LTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAA-----KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTP----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFT-PLHLSAQEGHKEISGLLIENGSDVGAKA-NNGLTAMHLCAQ-EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 3 Score: 80.1073 bits (196), Expect = 8.668e-15
Identity = 119/487 (24.44%), Postives = 211/487 (43.33%), Query Frame = 3
Query: 1686 LLKASSSNDVTTI----KLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF-----------YSELSGFVVSGNDDVLEEVI-HDHRTKLEPIFINLRSR--------------------CIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENEAN--QLL---RNVI-----TGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
             L+A+ + D+  +    +  TD+ +S+   +N         +LHLA+ +GH + V  L++  A V+A  R   T L  A+      I  IL+E GA ++  +V   T L +    + +  ++   K            ++ L+  +  G+D V+  ++ +D + K+    +++ ++                       G T LH AAH+      + LL    +VN +    +SPLH ++      + NLL+  GA ++ + +D   PLH  C    G     + + +L+++GA +  +    L P+H AA     D    LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N     +LL   R  I     +G   LH  A    +N+++Y  + GA+ +       +T LHLAA   + TD++ +LI+ GA V+A   E  TPL I+ 
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLN---------SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLH--CAARSGHD---QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAP--VDDVTVDYLTPL-----HVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET-VRGETPLHLAAR-ANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 4 Score: 79.337 bits (194), Expect = 1.368e-14
Identity = 83/304 (27.30%), Postives = 125/304 (41.12%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI----NLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVK------------DED---------NN------------QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEA 2573
            T LH+A+  G+ D V+ LL+ GA+ NA  R   +PL  AA+   E + GILL+  A+ +    +  T L +         ++  +ER      E    V       L    H +  K+  + +    + ++    G T LH AA  ++      LL  + D N +   G +PLH S+     EI  LLIE G+DV  K             ED         NN             PLH AC+       Q+  +K L+  GA++  +      P+H AA QG  + +  LL+   S   Q A
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP-----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH-----FGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTA 786          

HSP 5 Score: 78.9518 bits (193), Expect = 1.985e-14
Identity = 108/447 (24.16%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINW-------------HDSEM--GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLLK  ++ + TT   LT L  +   F+                D E   G T LHLAA     D V  L+  GA V+A+ R  QTPL  A+ +   +I  +LL+ GA  +     N + L I      +           E++G ++  N D                                      KTL  K              KG +PLH +S   +LE++ LL+E G  V+++ ++   PLH A +         +K+ +LL+E GA+          P+H AA + + ++   LL +      +       L+        L+   G    +  L++ G +      N L          +H  A  D + +  +LY  GA+IN +      T LH+A H     +++  L++ GADV        TPL
Sbjct:  402 KNRIKVVELLLKYRAAIEATTESGLTPLHVA--AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE-----------EVAGILLDHNAD--------------------------------------KTLLTK--------------KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH------YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH--------LSAQEGHKEISGLLIENGSDVGAKANNGL--------TAMHLCAQEDHVPVAQILYNNGAEINSKT-NAGYTPLHVACHF-GQLNMVKFLVENGADVGEKTRASYTPL 759          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 93.9745 bits (232), Expect = 5.616e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH-----------------------RSSDL-------------EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQ----------------------------MEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            GNTALH+A++ G    V  L+E GA+VN ++    TPL+ AA+ + E +   LL+ GA  + +     T L +         +   +E   K    L    + +  DD     +   ++H         N       G T LH AAH+      + LL    +VN +    +SPLH                       R+ DL             ++++LL+  GA ++ K ++   PLH A  G+  + ++                            +   K+LL   A+   R      P+H A  + R  V+ELLL Y      + A+E    + + P ++  A  G   +   +LL +G N             + GE  LH  A  +  +++  L + GA ++ +   + QT LH+A+ L + TD++ +L+QAGA+ NAT  ++ +PL I+      + A +++
Sbjct:   99 GNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---------NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY------RAAIEATTESGLTP-LHVAAFMGAI-NIVIYLLQQGANPD--------VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGN-TDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 2 Score: 87.4261 bits (215), Expect = 4.537e-17
Identity = 115/453 (25.39%), Postives = 183/453 (40.40%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI------------------NLRSRCIQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS--CAQWLLDRGFNFK----------------------------ENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G   LH+AA   H DA   LL   A V+       TPL  AA      +  +LL+  A+ +   +   T L I CK N +K  +E   K+ + +     SG               L P+ +                  N     ++G T LH AA  ++T  V+ L+    ++D   R+ +  +PLH +S L   +I+ LL++AGA+ N    DN  PLH A      ++ Q E   +LL   A+      +   P+H A+  G  +V+ LLL+          ++IE  N + P    L V+  + +   A  LL+ G + K                            + + N   R   T  L L  Q  +  ++ LL + G+D+  +      TA+HL A   D   +  IL   GA++N+  N   TPL ++C    L   K ++
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK-VVELLLKYRAAIEATTESG---------------LTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAA-----KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTP----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFT-PLHLSAQEGHKEISGLLIENGSDVGAKA-NNGLTAMHLCAQ-EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 3 Score: 80.1073 bits (196), Expect = 8.668e-15
Identity = 119/487 (24.44%), Postives = 211/487 (43.33%), Query Frame = 3
Query: 1686 LLKASSSNDVTTI----KLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF-----------YSELSGFVVSGNDDVLEEVI-HDHRTKLEPIFINLRSR--------------------CIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENEAN--QLL---RNVI-----TGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
             L+A+ + D+  +    +  TD+ +S+   +N         +LHLA+ +GH + V  L++  A V+A  R   T L  A+      I  IL+E GA ++  +V   T L +    + +  ++   K            ++ L+  +  G+D V+  ++ +D + K+    +++ ++                       G T LH AAH+      + LL    +VN +    +SPLH ++      + NLL+  GA ++ + +D   PLH  C    G     + + +L+++GA +  +    L P+H AA     D    LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N     +LL   R  I     +G   LH  A    +N+++Y  + GA+ +       +T LHLAA   + TD++ +LI+ GA V+A   E  TPL I+ 
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLN---------SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLH--CAARSGHD---QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAP--VDDVTVDYLTPL-----HVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET-VRGETPLHLAAR-ANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 4 Score: 79.337 bits (194), Expect = 1.368e-14
Identity = 83/304 (27.30%), Postives = 125/304 (41.12%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI----NLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVK------------DED---------NN------------QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEA 2573
            T LH+A+  G+ D V+ LL+ GA+ NA  R   +PL  AA+   E + GILL+  A+ +    +  T L +         ++  +ER      E    V       L    H +  K+  + +    + ++    G T LH AA  ++      LL  + D N +   G +PLH S+     EI  LLIE G+DV  K             ED         NN             PLH AC+       Q+  +K L+  GA++  +      P+H AA QG  + +  LL+   S   Q A
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP-----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH-----FGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTA 786          

HSP 5 Score: 78.9518 bits (193), Expect = 1.985e-14
Identity = 108/447 (24.16%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINW-------------HDSEM--GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLLK  ++ + TT   LT L  +   F+                D E   G T LHLAA     D V  L+  GA V+A+ R  QTPL  A+ +   +I  +LL+ GA  +     N + L I      +           E++G ++  N D                                      KTL  K              KG +PLH +S   +LE++ LL+E G  V+++ ++   PLH A +         +K+ +LL+E GA+          P+H AA + + ++   LL +      +       L+        L+   G    +  L++ G +      N L          +H  A  D + +  +LY  GA+IN +      T LH+A H     +++  L++ GADV        TPL
Sbjct:  402 KNRIKVVELLLKYRAAIEATTESGLTPLHVA--AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE-----------EVAGILLDHNAD--------------------------------------KTLLTK--------------KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH------YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH--------LSAQEGHKEISGLLIENGSDVGAKANNGL--------TAMHLCAQEDHVPVAQILYNNGAEINSKT-NAGYTPLHVACHF-GQLNMVKFLVENGADVGEKTRASYTPL 759          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 93.9745 bits (232), Expect = 5.619e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH-----------------------RSSDL-------------EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQ----------------------------MEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            GNTALH+A++ G    V  L+E GA+VN ++    TPL+ AA+ + E +   LL+ GA  + +     T L +         +   +E   K    L    + +  DD     +   ++H         N       G T LH AAH+      + LL    +VN +    +SPLH                       R+ DL             ++++LL+  GA ++ K ++   PLH A  G+  + ++                            +   K+LL   A+   R      P+H A  + R  V+ELLL Y      + A+E    + + P ++  A  G   +   +LL +G N             + GE  LH  A  +  +++  L + GA ++ +   + QT LH+A+ L + TD++ +L+QAGA+ NAT  ++ +PL I+      + A +++
Sbjct:   99 GNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---------NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY------RAAIEATTESGLTP-LHVAAFMGAI-NIVIYLLQQGANPD--------VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGN-TDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 2 Score: 87.8113 bits (216), Expect = 4.467e-17
Identity = 114/452 (25.22%), Postives = 181/452 (40.04%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI------------------NLRSRCIQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS--CAQWLLDRGFNFKENEANQLLRNVITGE---------------------------LVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G   LH+AA   H DA   LL   A V+       TPL  AA      +  +LL+  A+ +   +   T L I CK N +K  +E   K+ + +     SG               L P+ +                  N     ++G T LH AA  ++T  V+ L+    ++D   R+ +  +PLH +S L   +I+ LL++AGA+ N    DN  PLH A      ++ Q E   +LL   A+      +   P+H A+  G  +V+ LLL+          ++IE  N + P    L V+  + +   A  LL+ G + K    N      I  +                           L L  Q  +  ++ LL + G+D+  +      TA+HL A   D   +  IL   GA++N+  N   TPL ++C    L   K ++
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK-VVELLLKYRAAIEATTESG---------------LTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAA-----KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTP----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKA-NNGLTAMHLCAQ-EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 3 Score: 80.1073 bits (196), Expect = 8.118e-15
Identity = 119/487 (24.44%), Postives = 211/487 (43.33%), Query Frame = 3
Query: 1686 LLKASSSNDVTTI----KLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF-----------YSELSGFVVSGNDDVLEEVI-HDHRTKLEPIFINLRSR--------------------CIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENEAN--QLL---RNVI-----TGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
             L+A+ + D+  +    +  TD+ +S+   +N         +LHLA+ +GH + V  L++  A V+A  R   T L  A+      I  IL+E GA ++  +V   T L +    + +  ++   K            ++ L+  +  G+D V+  ++ +D + K+    +++ ++                       G T LH AAH+      + LL    +VN +    +SPLH ++      + NLL+  GA ++ + +D   PLH  C    G     + + +L+++GA +  +    L P+H AA     D    LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N     +LL   R  I     +G   LH  A    +N+++Y  + GA+ +       +T LHLAA   + TD++ +LI+ GA V+A   E  TPL I+ 
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLN---------SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLH--CAARSGHD---QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAP--VDDVTVDYLTPL-----HVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET-VRGETPLHLAAR-ANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 4 Score: 79.337 bits (194), Expect = 1.419e-14
Identity = 80/312 (25.64%), Postives = 133/312 (42.63%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFI----NLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEA 2696
            T LH+A+  G+ D V+ LL+ GA+ NA  R   +PL  AA+   E + GILL+  A+ +    +  T L +         ++  +ER      E    V       L    H +  K+  + +    + ++    G T LH AA  ++      LL  + D N +   G +PLH S+     EI  LLIE G+DV  K  +    +H  C  E+     +   ++L   GA +  + N    P+H A   G+ ++++ L+  +    + E        L        A   G  +C ++LL+ G +  E  A
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP-----LHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMH-LCAQED----HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV--ENGADVGEKTRASYTPL------HQAAQQGHNNCVRYLLENGASPNEQTA 786          

HSP 5 Score: 78.9518 bits (193), Expect = 1.990e-14
Identity = 108/447 (24.16%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINW-------------HDSEM--GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLLK  ++ + TT   LT L  +   F+                D E   G T LHLAA     D V  L+  GA V+A+ R  QTPL  A+ +   +I  +LL+ GA  +     N + L I      +           E++G ++  N D                                      KTL  K              KG +PLH +S   +LE++ LL+E G  V+++ ++   PLH A +         +K+ +LL+E GA+          P+H AA + + ++   LL +      +       L+        L+   G    +  L++ G +      N L          +H  A  D + +  +LY  GA+IN +      T LH+A H     +++  L++ GADV        TPL
Sbjct:  402 KNRIKVVELLLKYRAAIEATTESGLTPLHVA--AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE-----------EVAGILLDHNAD--------------------------------------KTLLTK--------------KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH------YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH--------LSAQEGHKEISGLLIENGSDVGAKANNGL--------TAMHLCAQEDHVPVAQILYNNGAEINSKT-NAGYTPLHVACHF-GQLNMVKFLVENGADVGEKTRASYTPL 759          

HSP 6 Score: 73.1738 bits (178), Expect = 1.275e-12
Identity = 78/283 (27.56%), Postives = 121/283 (42.76%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRI----DVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEA 2573
            ++DKT +    ++ G T LHLA+  G+ + V  LLE G  V+   + + TPL  AA  + + +  +LLE GA    A     T L I       A  + + +  S L  F                  K +P   N +SR   G T LH +A        KE+  L I    DV  +   G++ +H   +   + +  +L   GA++N K      PLH AC+       Q+  +K L+  GA++  +      P+H AA QG  + +  LL+   S   Q A
Sbjct:  547 NADKTLL----TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHI-------AAKKNQMEIASTLLQF------------------KADP---NAKSRA--GFTPLHLSAQEGH----KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH-----FGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTA 786          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 109.768 bits (273), Expect = 1.209e-23
Identity = 116/424 (27.36%), Postives = 183/424 (43.16%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENE---ANQLLRN-------VITGELVLHGQALNDTLNLLLYKTGADINKRYPPM-SQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNTALH+A++ G  + V  LLE  A VN +++   TPL+ AA+ + + +  +LL  GA  S A     T L +         +   +E   +    L    + +  DDV    +   +DH         N       G T LH A+H+        L+    DVN      +SPLH ++      +++LL+E G ++  K  D   PLH  C    G +   + + +LL  GA +  +    L P+H AA     D   +LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N       LLR+         +G   LH  A    +N+++Y    D +   P +  +T LHLAA   + TD++ IL++ GA V+A   E  TPL I+ 
Sbjct:   77 GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH---------NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHE---QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL-YHRAP--VDEVTVDYLTAL-----HVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAAR-ANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 2 Score: 89.7373 bits (221), Expect = 1.547e-17
Identity = 110/444 (24.77%), Postives = 180/444 (40.54%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSD-------KTFINWHDSE------MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLL+  +S   TT   LT L  +          ++  HD+        G T LHLAA     D +  LL  GA V+AR R +QTPL  A+ +   +I  +LL+ GA++      + T  D+                Y+ L      G D+V   +I +           L +   +G T LH  A +      + LL    DV+ +   GV+PLH +   ++ ++  LL+E GA  +   ++ + PLH A       K+QM+    LL  GA     +     P+H ++ +G  ++  LL+++  +                                               N   +N +T    +H  A  D +N+  +L K GA+I+        T LH+A+H   +  + F L+Q GA+V+A  +   TPL
Sbjct:  380 KNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV------DATTKDM----------------YTALHIAAKEGQDEVAAVLIENGAA--------LDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA-----RKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA----------------------------------------------VNHPAKNGLTP---MHLCAQEDNVNVAEILEKNGANIDMAT-KAGYTPLHVASHFGQANMVRF-LLQNGANVDAATSIGYTPL 737          

HSP 3 Score: 71.633 bits (174), Expect = 4.325e-12
Identity = 103/401 (25.69%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVM 2981
            TALH+AA  GH      LL+  AD NAR     TPL  A + +   +  +LL  GA IS       T L +                    + F+   N  V+  + HD    +           ++G T LH AA  ++T  ++ LL     V+ R  +  +PLH   R  +++I+ LL++ GA V+   +D    LH A   +EG   Q E   VL+  GA L     +   P+H  A  G   V +LLL      Q +  ++ +  N + P    +A        A  LL++G +      N        G   LH  A  + +++   L + GA  N        T LHL++      ++  +LI+  A VN       TP+ +    +++  A+++
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHV--------------------AAFMGCMNI-VIYLLQHDASPDVP---------TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEG---QDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL------QKEADVDAQGKNGVTPL--HVACHYNNQQVALLLLEKGASPHATAKN--------GHTPLHIAARKNQMDIATTLLEYGALANAES-KAGFTPLHLSSQ-EGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 686          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 109.383 bits (272), Expect = 1.333e-23
Identity = 116/427 (27.17%), Postives = 185/427 (43.33%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENE---ANQLLRN-------VITGELVLHGQALNDTLNLLLYKTGADINKRYPPM-SQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            ++ GNTALH+A++ G  + V  LLE  A VN +++   TPL+ AA+ + + +  +LL  GA  S A     T L +         +   +E   +    L    + +  DDV    +   +DH         N       G T LH A+H+        L+    DVN      +SPLH ++      +++LL+E G ++  K  D   PLH  C    G +   + + +LL  GA +  +    L P+H AA     D   +LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N       LLR+         +G   LH  A    +N+++Y    D +   P +  +T LHLAA   + TD++ IL++ GA V+A   E  TPL I+ 
Sbjct:   74 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH---------NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHE---QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL-YHRAP--VDEVTVDYLTAL-----HVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAAR-ANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 2 Score: 89.7373 bits (221), Expect = 1.230e-17
Identity = 110/444 (24.77%), Postives = 180/444 (40.54%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSD-------KTFINWHDSE------MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLL+  +S   TT   LT L  +          ++  HD+        G T LHLAA     D +  LL  GA V+AR R +QTPL  A+ +   +I  +LL+ GA++      + T  D+                Y+ L      G D+V   +I +           L +   +G T LH  A +      + LL    DV+ +   GV+PLH +   ++ ++  LL+E GA  +   ++ + PLH A       K+QM+    LL  GA     +     P+H ++ +G  ++  LL+++  +                                               N   +N +T    +H  A  D +N+  +L K GA+I+        T LH+A+H   +  + F L+Q GA+V+A  +   TPL
Sbjct:  380 KNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV------DATTKDM----------------YTALHIAAKEGQDEVAAVLIENGAA--------LDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA-----RKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA----------------------------------------------VNHPAKNGLTP---MHLCAQEDNVNVAEILEKNGANIDMAT-KAGYTPLHVASHFGQANMVRF-LLQNGANVDAATSIGYTPL 737          

HSP 3 Score: 72.0182 bits (175), Expect = 3.816e-12
Identity = 103/401 (25.69%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVM 2981
            TALH+AA  GH      LL+  AD NAR     TPL  A + +   +  +LL  GA IS       T L +                    + F+   N  V+  + HD    +           ++G T LH AA  ++T  ++ LL     V+ R  +  +PLH   R  +++I+ LL++ GA V+   +D    LH A   +EG   Q E   VL+  GA L     +   P+H  A  G   V +LLL      Q +  ++ +  N + P    +A        A  LL++G +      N        G   LH  A  + +++   L + GA  N        T LHL++      ++  +LI+  A VN       TP+ +    +++  A+++
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHV--------------------AAFMGCMNI-VIYLLQHDASPDVP---------TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEG---QDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL------QKEADVDAQGKNGVTPL--HVACHYNNQQVALLLLEKGASPHATAKN--------GHTPLHIAARKNQMDIATTLLEYGALANAES-KAGFTPLHLSSQ-EGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 686          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 109.383 bits (272), Expect = 1.511e-23
Identity = 116/427 (27.17%), Postives = 185/427 (43.33%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENE---ANQLLRN-------VITGELVLHGQALNDTLNLLLYKTGADINKRYPPM-SQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            ++ GNTALH+A++ G  + V  LLE  A VN +++   TPL+ AA+ + + +  +LL  GA  S A     T L +         +   +E   +    L    + +  DDV    +   +DH         N       G T LH A+H+        L+    DVN      +SPLH ++      +++LL+E G ++  K  D   PLH  C    G +   + + +LL  GA +  +    L P+H AA     D   +LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N       LLR+         +G   LH  A    +N+++Y    D +   P +  +T LHLAA   + TD++ IL++ GA V+A   E  TPL I+ 
Sbjct:   74 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH---------NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHE---QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL-YHRAP--VDEVTVDYLTAL-----HVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAAR-ANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 2 Score: 89.7373 bits (221), Expect = 1.512e-17
Identity = 110/444 (24.77%), Postives = 180/444 (40.54%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSD-------KTFINWHDSE------MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLL+  +S   TT   LT L  +          ++  HD+        G T LHLAA     D +  LL  GA V+AR R +QTPL  A+ +   +I  +LL+ GA++      + T  D+                Y+ L      G D+V   +I +           L +   +G T LH  A +      + LL    DV+ +   GV+PLH +   ++ ++  LL+E GA  +   ++ + PLH A       K+QM+    LL  GA     +     P+H ++ +G  ++  LL+++  +                                               N   +N +T    +H  A  D +N+  +L K GA+I+        T LH+A+H   +  + F L+Q GA+V+A  +   TPL
Sbjct:  380 KNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV------DATTKDM----------------YTALHIAAKEGQDEVAAVLIENGAA--------LDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA-----RKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA----------------------------------------------VNHPAKNGLTP---MHLCAQEDNVNVAEILEKNGANIDMAT-KAGYTPLHVASHFGQANMVRF-LLQNGANVDAATSIGYTPL 737          

HSP 3 Score: 71.633 bits (174), Expect = 4.224e-12
Identity = 103/401 (25.69%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVM 2981
            TALH+AA  GH      LL+  AD NAR     TPL  A + +   +  +LL  GA IS       T L +                    + F+   N  V+  + HD    +           ++G T LH AA  ++T  ++ LL     V+ R  +  +PLH   R  +++I+ LL++ GA V+   +D    LH A   +EG   Q E   VL+  GA L     +   P+H  A  G   V +LLL      Q +  ++ +  N + P    +A        A  LL++G +      N        G   LH  A  + +++   L + GA  N        T LHL++      ++  +LI+  A VN       TP+ +    +++  A+++
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHV--------------------AAFMGCMNI-VIYLLQHDASPDVP---------TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEG---QDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL------QKEADVDAQGKNGVTPL--HVACHYNNQQVALLLLEKGASPHATAKN--------GHTPLHIAARKNQMDIATTLLEYGALANAES-KAGFTPLHLSSQ-EGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 686          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303124)

HSP 1 Score: 108.997 bits (271), Expect = 2.123e-23
Identity = 116/424 (27.36%), Postives = 183/424 (43.16%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENE---ANQLLRN-------VITGELVLHGQALNDTLNLLLYKTGADINKRYPPM-SQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNTALH+A++ G  + V  LLE  A VN +++   TPL+ AA+ + + +  +LL  GA  S A     T L +         +   +E   +    L    + +  DDV    +   +DH         N       G T LH A+H+        L+    DVN      +SPLH ++      +++LL+E G ++  K  D   PLH  C    G +   + + +LL  GA +  +    L P+H AA     D   +LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N       LLR+         +G   LH  A    +N+++Y    D +   P +  +T LHLAA   + TD++ IL++ GA V+A   E  TPL I+ 
Sbjct:  227 GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH---------NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHE---QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL-YHRAP--VDEVTVDYLTAL-----HVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAAR-ANQTDIIRILLRNGAQVDARAREQQTPLHIAS 627          

HSP 2 Score: 89.3521 bits (220), Expect = 1.882e-17
Identity = 111/453 (24.50%), Postives = 182/453 (40.18%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFIN---------WHDSE------MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRN 2957
            KN +   +LLL+  +S   TT   LT L  +   F+           HD+        G T LHLAA     D +  LL  GA V+AR R +QTPL  A+ +   +I  +LL+ GA++      + T  D+                Y+ L      G D+V   +I +           L +   +G T LH  A +      + LL    DV+ +   GV+PLH +   ++ ++  LL+E GA  +   ++ + PLH A       K+QM+    LL  GA     +     P+H ++ +G  ++  LL+++  +                                               N   +N +T    +H  A  D +N+  +L K GA+I+        T LH+A+H   +  + F L+Q GA+V+A  +   TPL  +  + 
Sbjct:  530 KNRLKVVELLLRHGASISATTESGLTPLHVA--AFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV------DATTKDM----------------YTALHIAAKEGQDEVAAVLIENGAA--------LDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA-----RKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA----------------------------------------------VNHPAKNGLT---PMHLCAQEDNVNVAEILEKNGANIDMAT-KAGYTPLHVASHFGQANMVRF-LLQNGANVDAATSIGYTPLHQTAQQG 894          

HSP 3 Score: 71.2478 bits (173), Expect = 6.332e-12
Identity = 103/403 (25.56%), Postives = 164/403 (40.69%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLN----LLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVM 2981
            TALH+AA  GH      LL+  AD NAR     TPL  A + +   +  +LL  GA IS       T L +                      F+   N  V+  + HD    +           ++G T LH AA  ++T  ++ LL     V+ R  +  +PLH   R  +++I+ LL++ GA V+   +D    LH A   +EG   Q E   VL+  GA L     +   P+H  A  G   V +LLL      Q +  ++ +  N + P    +A        A  LL++G +      N        G   LH  A  + ++    LL Y   A+   +      T LHL++      ++  +LI+  A VN       TP+ +    +++  A+++
Sbjct:  489 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA--------------------AFMGCMNI-VIYLLQHDASPDVP---------TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEG---QDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL------QKEADVDAQGKNGVTPL--HVACHYNNQQVALLLLEKGASPHATAKN--------GHTPLHIAARKNQMDIATTLLEYGALANAESK---AGFTPLHLSSQ-EGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 836          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303113)

HSP 1 Score: 108.997 bits (271), Expect = 2.200e-23
Identity = 116/424 (27.36%), Postives = 183/424 (43.16%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR----------GFNF-----KENE---ANQLLRN-------VITGELVLHGQALNDTLNLLLYKTGADINKRYPPM-SQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNTALH+A++ G  + V  LLE  A VN +++   TPL+ AA+ + + +  +LL  GA  S A     T L +         +   +E   +    L    + +  DDV    +   +DH         N       G T LH A+H+        L+    DVN      +SPLH ++      +++LL+E G ++  K  D   PLH  C    G +   + + +LL  GA +  +    L P+H AA     D   +LL Y ++    + + ++ L  +      +A   G    A+ LLDR          GF       K+N       LLR+         +G   LH  A    +N+++Y    D +   P +  +T LHLAA   + TD++ IL++ GA V+A   E  TPL I+ 
Sbjct:   77 GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH---------NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHE---QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL-YHRAP--VDEVTVDYLTAL-----HVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAAR-ANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 2 Score: 88.9669 bits (219), Expect = 2.388e-17
Identity = 111/446 (24.89%), Postives = 180/446 (40.36%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFIN---------WHDSE------MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            KN +   +LLL+  +S   TT   LT L  +   F+           HD+        G T LHLAA     D +  LL  GA V+AR R +QTPL  A+ +   +I  +LL+ GA++      + T  D+                Y+ L      G D+V   +I +           L +   +G T LH  A +      + LL    DV+ +   GV+PLH +   ++ ++  LL+E GA  +   ++ + PLH A       K+QM+    LL  GA     +     P+H ++ +G  ++  LL+++  +                                               N   +N +T    +H  A  D +N+  +L K GA+I+        T LH+A+H   +  + F L+Q GA+V+A  +   TPL
Sbjct:  380 KNRLKVVELLLRHGASISATTESGLTPLHVA--AFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV------DATTKDM----------------YTALHIAAKEGQDEVAAVLIENGAA--------LDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR-----KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA----------------------------------------------VNHPAKNGLTP---MHLCAQEDNVNVAEILEKNGANIDMAT-KAGYTPLHVASHFGQANMVRF-LLQNGANVDAATSIGYTPL 737          

HSP 3 Score: 70.8626 bits (172), Expect = 8.956e-12
Identity = 103/401 (25.69%), Postives = 164/401 (40.90%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVM 2981
            TALH+AA  GH      LL+  AD NAR     TPL  A + +   +  +LL  GA IS       T L +                      F+   N  V+  + HD    +           ++G T LH AA  ++T  ++ LL     V+ R  +  +PLH   R  +++I+ LL++ GA V+   +D    LH A   +EG   Q E   VL+  GA L     +   P+H  A  G   V +LLL      Q +  ++ +  N + P    +A        A  LL++G +      N        G   LH  A  + +++   L + GA  N        T LHL++      ++  +LI+  A VN       TP+ +    +++  A+++
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA--------------------AFMGCMNI-VIYLLQHDASPDVP---------TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEG---QDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL------QKEADVDAQGKNGVTPL--HVACHYNNQQVALLLLEKGASPHATAKN--------GHTPLHIAARKNQMDIATTLLEYGALANAES-KAGFTPLHLSSQ-EGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 686          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 112.464 bits (280), Expect = 1.577e-24
Identity = 142/550 (25.82%), Postives = 234/550 (42.55%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDY-----LEWINSD--------------LFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIE 3242
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+             CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD N++     +T LH AA    +   +F L+ +GA+VN  D   CTPL + + S  D +  + ++ N+ N  +++N G+ A  Y   Y     LE I S+              L D + +A +   +L +     + ++  ++S  D   +  Q  + LD   F+  +E
Sbjct:  107 WQTPLHVAAANKAVRCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVP------------CKDK----------KAYTPLHAAASSGMISVVKYLL--------DMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHG------RFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGH----ELLIN----TLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNRK-DSFGRTPLHYAA-ANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVE 597          

HSP 2 Score: 56.6102 bits (135), Expect = 1.807e-7
Identity = 73/276 (26.45%), Postives = 112/276 (40.58%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEIS---------------WANVRNQTVLDICKSNSLKAYIERKFKF--YSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN----LLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME---GANLIFRNNQFL-MPIHCAAMQGRFDVIELLL 2540
            G TALH  A+ GH + V  LL+  A    R+   ++P+  A+      + G LL     +                WA        D C    L+  +  K +   +S L   V++ N+  +E +I      L P+ +N      +  T LH AA       ++ LL     VN  D  G +PL  +++    N    L+  A AD+ ++D + N  LH AC          E   +L++E     NLI   N  L  P+H AA  G   V++ LL
Sbjct:  686 GRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGH---DTCVEVLLEQELFHKTEGNPFSPLHCAVINDNEGAVELLI----ETLSPVIVNANDS--KNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLAC------SKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELL 946          

HSP 3 Score: 51.9878 bits (123), Expect = 4.646e-6
Identity = 69/263 (26.24%), Postives = 112/263 (42.59%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARN-RFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVN----VKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            +  G+T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA  +  + C  LL   A++       Q+ +DI           +     + L   V+ G+ D +  +I+           N+ ++   G T LH  A       V+ LL        RD +G SP+H +S    + ++  L+ A   V     + D     PLH ACY   G  + +E   VLL +        N F  P+HCA +      +ELL++
Sbjct:  580 TAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAA-TNGHSECLRLLIGNADL-------QSAVDI-----------QDGIGQTPLMLSVLGGHTDCVYSLINK--------GANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACY--NGHDTCVE---VLLEQELFHKTEGNPF-SPLHCAVINDNEGAVELLIE 809          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 112.464 bits (280), Expect = 1.577e-24
Identity = 142/550 (25.82%), Postives = 234/550 (42.55%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDY-----LEWINSD--------------LFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIE 3242
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+             CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD N++     +T LH AA    +   +F L+ +GA+VN  D   CTPL + + S  D +  + ++ N+ N  +++N G+ A  Y   Y     LE I S+              L D + +A +   +L +     + ++  ++S  D   +  Q  + LD   F+  +E
Sbjct:  107 WQTPLHVAAANKAVRCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVP------------CKDK----------KAYTPLHAAASSGMISVVKYLL--------DMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHG------RFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGH----ELLIN----TLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNRK-DSFGRTPLHYAA-ANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVE 597          

HSP 2 Score: 56.6102 bits (135), Expect = 1.807e-7
Identity = 73/276 (26.45%), Postives = 112/276 (40.58%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEIS---------------WANVRNQTVLDICKSNSLKAYIERKFKF--YSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN----LLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME---GANLIFRNNQFL-MPIHCAAMQGRFDVIELLL 2540
            G TALH  A+ GH + V  LL+  A    R+   ++P+  A+      + G LL     +                WA        D C    L+  +  K +   +S L   V++ N+  +E +I      L P+ +N      +  T LH AA       ++ LL     VN  D  G +PL  +++    N    L+  A AD+ ++D + N  LH AC          E   +L++E     NLI   N  L  P+H AA  G   V++ LL
Sbjct:  686 GRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGH---DTCVEVLLEQELFHKTEGNPFSPLHCAVINDNEGAVELLI----ETLSPVIVNANDS--KNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLAC------SKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELL 946          

HSP 3 Score: 51.9878 bits (123), Expect = 4.646e-6
Identity = 69/263 (26.24%), Postives = 112/263 (42.59%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARN-RFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVN----VKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            +  G+T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA  +  + C  LL   A++       Q+ +DI           +     + L   V+ G+ D +  +I+           N+ ++   G T LH  A       V+ LL        RD +G SP+H +S    + ++  L+ A   V     + D     PLH ACY   G  + +E   VLL +        N F  P+HCA +      +ELL++
Sbjct:  580 TAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAA-TNGHSECLRLLIGNADL-------QSAVDI-----------QDGIGQTPLMLSVLGGHTDCVYSLINK--------GANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACY--NGHDTCVE---VLLEQELFHKTEGNPF-SPLHCAVINDNEGAVELLIE 809          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 100.138 bits (248), Expect = 1.040e-20
Identity = 119/403 (29.53%), Postives = 185/403 (45.91%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +N   P  +  A+     S         + LL +G N   NE N   ++ +T   V   +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD
Sbjct:  162 QTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQAAREADMTK-VKKTLALEIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANV--NEKN---KDFMTPLHVAAERAHNDILE-VLQKHGAKMNA-VDTLGQTALHRAA-LAGHLQTCRLLLSYGAD 541          

HSP 2 Score: 78.9518 bits (193), Expect = 3.068e-14
Identity = 107/438 (24.43%), Postives = 173/438 (39.50%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  LK  +  +FK +S L            E  +   +  L    IN +       T LH A                          VSP  +    ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   +      +H AA+ G      LLL Y     I     +         M   AV        Q +L+     + ++ + +LL     G+L        DT+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  301 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQA--------AREADMTKVKKTLALEIINFKHPQTH-ETALHCAV-------------------------VSPHPKRK--QVTELLLRKGANVNEKNKDFMTPLHVAA-----ERAHNDILEVLQKHGAKMNAVDTLGQTALHRAALAGHLQTCRLLLSYGADPAI-----VSLQGFTAAQMGNEAV--------QQILNENIPVRNSDVDYRLLEAAKAGDL--------DTVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 662          

HSP 3 Score: 66.6254 bits (161), Expect = 1.997e-10
Identity = 91/343 (26.53%), Postives = 140/343 (40.82%), Query Frame = 3
Query: 1632 EKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQG--STLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            ++ L +  P  N      LL+A+ + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++       LE    N+  R  QG  ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  561 QQILNENIPVRNSDVDYRLLEAAKAGDLDTVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDMVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-----SLE----NINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 879          

HSP 4 Score: 65.4698 bits (158), Expect = 4.316e-10
Identity = 113/457 (24.73%), Postives = 188/457 (41.14%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHF---DAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE--RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRD--YKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--KENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGA-----------DINKR-YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            LL+A+   D+T +K    L       IN+   +   TALH A +  H         LL  GA+VN +N+   TPL  AAE    +I  +L + GA+++  +   QT L      +L  +++  R    Y                          +P  ++L+           TAA      AV+++L   I V   D  Y+ +    ++ DL+ +  L     +VN +D +     PLH +A Y      +++  ++ LL  GA++  ++   L+P+H A   G ++V ELL+ +  S  + +  +   L+         A  G +  C + LL  G +   K  + N  L  V  G+  +      D   L   K G            +IN R     + T LHLAA   ++ ++   L++ GADVNA D     PL  + S   +  A ++I
Sbjct:  418 LLQAAREADMTKVKKTLAL-----EIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDILEVLQKHGAKMNAVDTLGQTAL---HRAALAGHLQTCRLLLSYGA------------------------DPAIVSLQG---------FTAAQMGNE-AVQQILNENIPVRNSDVDYRLLEAA-KAGDLDTVKQLCSP-QNVNCRDLEGRHSTPLHFAAGY------NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEA-------AAKGKYEIC-KLLLKHGADPTKKNRDGNTPLDMVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSLENINCRDTQGRNSTPLHLAAGY-NNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI 815          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 100.138 bits (248), Expect = 1.040e-20
Identity = 119/403 (29.53%), Postives = 185/403 (45.91%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +N   P  +  A+     S         + LL +G N   NE N   ++ +T   V   +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD
Sbjct:  162 QTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQAAREADMTK-VKKTLALEIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANV--NEKN---KDFMTPLHVAAERAHNDILE-VLQKHGAKMNA-VDTLGQTALHRAA-LAGHLQTCRLLLSYGAD 541          

HSP 2 Score: 78.9518 bits (193), Expect = 3.068e-14
Identity = 107/438 (24.43%), Postives = 173/438 (39.50%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  LK  +  +FK +S L            E  +   +  L    IN +       T LH A                          VSP  +    ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   +      +H AA+ G      LLL Y     I     +         M   AV        Q +L+     + ++ + +LL     G+L        DT+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  301 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQA--------AREADMTKVKKTLALEIINFKHPQTH-ETALHCAV-------------------------VSPHPKRK--QVTELLLRKGANVNEKNKDFMTPLHVAA-----ERAHNDILEVLQKHGAKMNAVDTLGQTALHRAALAGHLQTCRLLLSYGADPAI-----VSLQGFTAAQMGNEAV--------QQILNENIPVRNSDVDYRLLEAAKAGDL--------DTVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 662          

HSP 3 Score: 66.6254 bits (161), Expect = 1.997e-10
Identity = 91/343 (26.53%), Postives = 140/343 (40.82%), Query Frame = 3
Query: 1632 EKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQG--STLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            ++ L +  P  N      LL+A+ + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++       LE    N+  R  QG  ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  561 QQILNENIPVRNSDVDYRLLEAAKAGDLDTVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDMVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-----SLE----NINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 879          

HSP 4 Score: 65.4698 bits (158), Expect = 4.316e-10
Identity = 113/457 (24.73%), Postives = 188/457 (41.14%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHF---DAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE--RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRD--YKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--KENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGA-----------DINKR-YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            LL+A+   D+T +K    L       IN+   +   TALH A +  H         LL  GA+VN +N+   TPL  AAE    +I  +L + GA+++  +   QT L      +L  +++  R    Y                          +P  ++L+           TAA      AV+++L   I V   D  Y+ +    ++ DL+ +  L     +VN +D +     PLH +A Y      +++  ++ LL  GA++  ++   L+P+H A   G ++V ELL+ +  S  + +  +   L+         A  G +  C + LL  G +   K  + N  L  V  G+  +      D   L   K G            +IN R     + T LHLAA   ++ ++   L++ GADVNA D     PL  + S   +  A ++I
Sbjct:  418 LLQAAREADMTKVKKTLAL-----EIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDILEVLQKHGAKMNAVDTLGQTAL---HRAALAGHLQTCRLLLSYGA------------------------DPAIVSLQG---------FTAAQMGNE-AVQQILNENIPVRNSDVDYRLLEAA-KAGDLDTVKQLCSP-QNVNCRDLEGRHSTPLHFAAGY------NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEA-------AAKGKYEIC-KLLLKHGADPTKKNRDGNTPLDMVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSLENINCRDTQGRNSTPLHLAAGY-NNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI 815          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 100.138 bits (248), Expect = 1.040e-20
Identity = 119/403 (29.53%), Postives = 185/403 (45.91%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +N   P  +  A+     S         + LL +G N   NE N   ++ +T   V   +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD
Sbjct:  162 QTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQAAREADMTK-VKKTLALEIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANV--NEKN---KDFMTPLHVAAERAHNDILE-VLQKHGAKMNA-VDTLGQTALHRAA-LAGHLQTCRLLLSYGAD 541          

HSP 2 Score: 78.9518 bits (193), Expect = 3.068e-14
Identity = 107/438 (24.43%), Postives = 173/438 (39.50%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  LK  +  +FK +S L            E  +   +  L    IN +       T LH A                          VSP  +    ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   +      +H AA+ G      LLL Y     I     +         M   AV        Q +L+     + ++ + +LL     G+L        DT+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  301 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLTYEFKGHSLLQA--------AREADMTKVKKTLALEIINFKHPQTH-ETALHCAV-------------------------VSPHPKRK--QVTELLLRKGANVNEKNKDFMTPLHVAA-----ERAHNDILEVLQKHGAKMNAVDTLGQTALHRAALAGHLQTCRLLLSYGADPAI-----VSLQGFTAAQMGNEAV--------QQILNENIPVRNSDVDYRLLEAAKAGDL--------DTVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 662          

HSP 3 Score: 66.6254 bits (161), Expect = 1.997e-10
Identity = 91/343 (26.53%), Postives = 140/343 (40.82%), Query Frame = 3
Query: 1632 EKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQG--STLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            ++ L +  P  N      LL+A+ + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++       LE    N+  R  QG  ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  561 QQILNENIPVRNSDVDYRLLEAAKAGDLDTVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDMVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-----SLE----NINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 879          

HSP 4 Score: 65.4698 bits (158), Expect = 4.316e-10
Identity = 113/457 (24.73%), Postives = 188/457 (41.14%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHF---DAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE--RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRD--YKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--KENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGA-----------DINKR-YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            LL+A+   D+T +K    L       IN+   +   TALH A +  H         LL  GA+VN +N+   TPL  AAE    +I  +L + GA+++  +   QT L      +L  +++  R    Y                          +P  ++L+           TAA      AV+++L   I V   D  Y+ +    ++ DL+ +  L     +VN +D +     PLH +A Y      +++  ++ LL  GA++  ++   L+P+H A   G ++V ELL+ +  S  + +  +   L+         A  G +  C + LL  G +   K  + N  L  V  G+  +      D   L   K G            +IN R     + T LHLAA   ++ ++   L++ GADVNA D     PL  + S   +  A ++I
Sbjct:  418 LLQAAREADMTKVKKTLAL-----EIINFKHPQTHETALHCAVVSPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDILEVLQKHGAKMNAVDTLGQTAL---HRAALAGHLQTCRLLLSYGA------------------------DPAIVSLQG---------FTAAQMGNE-AVQQILNENIPVRNSDVDYRLLEAA-KAGDLDTVKQLCSP-QNVNCRDLEGRHSTPLHFAAGY------NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEA-------AAKGKYEIC-KLLLKHGADPTKKNRDGNTPLDMVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSLENINCRDTQGRNSTPLHLAAGY-NNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI 815          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 117.087 bits (292), Expect = 6.943e-26
Identity = 132/485 (27.22%), Postives = 214/485 (44.12%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+            +CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + ++++  GA +   +     P+H AA  G   +I  L+    D SK+ I     +            LA   GF+ C + LL  GF+   ++          G   LH  A     + LNLLL  TGAD NK+     +T LH AA    +   +F L+ +GA VN  D   C+PL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +  +L   ET
Sbjct:  134 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEV------------MCKDK----------KSYTPLHAAASSGMISVIKYLL--------DLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLH-----------LAALSGFSDCCRKLLSSGFDIDTHDD--------FGRTCLHAAAAGGNLECLNLLL-STGADFNKK-DKFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARET 555          

HSP 2 Score: 80.8777 bits (198), Expect = 9.810e-15
Identity = 102/389 (26.22%), Postives = 169/389 (43.44%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S ++D + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S  +E+++LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA ++ ++ +   P+H AA  G   VI+ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TA+H     + S     I+IQ GA+++  D    TPL I+
Sbjct:   42 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEDAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL--------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQVNE------RGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIH--GRFSRSQ----IIIQNGAEIDCEDKNGNTPLHIA 373          

HSP 3 Score: 73.1738 bits (178), Expect = 2.120e-12
Identity = 75/301 (24.92%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   + + +L++  ADVN +D++   PLH A   +  +                               +E + +LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E+ A         G   LH    N  D +   L   GA++N+       T LH AA  T     + +L+  GADVN    +  TPL ++        ++++I
Sbjct:   70 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHA--------AASSGMISVIKYLLDLGVDMNESNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQ-VNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIII 353          

HSP 4 Score: 73.1738 bits (178), Expect = 2.212e-12
Identity = 102/429 (23.78%), Postives = 162/429 (37.76%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQ----RDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFL----AVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            +S    +N  ++    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +    IN  S C++                   LL+   DV       D  G +PL  S      E +  L+  GA+V+ KD+     LH  A  G E      E ++ LL   AN + R+ +   PIH AA  G   V+  LL        Q A+ ++ +  I  +  +     A   G  +C + LL++   F++ E N            LH   +ND      +L+   G  I        +T LH AA  TD  + + +L+   A VNA D+   TPL ++       + +V+++
Sbjct:  563 TSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASIL-----------------VKDYVVK---------------------------RTPIHSAAINGHSECLR-------------------LLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL--------QTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSP--------LHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAA-FTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVS 904          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 117.087 bits (292), Expect = 6.954e-26
Identity = 132/485 (27.22%), Postives = 214/485 (44.12%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+            +CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + ++++  GA +   +     P+H AA  G   +I  L+    D SK+ I     +            LA   GF+ C + LL  GF+   ++          G   LH  A     + LNLLL  TGAD NK+     +T LH AA    +   +F L+ +GA VN  D   C+PL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +  +L   ET
Sbjct:  134 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEV------------MCKDK----------KSYTPLHAAASSGMISVIKYLL--------DLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLH-----------LAALSGFSDCCRKLLSSGFDIDTHDD--------FGRTCLHAAAAGGNLECLNLLL-STGADFNKK-DKFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARET 555          

HSP 2 Score: 80.8777 bits (198), Expect = 1.020e-14
Identity = 102/389 (26.22%), Postives = 169/389 (43.44%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S ++D + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S  +E+++LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA ++ ++ +   P+H AA  G   VI+ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TA+H     + S     I+IQ GA+++  D    TPL I+
Sbjct:   42 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEDAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL--------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQVNE------RGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIH--GRFSRSQ----IIIQNGAEIDCEDKNGNTPLHIA 373          

HSP 3 Score: 73.1738 bits (178), Expect = 2.208e-12
Identity = 75/301 (24.92%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   + + +L++  ADVN +D++   PLH A   +  +                               +E + +LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E+ A         G   LH    N  D +   L   GA++N+       T LH AA  T     + +L+  GADVN    +  TPL ++        ++++I
Sbjct:   70 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHA--------AASSGMISVIKYLLDLGVDMNESNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQ-VNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIII 353          

HSP 4 Score: 58.151 bits (139), Expect = 9.632e-8
Identity = 75/305 (24.59%), Postives = 126/305 (41.31%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYS-ELSGF-----VVSGNDDVLEEV-IHD--HRTKLEPIFINLRSRCIQ---------------GSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNV----KDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQF------LMPIHCAAMQGRFDVIELLLDYD 2549
            +S    +N  ++    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ ++   +S  ++G      ++ GN DV   V IHD   +T L    +N  + C+                G T LH  A       V+ LL    +   RD +G +P+H ++    + +++ L++    V+V     D     PLH ACY   G  + +E   +LL +        N F      + P+H AA     + ++LLL ++
Sbjct:  563 TSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASI-----------------LVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACY--NGHDACVE---LLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHN 845          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 117.087 bits (292), Expect = 7.516e-26
Identity = 132/485 (27.22%), Postives = 214/485 (44.12%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+            +CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + ++++  GA +   +     P+H AA  G   +I  L+    D SK+ I     +            LA   GF+ C + LL  GF+   ++          G   LH  A     + LNLLL  TGAD NK+     +T LH AA    +   +F L+ +GA VN  D   C+PL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +  +L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEV------------MCKDK----------KSYTPLHAAASSGMISVIKYLL--------DLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLH-----------LAALSGFSDCCRKLLSSGFDIDTHDD--------FGRTCLHAAAAGGNLECLNLLL-STGADFNKK-DKFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARET 528          

HSP 2 Score: 80.8777 bits (198), Expect = 1.020e-14
Identity = 102/389 (26.22%), Postives = 169/389 (43.44%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S ++D + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S  +E+++LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA ++ ++ +   P+H AA  G   VI+ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TA+H     + S     I+IQ GA+++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEDAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL--------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQVNE------RGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIH--GRFSRSQ----IIIQNGAEIDCEDKNGNTPLHIA 346          

HSP 3 Score: 73.1738 bits (178), Expect = 2.171e-12
Identity = 75/301 (24.92%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   + + +L++  ADVN +D++   PLH A   +  +                               +E + +LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E+ A         G   LH    N  D +   L   GA++N+       T LH AA  T     + +L+  GADVN    +  TPL ++        ++++I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHA--------AASSGMISVIKYLLDLGVDMNESNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQ-VNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIII 326          

HSP 4 Score: 73.1738 bits (178), Expect = 2.364e-12
Identity = 102/429 (23.78%), Postives = 162/429 (37.76%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQ----RDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFL----AVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            +S    +N  ++    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +    IN  S C++                   LL+   DV       D  G +PL  S      E +  L+  GA+V+ KD+     LH  A  G E      E ++ LL   AN + R+ +   PIH AA  G   V+  LL        Q A+ ++ +  I  +  +     A   G  +C + LL++   F++ E N            LH   +ND      +L+   G  I        +T LH AA  TD  + + +L+   A VNA D+   TPL ++       + +V+++
Sbjct:  536 TSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASIL-----------------VKDYVVK---------------------------RTPIHSAAINGHSECLR-------------------LLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL--------QTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSP--------LHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAA-FTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVS 877          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 116.701 bits (291), Expect = 8.766e-26
Identity = 132/485 (27.22%), Postives = 214/485 (44.12%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+            +CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + ++++  GA +   +     P+H AA  G   +I  L+    D SK+ I     +            LA   GF+ C + LL  GF+   ++          G   LH  A     + LNLLL  TGAD NK+     +T LH AA    +   +F L+ +GA VN  D   C+PL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +  +L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEV------------MCKDK----------KSYTPLHAAASSGMISVIKYLL--------DLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLH-----------LAALSGFSDCCRKLLSSGFDIDTHDD--------FGRTCLHAAAAGGNLECLNLLL-STGADFNKK-DKFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARET 528          

HSP 2 Score: 73.1738 bits (178), Expect = 2.573e-12
Identity = 95/397 (23.93%), Postives = 159/397 (40.05%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S ++D ++ V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S  +E+++LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA ++ ++ +   P+H AA  G   VI                                         ++LLD G +  E+ A         G   LH    N  D +   L   GA++N+       T LH AA  T     + +L+  GADVN    +  TPL ++        ++++I
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEDAVQ-VLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVI-----------------------------------------KYLLDLGVDMNESNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQ-VNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIII 326          

HSP 3 Score: 72.7886 bits (177), Expect = 2.708e-12
Identity = 102/429 (23.78%), Postives = 162/429 (37.76%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQ----RDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFL----AVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            +S    +N  ++    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +    IN  S C++                   LL+   DV       D  G +PL  S      E +  L+  GA+V+ KD+     LH  A  G E      E ++ LL   AN + R+ +   PIH AA  G   V+  LL        Q A+ ++ +  I  +  +     A   G  +C + LL++   F++ E N            LH   +ND      +L+   G  I        +T LH AA  TD  + + +L+   A VNA D+   TPL ++       + +V+++
Sbjct:  536 TSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASIL-----------------VKDYVVK---------------------------RTPIHSAAINGHSECLR-------------------LLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL--------QTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSP--------LHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAA-FTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVS 877          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 116.701 bits (291), Expect = 9.299e-26
Identity = 132/485 (27.22%), Postives = 214/485 (44.12%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE+            +CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + ++++  GA +   +     P+H AA  G   +I  L+    D SK+ I     +            LA   GF+ C + LL  GF+   ++          G   LH  A     + LNLLL  TGAD NK+     +T LH AA    +   +F L+ +GA VN  D   C+PL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +  +L   ET
Sbjct:  126 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEV------------MCKDK----------KSYTPLHAAASSGMISVIKYLL--------DLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLH-----------LAALSGFSDCCRKLLSSGFDIDTHDD--------FGRTCLHAAAAGGNLECLNLLL-STGADFNKK-DKFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARET 547          

HSP 2 Score: 80.4925 bits (197), Expect = 1.316e-14
Identity = 102/389 (26.22%), Postives = 169/389 (43.44%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S ++D + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S  +E+++LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA ++ ++ +   P+H AA  G   VI+ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TA+H     + S     I+IQ GA+++  D    TPL I+
Sbjct:   34 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEDAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL--------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQVNE------RGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIH--GRFSRSQ----IIIQNGAEIDCEDKNGNTPLHIA 365          

HSP 3 Score: 73.1738 bits (178), Expect = 2.321e-12
Identity = 75/301 (24.92%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   + + +L++  ADVN +D++   PLH A   +  +                               +E + +LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E+ A         G   LH    N  D +   L   GA++N+       T LH AA  T     + +L+  GADVN    +  TPL ++        ++++I
Sbjct:   62 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHA--------AASSGMISVIKYLLDLGVDMNESNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQ-VNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIII 345          

HSP 4 Score: 72.7886 bits (177), Expect = 3.097e-12
Identity = 102/429 (23.78%), Postives = 162/429 (37.76%), Query Frame = 3
Query: 1746 SSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQ----RDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFL----AVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            +S    +N  ++    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +    IN  S C++                   LL+   DV       D  G +PL  S      E +  L+  GA+V+ KD+     LH  A  G E      E ++ LL   AN + R+ +   PIH AA  G   V+  LL        Q A+ ++ +  I  +  +     A   G  +C + LL++   F++ E N            LH   +ND      +L+   G  I        +T LH AA  TD  + + +L+   A VNA D+   TPL ++       + +V+++
Sbjct:  555 TSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASIL-----------------VKDYVVK---------------------------RTPIHSAAINGHSECLR-------------------LLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL--------QTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSP--------LHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAA-FTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVS 896          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 108.227 bits (269), Expect = 3.126e-23
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ++ KG +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAESLVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 528          

HSP 2 Score: 76.2554 bits (186), Expect = 1.886e-13
Identity = 77/301 (25.58%), Postives = 124/301 (41.20%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  +                                E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA++N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQKNEK-GFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 326          

HSP 3 Score: 75.0998 bits (183), Expect = 5.008e-13
Identity = 99/389 (25.45%), Postives = 165/389 (42.42%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +++  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QILLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 346          

HSP 4 Score: 62.7734 bits (151), Expect = 3.111e-9
Identity = 101/448 (22.54%), Postives = 169/448 (37.72%), Query Frame = 3
Query: 1677 CKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVS----GGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            C  L+ + +  DV      TD+ S         D+    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +     N  S C++   LL   A     + ++            D  G +PL  S      + +  L+  GA+V+ KD+     LH  A  G E      E +  LL  GA  + R+++   PIH +A  G   V+  LL        Q A  ++    +  +  + A+      G  +C + LL++   F++ + N            LH   +ND      +L+   GA I        +T LH AA  TD  + + +L+   A VN+ D+   TPL ++       + +++++
Sbjct:  520 CLQLIASETPLDVLMETSGTDMLSDS-------DNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASI-----------------LVKDYVLK---------------------------RTPIHAAATNGHSECLR---LLIGNAEPQNAVDIQ------------DGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALL--------QSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV-FQKIDGNAFSP--------LHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAA-FTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVS 877          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 107.842 bits (268), Expect = 4.342e-23
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ++ KG +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  137 WQTPLHIAAANKAVKCAESLVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLLD--------LGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 558          

HSP 2 Score: 76.2554 bits (186), Expect = 1.991e-13
Identity = 77/301 (25.58%), Postives = 124/301 (41.20%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  +                                E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA++N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   73 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQKNE-KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 356          

HSP 3 Score: 74.7146 bits (182), Expect = 6.536e-13
Identity = 99/389 (25.45%), Postives = 165/389 (42.42%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +++  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   45 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QILLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 376          

HSP 4 Score: 56.225 bits (134), Expect = 2.830e-7
Identity = 111/449 (24.72%), Postives = 180/449 (40.09%), Query Frame = 3
Query: 1677 CKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWAN-VRNQTVLDICKSNSLKAYIERKFKFYSELSGFV----VSGNDDVLEEVIHDHRTKLEPIF---INLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVN----VKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL--IQAGADVNATDNEHCTPLFISCSRNDL 2963
            C  L+ + +  DV      TD+ S         D+    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I   + V  +T +    +N     + R     +E    V     +G   ++  V++ H   +  +     N+ ++   G T LH  A       V  LL        RD +G +P+H S+    + ++  L+++   V+    V D      LH ACY   G ++ +E    LL+E       +     P+HCA +       E+L+D   +  +       +  L        A       C Q LL +  N + N A+       TG+  L   A N   +T+ +L+    AD+  +      TALHLA      T  + IL  I     +NAT+    TPL ++ +RN L
Sbjct:  550 CLQLIASETPLDVLMETSGTDMLSDS-------DNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECL-RLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACY--NGHETCVE----LLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPL------HAAAFTDHVECLQLLLSQ--NAQVNSADS------TGKTPLMMAAENGQTNTVEMLVSSASADLTLQ-DKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVA-ARNGL 968          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Tnks (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [Source:MGI Symbol;Acc:MGI:1341087])

HSP 1 Score: 100.908 bits (250), Expect = 5.794e-21
Identity = 116/391 (29.67%), Postives = 183/391 (46.80%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            G   LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +N   P  +  A+    AS        A+ LL +G N   NE N   ++ +T   V   +A ND +  +L+K GA +N     + QTALH AA L        +L+  G+D
Sbjct:  242 GLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAK-VKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANV--NEKN---KDFMTPLHVAAERAHNDVME-VLHKHGAKMNA-LDSLGQTALHRAA-LAGHLQTCRLLLSYGSD 609          

HSP 2 Score: 76.2554 bits (186), Expect = 1.999e-13
Identity = 107/438 (24.43%), Postives = 176/438 (40.18%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  L+  +  +FK +S L     +  +  L +V    +  L    IN +       T LH A                          V+ LH     ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   ++     +H AA+ G      LLL Y     I     I         M   AV        Q +L      + ++ + +LL     G+L        +T+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  369 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQ----AAREADLAKV----KKTLALEIINFKQPQSH-ETALHCA--------------------------VASLHPKRK-QVAELLLRKGANVNEKNKDFMTPLHVAA-----ERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSI-----ISLQGFTAAQMGNEAV--------QQILSESTPMRTSDVDYRLLEASKAGDL--------ETVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 730          

HSP 3 Score: 70.0922 bits (170), Expect = 1.723e-11
Identity = 87/323 (26.93%), Postives = 132/323 (40.87%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            LL+AS + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++         P  IN R    + ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  647 LLEASKAGDLETVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-------TPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 947          

HSP 4 Score: 60.4622 bits (145), Expect = 1.349e-8
Identity = 110/453 (24.28%), Postives = 182/453 (40.18%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHF---DAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--KENEANQLLRNVITGELVLHGQALNDTLNLLLYKTG--ADINKRYPP----------MSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            LL+A+   D+  +K    L       IN+   +   TALH A    H         LL  GA+VN +N+   TPL  AAE    ++  +L + GA+++  +   QT L      +L  +++      S  S                      +P  I+L     QG T         + +  +   M   DV+ R  +      ++ DLE +  L     +VN +D +     PLH +A Y      +++  ++ LL  GA++  ++   L+P+H A   G ++V ELL+ +  S  + +  +   L+         A  G +  C + LL  G +   K  + N  L  V  G+  +      D   L   K G  A + K   P           + T LHLAA   ++ ++   L++ GADVNA D     PL  + S   +  A ++I
Sbjct:  486 LLQAAREADLAKVKKTLAL-----EIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTAL---HRAALAGHLQTCRLLLSYGS----------------------DPSIISL-----QGFTAAQMGNEAVQQILSESTPMRTSDVDYRLLEAS----KAGDLETVKQLCSP-QNVNCRDLEGRHSTPLHFAAGY------NRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEA-------AAKGKYEIC-KLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGY-NNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI 883          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 98.2117 bits (243), Expect = 3.367e-20
Identity = 111/426 (26.06%), Postives = 175/426 (41.08%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQA----GADVNATDN 2918
            W   L  A+++  V   +++  L SS    +N  D   G TALH AA++GH + V  LL  GA++NA ++  +  L  AA M   ++  +L+  GAE++  + +  T L    SN   + ++       E+    V GN                              T LH A +  +   V EL+    +VNQ +  G +PLH     +     + LL+  GADVN++ +D   PLH +A +G      +  + + L+  G  +   +     P+H AA  G     ELL++      I    +  K  +       LA     + C + LL  GF     +          G   LH  A    +    LL  +GAD +K+     +T LH AA      +  F  I+A    GA+VN TD+
Sbjct:  107 WQTPLHVAAANKAVKCAEVIIPLLSS----VNVSD-RGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGN------------------------------TALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHG------RFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGH----ELLIN----TLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPD--------TFGRTCLHAAAAGGNVECIKLLQSSGADFHKK-DKCGRTPLHYAA-----ANCHFHCIKALVTTGANVNETDD 469          

HSP 2 Score: 72.0182 bits (175), Expect = 3.949e-12
Identity = 114/478 (23.85%), Postives = 192/478 (40.17%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIF---INLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDV-IELLLDYDKSKQIQEALEIEKLNLIPPSMNF-----LAVSGGFASCAQWLLDRGFNFKENEANQLLRNV------------ITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDY 3041
            L++A  S D   I++L          +N  DSE   T LH+AA  G  + +  L+  GA VNA++    TPL  A     E    +L++  A+++  +   QT L +  +N      E      S ++     G   +    ++ H   +  +     N+ +   +    LH AA+      V  L+    +V  +D KG +PLH ++    + ++  L+  G +++  +   N  LH ACY       Q   +  L+  GAN+   NN    P+H AA      + +ELL++      IQ       L++      F     L  +GG   C     +   +      ++LL N             I     LH  ALN   +    L  +G +I+       +T LH AA    + + + +L  +GAD +  D    TPL  + +       K ++T   N+N  ++ G TA  Y
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED----VNALDSEK-RTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACY-----NGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTP-DTFGRTCLHAAA-AGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHY 477          

HSP 3 Score: 68.5514 bits (166), Expect = 5.137e-11
Identity = 97/423 (22.93%), Postives = 171/423 (40.43%), Query Frame = 3
Query: 1752 DKTFINWHDSEMG--NTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVIT-----GELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            ++T   + +S+ G   + LHLAA +GH  A+  LL+   D++ R+   +T L+ AA          L+  GA I                     +++      + L   V++G+   L  ++    T   P  ++++    +G T L  A  +    AV  LL    +V+  D  G + LHR   +   E + +L+E  A +  KD     PLH A     G  + + ++  + +   +   ++NQ   P+H A   G  + IE+LL         E     K    P +    A+  G  SCA  LL             +  ++++     G   LH  A  D      LL +  A +N       +TAL +AA    +  +  ++  A AD+   D +  TPL ++ S+   + A +++
Sbjct:  553 ERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASI---------------------FVKDNVTKRTPLHASVINGHTLCLRLLL---ETADNPEVVDVKD--AKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYA--AARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLL---------EQKCFRKFIGNPFTPLHCAIINGHESCASLLL-----------GAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNA-VDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHEKCALLIL 926          

HSP 4 Score: 58.9214 bits (141), Expect = 3.796e-8
Identity = 92/346 (26.59%), Postives = 143/346 (41.33%), Query Frame = 3
Query: 1650 LFPKNNVTWCKLLLKASSSNDVT-TIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKF--------------YSELSGFVVSGNDDVLE---------EVIHDHRTKLEPIFINLRSRCI-----------------QGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLI-EAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLM---EGANLI-FRNNQFLMPIHCAAMQGRFDVIELLL 2540
            +F K+NVT  +  L AS  N  T  ++LL +  + +   ++  D++ G T L LA   GH DAV  LLE  A+V+A +    T L        E    +LLE  A I   + R +T L    +     ++    +               Y+ L     +GN++ +E         + I +  T L    IN    C                  +G T LH AA       ++ LL     VN  D  G + L  +++      +++L+  A AD+ VKD+D N PLH A           EK  +L++   +  +LI  +N+    P+H AA  G   V+E LL
Sbjct:  626 IFVKDNVTK-RTPLHASVINGHTLCLRLLLET-ADNPEVVDVKDAK-GQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAI------SKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELL 962          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 95.1301 bits (235), Expect = 4.029e-19
Identity = 116/433 (26.79%), Postives = 192/433 (44.34%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDIC----KSNSLKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLR---IDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLL-------RNVI------------------TGELVLHGQALNDTLN--LLLYKTGAD---INKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            ++ GNTALH+A++ G  + V  L++ GA++NA+++   TPL+ AA+ +  ++   LLE GA  S A     T L +      + ++   +E   K    L    + +  DD     +   +DH   ++   +  R+    G T LH AAH+   + V  LL+ R   +D   R+  G++PLH +S   +  ++ LL++ G  ++ K  D   PLH  C    G     + +++LL   A L+ R    L P+H AA     + ++ LL Y   K   + + ++ L  +      +A   G     + LLD+  N      N          +N I                  +G   +H  A    LN  LLL + GA     N R     +TALH+AA      +++  L++ GA V+A   E  TPL I+
Sbjct:   90 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRT-TESGFTPLHIAAHYGN-VNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLH--CAARSGHD---QVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQY---KAPVDDVTLDYLTAL-----HVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR----GETALHMAAR-AGQVEVVRCLLRNGALVDARAREEQTPLHIA 500          

HSP 2 Score: 93.2041 bits (230), Expect = 1.465e-18
Identity = 117/433 (27.02%), Postives = 171/433 (39.49%), Query Frame = 3
Query: 1683 LLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEE-VIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVIT----GELVLHGQALNDTLNLLLYKTGADINKR----YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            LLL+  +S DVT I+                    G TALH+AA  G  + V CLL  GA V+AR R +QTPL  A+ +    I  +LL+  A    A     T L I          E +    S L           LE    H   TK             +G T LH AA +      K LL  R   +     G++PLH ++   + ++  LL+E GA  +   ++   PLH A      +K+QM+    LL  GA       Q + P+H A+ +G  D++ LLLD   +  +     +  L+        LA      + A  L   G +          R+  T      L++     N  +   L K GA++N +    Y P+ Q A     H+ +      +L+Q GA  NAT     T L I+
Sbjct:  445 LLLQNGASPDVTNIR--------------------GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR-------EGQVDVASVL-----------LEAGAAHSLATK-------------KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAA-----KKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLH--------LAAQEDKVNVADILTKHGAD----------RDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIIN------VLLQHGAKPNATTANGNTALAIA 797          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.186e-22
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ++ KG +PLH     +     + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAESLVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 528          

HSP 2 Score: 76.2554 bits (186), Expect = 1.319e-12
Identity = 77/301 (25.58%), Postives = 124/301 (41.20%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGE----------------------------KSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  +                                E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA++N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGANVNQKNEK-GFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 326          

HSP 3 Score: 75.0998 bits (183), Expect = 3.503e-12
Identity = 99/389 (25.45%), Postives = 165/389 (42.42%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +++  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G N   N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QILLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 346          

HSP 4 Score: 62.7734 bits (151), Expect = 2.176e-8
Identity = 101/448 (22.54%), Postives = 169/448 (37.72%), Query Frame = 3
Query: 1677 CKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVS----GGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            C  L+ + +  DV      TD+ S         D+    + LHLAA  GH  A+  L++   D++ RN   +TPL  AA         +L+  GA I                  +K Y+ +                           RT +     N  S C++   LL   A     + ++            D  G +PL  S      + +  L+  GA+V+ KD+     LH  A  G E      E +  LL  GA  + R+++   PIH +A  G   V+  LL        Q A  ++    +  +  + A+      G  +C + LL++   F++ + N            LH   +ND      +L+   GA I        +T LH AA  TD  + + +L+   A VN+ D+   TPL ++       + +++++
Sbjct:  520 CLQLIASETPLDVLMETSGTDMLSDS-------DNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASI-----------------LVKDYVLK---------------------------RTPIHAAATNGHSECLR---LLIGNAEPQNAVDIQ------------DGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALL--------QSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV-FQKIDGNAFSP--------LHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAA-FTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVS 877          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 106.686 bits (265), Expect = 7.155e-22
Identity = 129/481 (26.82%), Postives = 207/481 (43.04%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  GA++NA ++  +  +  AA M    +  +L+  GAE++            CK            K Y+ L     SG   V++ ++         + +++      G+T LH A +  + + V EL+     VNQ++ KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  GF+    +          G   LH  A         LL  TGAD NK+     ++ LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++  G+ A  Y   Y   +   L   ET
Sbjct:  107 WQTPLHIAAANKAVKCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT------------CKDK----------KSYTPLHAAASSGMISVVKYLL--------DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG------RFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGH----ELLIN----TLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNKK-DKFGRSPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASET 528          

HSP 2 Score: 74.3294 bits (181), Expect = 5.266e-12
Identity = 77/301 (25.58%), Postives = 125/301 (41.53%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQM----------------------------EKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +  + ++                             E +K+LL  GAN+   + +    IH AA  G  +V++LL+ +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L   GA +N++      T LH AA  T     + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHA--------AASSGMISVVKYLLDLGVDMNEPNA--------YGNTPLHVACYNGQDVVVNELIDCGAIVNQKNE-KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII 326          

HSP 3 Score: 71.2478 bits (173), Expect = 4.872e-11
Identity = 99/389 (25.45%), Postives = 164/389 (42.16%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    DVN ++  K+TPL +AA +    I  +L+  GA ++                       +  K+ + L   V S +++ + +V+  H        +N R +  Q  T LH AA        + L+ L  +VN  D  G + LH    S   E++ LL+  GA++N  D+ + + +H A Y        +E +K+L+  GA +  ++ +   P+H AA  G   V++ LLD          +++ + N    +   +A   G       L+D G     N+ N+       G   LH  A +    L   LL   GAD+N +      P+  TALH     + S      +IQ+GA ++  D    TPL I+
Sbjct:   15 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVN----------------------AKDSKWLTPLHRAVASCSEEAV-QVLLKHSAD-----VNARDKNWQ--TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY-----MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL--------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIV--NQKNE------KGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALH--GRFSRSQ----TIIQSGAVIDCEDKNGNTPLHIA 346          

HSP 4 Score: 60.4622 bits (145), Expect = 1.109e-7
Identity = 75/278 (26.98%), Postives = 114/278 (41.01%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEI----SWANVRNQTVLDICKSNSLKAYIE----------RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIIN----LLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME---GANLIFRNNQFL-MPIHCAAMQGRFDVIELLLDYDKS 2555
            G TALH  A+ GH + V  LL+ GA    R+   +TP+  +A      + G LL+  A +    + A+    T L     N  +  +E           +   +S L   V++ N+   E +I      L    +N      +G T LH AA       ++ LL     VN  D  G +PL  +++    N    L+  A A++ ++D   N  LH AC          E   +L++E     NLI   N  L  P+H AA  G   V++ LL    S
Sbjct:  686 GRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLI----DTLGASIVNATDS--KGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLAC------SKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGAS 951          

HSP 5 Score: 57.7658 bits (138), Expect = 7.104e-7
Identity = 112/495 (22.63%), Postives = 181/495 (36.57%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENIC-----------GIL-----------LEWGAEISWANVRNQTVLDICKSNSLKAYIERK--FKFYSELSGFVVSGNDDVLEEVIHD----------HRTKLEPIFINLRSRCI-----QGSTLL-------HTAAHFSKTLAVKELLMLRID-------VNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLF----------------------------------ISCSRNDLQSAKVMI 2984
            + G + LH AA + ++  +  L+  GA VN  +    TPL  AA  D +  C           GI              +G  +    + ++T LD+    S    +         S L      G+   LE ++             RT L+         C+     QG+++L        T  H + T    E L L I        V+ +D  G +PL  S      + +  L+  GA+V+ KD+     LH  A  G E      E +  LL  GA  + R+++   PIH +A  G   V+  LL   +S    +A      N    ++++ A   G  +C + LL++   F++ E N            LH   +ND      +L+   GA I        +T LH AA  TD  + + +L+   A VN+ D+   TPL                                   ++CS+    SA +++
Sbjct:  436 KFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHE------ECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALL---QSAASMDANPATADNHGYTALHW-ACYNGHETCVELLLEQEV-FQKTEGNAFSP--------LHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAA-FTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLIL 910          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54KA7|SECG_DICDI (Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.555e-20
Identity = 118/438 (26.94%), Postives = 189/438 (43.15%), Query Frame = 3
Query: 1755 KTFINWHDSEMGNTALHLAAIDGHFDAVLCLLE-CGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIF---INLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDY 3041
            K   N  DS  GNT L  A+  GH + +  L+E  G DVN ++    TPL  A+          LL   A+        +T L    +      +E   K  S+++         + +     H + +  +      +  R I G + LH AA       V++L+    ++N  D +GV+PLH +    +L++   LIE GA +N+ DE    PLH A +   G K   E +  L ++   +  R+++    +H AA  G  D+++LL+ Y     I++  E     L   S N      G +SCA+ L+D+G      ++         G   LH  A N     L  L ++GA++  +      T LH AA+    +D   IL++ GA+VNA D    TPL ++ +     +  V+I     I+ KN  G T   Y
Sbjct:   92 KANANIKDS-AGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAF--NGHKEVCEYL--LYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKD--EEGATPLHKASFN------GHSSCAKLLVDKGAPICIVDSQ--------GATPLHKAAFNGRSKCLATLIRSGAELEVK-DSQGGTPLHNAAY-NGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVY 506          

HSP 2 Score: 70.4774 bits (171), Expect = 8.382e-11
Identity = 100/407 (24.57%), Postives = 167/407 (41.03%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCI----QGSTLLHTAAHFSKTLAVKELLMLRID-VNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G T LH A+  G+   V  L++  + VNA +    TPL  A+     +   +LL+ GA++   ++   + L    S      +E+  +    ++   + G    L     +   +L    I L ++       G T LH AA        + LL L    ++ RD +  + LH ++    L++++LLI   A +N+KDE+   PLH A +   G  S     K+L+ +GA +   ++Q   P+H AA  GR   +  L+      +    LE++      P  N  A   G + C + LL +G N           N +            DT                   S T LHLA+    + D + +LIQ  A ++A +    TPL  +  +N    A+V+I
Sbjct:  169 GETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTP-LHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASF--NGHSSCA---KLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLI------RSGAELEVKDSQGGTPLHN--AAYNGHSDCCRILLKKGANV----------NAV------------DT------------------HSSTPLHLAS-AAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLI 520          

HSP 3 Score: 66.6254 bits (161), Expect = 1.371e-9
Identity = 86/330 (26.06%), Postives = 127/330 (38.48%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIE-AGADVNVKDEDNNQPLHSAC------------------------------YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKE--------------NEANQLLRNVI-----------TGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA       V  LL  + + N +D  G +PL  +S    LE I LL+E  G DVN KD+ N  PLH A                               +   G   Q   +++L+   + +   +N  + P+H A+  G    + LLL      +    ++   ++ I P  N  A S G+  C + L+  G N                 N   QL + +I            GE  LH  A N   +    LLY     I+ R    S T+LHLAA      D++ +LI+  A +N  D E  TPL  +        AK+++
Sbjct:   71 TPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQC--VELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLL------KKGAKVDPRDIHGISPLHN--AASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQS-TSLHLAA-FNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLV 388          

HSP 4 Score: 55.0694 bits (131), Expect = 3.935e-6
Identity = 63/239 (26.36%), Postives = 103/239 (43.10%), Query Frame = 3
Query: 1752 DKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANL 2459
            D T I+  DS   +T+LHLAA +G  D V  L+   A +N ++    TPL  A+     +   +L++ GA I   + +  T L        KA    + K    L+  + SG +                    L  +  QG T LH AA+   +   + LL    +VN  D    +PLH +S     + +++LI+  A ++ K+     PL  A      +K+  +  +VL+  GA+L
Sbjct:  324 DPTMIDCRDSRQ-STSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLH-------KAAFNGRSKC---LATLIRSGAE--------------------LEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAI-----KKNHSDVARVLIRAGADL 526          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PFX9|TNKS1_MOUSE (Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.053e-20
Identity = 116/391 (29.67%), Postives = 183/391 (46.80%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            G   LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +N   P  +  A+    AS        A+ LL +G N   NE N   ++ +T   V   +A ND +  +L+K GA +N     + QTALH AA L        +L+  G+D
Sbjct:  242 GLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAK-VKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANV--NEKN---KDFMTPLHVAAERAHNDVME-VLHKHGAKMNA-LDSLGQTALHRAA-LAGHLQTCRLLLSYGSD 609          

HSP 2 Score: 76.2554 bits (186), Expect = 1.399e-12
Identity = 107/438 (24.43%), Postives = 176/438 (40.18%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  L+  +  +FK +S L     +  +  L +V    +  L    IN +       T LH A                          V+ LH     ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   ++     +H AA+ G      LLL Y     I     I         M   AV        Q +L      + ++ + +LL     G+L        +T+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  369 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQ----AAREADLAKV----KKTLALEIINFKQPQSH-ETALHCA--------------------------VASLHPKRK-QVAELLLRKGANVNEKNKDFMTPLHVAA-----ERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSI-----ISLQGFTAAQMGNEAV--------QQILSESTPMRTSDVDYRLLEASKAGDL--------ETVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 730          

HSP 3 Score: 70.0922 bits (170), Expect = 1.205e-10
Identity = 87/323 (26.93%), Postives = 132/323 (40.87%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            LL+AS + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++         P  IN R    + ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  647 LLEASKAGDLETVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-------TPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 947          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O95271|TNKS1_HUMAN (Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.175e-19
Identity = 112/403 (27.79%), Postives = 182/403 (45.16%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            G   LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N             G+  V     D   + +++E L  E       S+   A     A   + L     NFK+ ++++   +     L          +  LL + GA++N++      T LH+AA    + D+M +L + GA +NA D    T L  +     LQ+ +++++
Sbjct:  249 GLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLVN-----------CHGKSAV-----DMAPTPELRERLTYE---FKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASL----HPKRKQVTELLLRKGANVNEKNKDF-MTPLHVAAERAHN-DVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLS 612          

HSP 2 Score: 75.8702 bits (185), Expect = 2.104e-12
Identity = 107/438 (24.43%), Postives = 175/438 (39.95%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N   ++ +D+  +  L+  +  +FK +S L     +  +  L +V    +  L    IN +       T LH A                          V+ LH     ++  LL+  GA+VN K++D   PLH A      E++  + ++VL   GA +   +      +H AA+ G      LLL Y     I     I         M   AV        Q +L      + ++ + +LL     G+L        +T+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  376 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQ----AAREADLAKV----KKTLALEIINFKQPQSH-ETALHCA--------------------------VASLHPKRK-QVTELLLRKGANVNEKNKDFMTPLHVA-----AERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSI-----ISLQGFTAAQMGNEAV--------QQILSESTPIRTSDVDYRLLEASKAGDL--------ETVKQLCSSQNVNCRDLEGRH----STPLHFAAGY-NRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 737          

HSP 3 Score: 70.4774 bits (171), Expect = 9.048e-11
Identity = 89/323 (27.55%), Postives = 134/323 (41.49%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNR---------------------------------FKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            LL+AS + D+ T+K    L SS    +N  D E   +T LH AA       V  LL  GADV+A+++                                 +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++         P  IN R    + ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      D+  LL+D
Sbjct:  654 LLEASKAGDLETVK---QLCSSQN--VNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLC-------TPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD---DIRALLID 954          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3H802 (uncharacterized protein LOC106152547 OS=Lingula unguis OX=7574 GN=LOC106152547 PE=4 SV=1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 391/1024 (38.18%), Postives = 609/1024 (59.47%), Query Frame = 3
Query:  114 MSL-AKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIGSFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXXXXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVD----ICESKNEILSSSQLEKNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGE--LVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIR 3164
            MSL  +IH F+AWVNLRL+      + NV++DL    + + LVE  TG  ++ + SF G++Q QK TR EW++KEL + KL+ ED+ ++ +L A R +++ F  L +LV  DI F+W+R E+LQ  + +++    FK +  + P  K KK KVK+ LL+GFG+A+    ++ D+   P      F   + M   K        N P P +CIL ++  HL M+K GK +K   + DL D RVLCA  N+ + +TF+ E+L NDRW++N  L+T EK+   ++ F++ DL   +  ++ AYF    ++ Y+FRQ+  V+   E L   IR     +D    +  +  E+     L++   + N+   E+  +++ FD+++C  W  H+  V  E+ +++  K + ++E + VPR +SI DLC    I       S +Y   N E VN+ RK+ILR+    + I D   K K  +R  L++H    V + PEK  +Y+I+ +S S+NK L    +FLYQ+FP     W K + +A   N+V ++K +   F +  +FIN  +   GNTALH+AA  G ++ V  LLE  A+++ARN +K TPLFSA E     +  +L+E G +++  +++  T  +  K++ LK Y+   ++ YS++   +++G+ +VLEEV+ DH T +  +  +LRSRC+ GSTL+HTAA+F     VK LL LR+DV+ RDYKG +PLHRS ++E + +L+EAGA VN +D + N PLH  CYGE G+++Q+  I++L   G+ L+ RNN+ LMPIHC AMQGR D I+LLL  DK ++I++ L  E   L PPS+  LAV+     CA+WL++ GF FKE E + L++ ++  +  ++  G+A+       L   GA  N  Y P   TALH AA ++ ST+++ +L+  GA+V+A + +  TPLF S   N+  +A V+I N  N   KN  G TAFD I D+ +W+    F++E  ARLKAY+LK TR+ +R I KK++
Sbjct:    1 MSLKTRIHGFTAWVNLRLKPYDI-LMNNVIMDLLTGTNLKLLVESMTGREMKNVKSFDGLTQQQKITRAEWVVKELKACKLVPEDVYVDARLFAMRGADQVFDLLWRLVSHDIWFVWERAEYLQHAEDQVLVAVPFK-WTPEPPPKKRKKTKVKQSLLSGFGAASLVQEDLNDDAPDPNEYYDPFPGSDIMKQLK-PKKIDPKNYPAPDDCILEMVNAHLNMSKDGKKLKCISVDDLMDSRVLCALVNSFVQDTFTPEVLLNDRWTMNLCLRTAEKMFYTETPFDSEDLAEGDPMAVCAYFAFFFMVGYKFRQAKAVVNRIEWLHRLIRENNHEMDELATVATNIQELRRKKDLKQKLQMYND---EIGRIQDMFDLEYCRKWLDHAIKVQKETHKLIWTKMKEKFETLPVPRNISINDLCLSLSINLSLTFGSAFYLSNNKEQVNELRKMILRNKETGEYIEDFTAKNKEPIRKILRLHAYETVEVNPEKYPQYDIFFESPSRNKRLEAGTEFLYQIFPGTFEQWHKQMFRAIKENEVDSVKKMVLFFRNTPSFINAREKTTGNTALHIAARFGQYEIVQFLLESNANIDARNAYKYTPLFSALEGVHRRVGHLLVECGCDVNKRSIKGLTAFETVKNDELKDYLIEAYEHYSDVVPKIMAGDLEVLEEVVKDHITGVRQLN-SLRSRCVNGSTLIHTAAYFGAVSIVKTLLTLRMDVDLRDYKGATPLHRSQNVETMEVLLEAGASVNAEDLEGNTPLHVKCYGETGKETQLGCIELLCQSGSKLVSRNNRGLMPIHCCAMQGRIDAIQLLLAADKKEEIKKDLSKEDPKL-PPSLPHLAVANDCMECAEWLIENGFEFKEGEPDLLVQRILAEQVKVIQQGEAIK-----FLLDHGASANPVY-PGGNTALHYAASMSHSTEILELLMGYGAEVDAPNEDQATPLFFSTQCNNQSAASVLIENGANYRWKNAQGLTAFDCILDFDDWVECGYFNDEIRARLKAYSLKHTRDLIRAISKKVK 1010          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3II61 (uncharacterized protein LOC106164510 OS=Lingula unguis OX=7574 GN=LOC106164510 PE=4 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 391/1024 (38.18%), Postives = 609/1024 (59.47%), Query Frame = 3
Query:  114 MSL-AKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIGSFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXXXXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVD----ICESKNEILSSSQLEKNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGE--LVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIR 3164
            MSL  +IH F+AWVNLRL+      + NV++DL    + + LVE  TG  ++ + SF G++Q QK TR EW++KEL + KL+ ED+ ++ +L A R +++ F  L +LV  DI F+W+R E+LQ  + +++    FK +  + P  K KK KVK+ LL+GFG+A+    ++ D+   P      F   + M   K        N P P +CIL ++  HL M+K GK +K   + DL D RVLCA  N+ + +TF+ E+L NDRW++N  L+T EK+   ++ F++ DL   +  ++ AYF    ++ Y+FRQ+  V+   E L   IR     +D    +  +  E+     L++   + N+   E+  +++ FD+++C  W  H+  V  E+ +++  K + ++E + VPR +SI DLC    I       S +Y   N E VN+ RK+ILR+    + I D   K K  +R  L++H    V + PEK  +Y+I+ +S S+NK L    +FLYQ+FP     W K + +A   N+V ++K +   F +  +FIN  +   GNTALH+AA  G ++ V  LLE  A+++ARN +K TPLFSA E     +  +L+E G +++  +++  T  +  K++ LK Y+   ++ YS++   +++G+ +VLEEV+ DH T +  +  +LRSRC+ GSTL+HTAA+F     VK LL LR+DV+ RDYKG +PLHRS ++E + +L+EAGA VN +D + N PLH  CYGE G+++Q+  I++L   G+ L+ RNN+ LMPIHC AMQGR D I+LLL  DK ++I++ L  E   L PPS+  LAV+     CA+WL++ GF FKE E + L++ ++  +  ++  G+A+       L   GA  N  Y P   TALH AA ++ ST+++ +L+  GA+V+A + +  TPLF S   N+  +A V+I N  N   KN  G TAFD I D+ +W+    F++E  ARLKAY+LK TR+ +R I KK++
Sbjct:    1 MSLKTRIHGFTAWVNLRLKPYDI-LMNNVIMDLLTGTNLKLLVESMTGREMKNVKSFDGLTQQQKITRAEWVVKELKACKLVPEDVYVDARLFAMRGADQVFDLLWRLVSHDIWFVWERAEYLQHAEDQVLVAVPFK-WTPEPPPKKRKKTKVKQSLLSGFGAASLVQEDLNDDAPDPNEYYDPFPGSDIMKQLK-PKKIDPKNYPAPDDCILEMVNAHLNMSKDGKKLKCISVDDLMDSRVLCALVNSFVQDTFTPEVLLNDRWTMNLCLRTAEKMFYTETPFDSEDLAEGDPMAVCAYFAFFFMVGYKFRQAKAVVNRIEWLHRLIRENNHEMDELATVATNIQELRRKKDLKQKLQMYND---EIGRIQDMFDLEYCRKWLDHAIKVQKETHKLIWTKMKEKFETLPVPRNISINDLCLSLSINLSLTFGSAFYLSNNKEQVNELRKMILRNKETGEYIEDFTAKNKEPIRKILRLHAYETVEVNPEKYPQYDIFFESPSRNKRLEAGTEFLYQIFPGTFEQWHKQMFRAIKENEVDSVKKMVLFFRNTPSFINAREKTTGNTALHIAARFGQYEIVQFLLESNANIDARNAYKYTPLFSALEGVHRRVGHLLVECGCDVNKRSIKGLTAFETVKNDELKDYLIEAYEHYSDVVPKIMAGDLEVLEEVVKDHITGVRQLN-SLRSRCVNGSTLIHTAAYFGAVSIVKTLLTLRMDVDLRDYKGATPLHRSQNVETMEVLLEAGASVNAEDLEGNTPLHVKCYGETGKETQLGCIELLCQSGSKLVSRNNRGLMPIHCCAMQGRIDAIQLLLAADKKEEIKKDLSKEDPKL-PPSLPHLAVANDCMECAEWLIENGFEFKEGEPDLLVQRILAEQVKVIQQGEAIK-----FLLDHGASANPVY-PGGNTALHYAASMSHSTEILELLMGYGAEVDAPNEDQATPLFFSTQCNNQSAASVLIENGANYRWKNAQGLTAFDCILDFDDWVECGYFNDEIRARLKAYSLKHTRDLIRAISKKVK 1010          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210QPB3 (Ankyrin-2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18253 PE=4 SV=1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 385/1045 (36.84%), Postives = 612/1045 (58.56%), Query Frame = 3
Query:  114 MSL-AKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIGSFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXXXXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVDICESKNEILSSSQLEKNRTIINETILE---LDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIE-GKAKSK-VRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFE 3230
            MS+  KI+ ++AWVNLRL +     L N L+DL    H + L+E  TG  ++++ SF  +SQ QK TR+EW++ EL + ++L +D+ I+ +L A R+++  F  L +L+  DI F+W+R E+LQ  D  ++TQ  FK  PE  P  K  K   K  LL+GFGS ++   +  D+     +K   F + E +  +K+        P     CIL ++   LK T+ G+ +  + + D  D RVLCA  N+ +PNTF+ ++L NDRW+IN  L+T EK+   ++ F++ DL   +  ++ +YF   L++ Y++RQ    +   + +   IR    + +I +    + +  +L++ + + NE       L+    RFDI +C+ W  H + V  E +  ++ K + +++++  PR +++ D+C    I       SG+Y   N E + D RK++LR       I D   G+++   VR  LKV   G V + P+   + EI++++ S+NK L     FLYQ+FP N  TW +L +K++  N+  T++ +   F S+ +FIN  + + GNTALH A  +G FD V  LLE GA+V++RN  K TPLF+A E     IC +L+EWG ++   NV+N T  ++ K++  K ++   +  YSE+   ++ G+  +L+EVIH H T  +  F +LRSRCI GSTLLHTAA++    A++EL+ LR+DVN RDYKG + LHR+ + E++ +L+E+GA V+ +D + N PLH  CYGE    S++  I+VLL   ANL  RN + L+PIHC AMQGR DVI L++  D    I +A+  E  +  PPS+  LA++  F  CA+WL   GF FK+ E + LLR ++T ++ L+ +   + +  LL + GAD + RYP    T+LH AA LT S++++ +L++ GA+V+  D+  CTPLF +   N+  +A V+I  N N+  KN+ G TAFDYI D+ EWI+   F ++  ARLKA++LK  R+ +R I KK++      +Q  ++ S L    F+
Sbjct:    1 MSMRTKINGYTAWVNLRL-MPYDQLLNNALMDLLTGTHMKFLLESITGRDIKRLESFDDLSQQQKQTRVEWVMHELKTCQVLPDDVAIDSRLFAMRSADHVFDLLWRLISHDIWFVWERAEYLQHVDMDVLTQIPFKWTPEPPPKKKKSKKPKKS-LLSGFGSGSQAEDDSSDDIMEDWVK---FPNAEWVKNFKKKKREIGNYPSP-DECILEMVNYQLKTTRDGRNLSCHTIDDFVDSRVLCALVNSFVPNTFTTDLLLNDRWTINLALRTAEKMFYAETPFDSEDLVEADPTAVCSYFCFFLMMAYKYRQCKGAVNRVDYISMLIR--ECNHEISKFPAIVSNMQELQRRKEVKNEIEQHKKALEKFNGRFDIPYCKKWMNHVEYVQNEVRRQIREKMKSRFDMITAPRNITVNDICLSCVINLTLTNGSGFYLASNKEVLGDGRKVVLRAKETGDFIDDFSSGRSRGPTVRDILKVADAGVVEIYPDNYPQIEIFVEAQSRNKLLKAGTVFLYQVFPGNTTTWQRLFIKSARENEFETVQKMIVFFHSNPSFINSKEPKTGNTALHWACRNGLFDMVCLLLENGANVDSRNSNKSTPLFAAIEGLHRRICHLLIEWGCDVHCKNVKNLTPFEMIKNDDFKHFLIELYGHYSEIVPKIMEGDMALLDEVIHKHSTH-QKQFCSLRSRCINGSTLLHTAAYYGNVAAIRELMQLRVDVNIRDYKGATALHRARNKEVLEVLLESGASVDAEDGEANTPLHVKCYGETNAPSEIPSIEVLLARNANLARRNMRGLLPIHCCAMQGRVDVIRLMVRADTENNISKAISGED-DKKPPSLLHLAIANDFIECAKWLSTNGFYFKKREQDVLLRRIMTEQVTLNDR--EEAVRFLL-ENGADPSPRYPG-GNTSLHYAAGLTGSSEVLELLLENGAEVDPVDDNGCTPLFFATQANNQFAACVLIEQNANVRHKNSQGLTAFDYIIDFEEWIDCGYFTDDIKARLKAFSLKHARDLVRAISKKVKPNQFHSFQDIRMRSGLSTRSFQ 1031          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267E2G1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030254g2 PE=4 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 376/1029 (36.54%), Postives = 599/1029 (58.21%), Query Frame = 3
Query:  114 MSLA-KIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIG-SFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXX-XXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERK-----FHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVD-ICESKNEILSSSQLEKNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKS---KQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIR 3164
            MSL+ +I  F+AWVNLRL+      L NVL+DL    + +NL+E  TGS  + +G +F  ++Q QK TR EW++KEL  W+++ +   ++ KL AARNSEE F  L +LV  DI FLW+RMEFLQ  +A ++TQ  F   P+      + KKFKV K++L GFG+++     + +      + ++      F   E M  YK  ++  +  P    +C+  ++K HL+MT  G+ ++  KL DL D RV+CA  NA+ PN F+ E+L NDRWS++ +L+T+EKI   +  F+A +L   ++ ++ AYF   L+  Y+FRQ   V+   E L+ + R     ++ +CE    +  S + EK   +I     E  +++ RF++  C      +++ + E +  ++ K + ++EI+Q PR +++  +C    I       + + +L + E + ++R+I+L+   N +   D   K +  VR  L+      + L+P +  +++IY++  SKN  + V E  LYQ+FP     W   LLK +   +   I+ L   FS    FIN+ +    NTALH A   G     L LL+  AD++ARN  K TPLF A E     +C +L+EWG +I   N++  T L+  KS+ L+  + R +++YS     VVSG    L ++I DH TK   + ++++SRC+ GSTLLHTAA+F   L ++ LL L+IDV+ RDYKG   LHR+  +    +L+EAGADV ++D + NQ LH  C+GE+G++SQ++ I+ LL   A+   +N++ LMPIHCAA+QGR DVI LLL +D S     I  +L  E  +  PPS+  L+++GGF  CA WLL +GF+ K++EA+++L  +++GEL +  + L  TL  LL K GAD + ++PP   TALHLAA L++ +D+M +L+  G   +A   +  TPLF +C   +  SA ++I    +   +   G  AFD+I D+ EW+    F ++  AR++AY LK TR+++R + ++++
Sbjct:    1 MSLSSRICGFTAWVNLRLQ-HSDLMLSNVLMDLMSGMYMRNLIESLTGSEFKNLGDTFDRLTQQQKVTRSEWVVKELKRWRIVPDSYQMDFKLFAARNSEEVFELLWELVSHDIWFLWERMEFLQHPEAAVLTQCVFTWIPDPIDVTKQKKKFKVTKNVLGGFGASSMKSQMLKEAGANAEVSDQPDDYEPFPGSELMKKYKSRAAPGAKIPKAL-DCMFQIVKGHLRMTPEGRALRLWKLGDLADTRVICALGNALFPNQFNSEVLLNDRWSLDLVLETMEKIFHFEGCFKAKNLVEGDNRAIAAYFCCFLMAAYKFRQQQMVVLRLEQLKAQTRDAYTDIEFLCEQG--LGDSVEKEKLDKLIQAFQAEKAAIESRFNVAECRDNLNFAQDTLKEMQGKIRDKLKDRFEIVQAPRDMTLNQMCISLMINLSLSNGAAFCKLLDPELILENRRIVLQSKKNGEFYDDFTRKTEVTVRQMLRQPSRDSILLDPAEHPQFDIYVECQSKNSLIGVGESVLYQVFPGTLEIWQNGLLKHAKEGNYHAIQKLITFFSFVPDFINYREPGSLNTALHYACRYGQLRVALQLLQNFADIDARNVHKCTPLFLAVESGNRRVCQLLIEWGCDIHAKNIQKLTALEASKSDELRRNLMRHYQYYSTTVPLVVSGQLQHLSDMIEDHVTKRHEL-VSIQSRCLNGSTLLHTAAYFDHLLLIRRLLKLKIDVSIRDYKGAGVLHRAGSVLGARILLEAGADVQLRDREGNQALHVKCFGEDGKQSQLDLIRFLLDNDASPTSKNDKDLMPIHCAALQGRTDVINLLLTHDASVGGGAILRSLGQES-STHPPSLVCLSLTGGFVECADWLLGKGFDLKQDEASRMLYKLVSGELQIARRFL--TLGFLLDKCGADPSAQFPPDGATALHLAAGLSEGSDMMLLLLDKGGCPDARAGDMATPLFYACRSGNQLSASLLIERGADTKCRAQNGLAAFDHITDFDEWLTCGYFSDQVCARIRAYQLKRTRDSIRGLLRRVK 1021          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8G9Y6 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030254g1 PE=4 SV=1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 375/1029 (36.44%), Postives = 596/1029 (57.92%), Query Frame = 3
Query:  114 MSLA-KIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIG-SFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXX-XXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERK-----FHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVD-ICESKNEILSSSQLEKNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKS---KQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIR 3164
            MSL+ +I  F+AWVNLRL+      L NVL+DL    + +NL+E  TGS  + +G +F  ++Q QK TR EW++KEL  W+++ +   ++ KL AARNSEE F  L +LV  DI FLW+RMEFLQ  +A ++TQ  F   P+      + KKFKV K++L GFG+++     + D      + ++      F   E M  YK  ++  +       +C+  ++K HL+MT  G+ ++  KL DL D RV+CA  NA+ PN F+ E+L NDRWS++ +L+T+EKI   +  F+A +L   ++ ++ AYF   L+  Y+FRQ   V+   E L+ + R     ++ +CE    +  S + EK   +I     E  +++ RF++  C      +++ + E +  ++ K   ++EI+Q PR +++  +C    I       + + +L + E + ++R+I+L+     +   D   K +  VR  L+      + L+P +  +++IY++  SKN  + V E  LYQ+FP     W   LLK +   +   I+ L   FS    FIN+ +    NTALH A   G     L LL+  AD++ARN  K TPLF A E     +C +L+EWG +I   N++  T L+  KS+ L+  + R +++YS     VVSG    L ++I DH TK   + ++++SRC+ GSTLLHTAA+F   L ++ LL L+IDV+ RDYKG   LHR+  +    +L+EAGADV ++D + NQ LH  C+GE+G++SQ++ I+ LL   A+   +N++ LMPIHCAA+QGR DVI LLL +D S     I  +L  E  +  PPS+  L+++GGF  CA WLL +GF+ K++EA+++L  +++GEL +  + L  TL  LL K GAD + ++PP   TALHLAA L++ +D+M +L+  G   +A   +  TPLF +C   +  SA ++I    +   +   G  AFD+I D+ EW+    F ++  AR++AY LK TR+++R + ++++
Sbjct:    1 MSLSSRICGFTAWVNLRLQ-HSDLMLSNVLMDLMSGMYLRNLIESLTGSEFKNLGDTFDRLTQQQKVTRSEWVVKELKRWRIVPDSYQMDFKLFAARNSEEVFELLWELVSHDIWFLWERMEFLQHPEAAVLTQCVFTWIPDPIDITKQKKKFKVTKNVLGGFGASSMKSQMLKDAGANAEVSDQPDDYEPFPGSELMKKYKSRAAPGAKILKAL-DCMFQIVKGHLRMTPEGRALRLWKLGDLADTRVICALGNALFPNQFNSEVLLNDRWSLDLVLETMEKIFHFEGCFKAKNLVEGDNRAIAAYFCCFLMAAYKFRQQQMVVLRLEQLKAQTRDAYTDIEFLCEQG--LGDSVEKEKLDKLIQAFQAEKAAIESRFNVAECRDNLNFAQDTLKEMQGKIRDKLNDRFEIVQAPRDMTLNQMCISLMINLSLSNGAAFCKLLDPELILENRRIVLQSKKTGEFYDDFTRKTEVTVRQMLRQPSRDSILLDPAEHPQFDIYVECQSKNSLIGVGESVLYQVFPGTLEIWQNGLLKHAKEGNYHAIQKLITFFSFVPDFINYREPGSLNTALHYACRYGQLRVALQLLQNFADIDARNVHKCTPLFLAVESGNRRVCQLLIEWGCDIHAKNIQKITALEASKSDELRRNLMRHYQYYSTTVPLVVSGQLQHLSDMIEDHVTKRHEL-VSIQSRCLNGSTLLHTAAYFDHLLLIRRLLKLKIDVSIRDYKGAGVLHRAGSVLGARILLEAGADVQLRDREGNQALHVKCFGEDGKQSQLDLIRFLLDNDASPTSKNDKDLMPIHCAALQGRTDVINLLLTHDASVGGGAILRSLGQES-STHPPSLVCLSLTGGFVECADWLLGKGFDLKQDEASRMLYKLVSGELQIARRFL--TLGFLLDKCGADPSAQFPPDGATALHLAAGLSEGSDMMLLLLDKGGCPDARAGDMATPLFYACRSGNQLSASLLIERGADTKCRAQNGLAAFDHITDFDEWLTCGYFSDQVCARIRAYQLKRTRDSIRGLLRRVK 1021          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 105.531 bits (262), Expect = 2.012e-22
Identity = 116/412 (28.16%), Postives = 188/412 (45.63%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRC----IQGSTLLHTAAHFSKTLAVKELLMLR-IDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            ++ GNTALH+AA+ G    V  L+  GA+VNA+++   TPL+ AA+ +   +   LLE GA        NQ++    K +++       F  Y       +S N                   I L++ C      G T LH AAH+ + L V +LL+ R  +VN     G++PLH   R  ++ ++ LL++ GA ++ K +D   PLH  C    G    +  I++LL +GA +  +    L PIH AA     D +  LL Y+         EI+ + L   +   +A   G    A+ LLD+G   K N         + G   LH     + L +  LL K  A + +       T LH+A+ +    +++ IL+Q GA  NA++ +  TPL ++      + A+ ++
Sbjct:   73 TKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGA--------NQSIPTEVKPSAVSLANSYSFPLY-------LSTNAS----------------HITLKNVCSFITATGFTPLHIAAHY-ENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLH--CAARNG---HVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA--------EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKG--AKPNT------RALNGFTPLHIACKKNHLRVMDLLLKHSASL-EAVTESGLTPLHVASFM-GHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLL 429          

HSP 2 Score: 88.5817 bits (218), Expect = 3.277e-17
Identity = 108/439 (24.60%), Postives = 187/439 (42.60%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSR----CIQGSTLLHTAAHFSKTLAVKELLMLR-IDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            KN++    LLLK S+S +  T                    E G T LH+A+  GH + V  LL+ GA  NA N   +TPL  A+      +   LL+  A +      +QT L        K  ++   +  +  +    +G+   L     +  T+   I +++ ++      +G T LH AA + K + V ELL+ R  + N     G++PLH     ++L+++NLL+  G   +    +   PLH A      +++Q+E    LL  GA+    + Q + P+H AA +GR D++ LL+    +  +     +  L+L+           G    A  L+ +G +     A ++      G   LH       + ++  L +  A++N +      T LH AA     TD++ +L++ GA  N       + L I+
Sbjct:  353 KNHLRVMDLLLKHSASLEAVT--------------------ESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTP-LHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGK-VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIA-----SKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLV--------AQEGHVGIADILVKQGASVY--AATRM------GYTPLHVACHYGNIKMVKFLLQQQANVNGKT-RAGYTPLHQAAQ-QGHTDIVTLLLKHGAQPNEITTNGTSALAIA 746          

HSP 3 Score: 88.1965 bits (217), Expect = 3.883e-17
Identity = 118/460 (25.65%), Postives = 185/460 (40.22%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWH----------------DSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITG-ELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC--SRNDLQS 2969
            + NV   +LLL   ++ D  T   LT L  + +   N H                 ++ G + +H+AA   H D V  LL+  A+++       TPL  AA      +  +LL+ GA+ +   +   T L I CK N L+                          +++  H   LE +          G T LH A+       VK LL      N  + K  +PLH   R+   E+   L++  A V+ K +D+   LH  C    G K   E +K+LL   AN          P+H AA +G    + +LLD +  +      ++ K    P     +A   G    A+ LL+RG N      N   +N +T   + +H   L D +NLL+ K G+  +        T LH+A+   +  ++   L+Q GA  NA   +  TPL ++    R D+ S
Sbjct:  221 RGNVIMVRLLLDRGATIDAKTKDELTPLHCAAR---NGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVM------------------------DLLLKHSASLEAV-------TESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLH--CAARMGHK---ELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQT-----KMTKKGFTP---LHVAAKYGKVDVAELLLERGAN-----PNAAGKNGLTPLHVAVHHNNL-DVVNLLVSKGGSPHSAAR--NGYTPLHIASK-QNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVS 624          

HSP 4 Score: 83.1889 bits (204), Expect = 1.487e-15
Identity = 102/430 (23.72%), Postives = 169/430 (39.30%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYD-----KSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQAL---NDTLNLLLYKTGADINKRYPPMSQ---TALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAF 3035
            G T LH+A+  G+   V  LL+ GA ++A+ + + TPL  AA      I  ILL+ GA I        + + +         + +  ++ +E+            +++  DH T L                  H AAH       K LL      N R   G +PLH   + + L +++LL++  A +    E    PLH A +        +  +K+LL +GA+    N +   P+H A+  G  +V E LL        K+K  Q +L               A   G     + LL+   N               G   LH  A      T+ +LL     D+N +   M++   T LH+AA      D+  +L++ GA+ NA      TPL ++   N+L    ++++   + +     G+T  
Sbjct:  211 GITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI------------DDITLDHLTPL------------------HVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASF-----MGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHC-------------AARMGHKELVKLLLEHKANPNST--------TTAGHTPLHIAAREGHTQTVRILL-----DMNAQQTKMTKKGFTPLHVAAKY-GKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPL 578          

HSP 5 Score: 82.0333 bits (201), Expect = 2.761e-15
Identity = 102/396 (25.76%), Postives = 162/396 (40.91%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIH-----DHRTKLEPIF---INLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            G T LH+A    H   +  LL+  A + A      TPL  A+ M   NI  ILL+ GA  + +NV+ +T L +    S   + E         +       DD  +  +H      H+  ++ +     N  S    G T LH AA    T  V+ LL +     +   KG +PLH   +   +++  LL+E GA+ N   ++   PLH A +      + ++ + +L+ +G +          P+H A+ Q + +V   LL Y  S   +    +  L+        LA   G A     L+ +  N   N  N+      +G   LH  A    + +  +L K GA +      M  T LH+A H  +   + F L+Q  A+VN       TPL
Sbjct:  343 GFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMA---SRAGHCEVAEFLLQNAAPVDAKAKDD--QTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVH-----HNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLH--------LAAQEGRADMVSLLISKQANV--NLGNK------SGLTPLHLVAQEGHVGIADILVKQGASVYAAT-RMGYTPLHVACHYGNIKMVKF-LLQQQANVNGKTRAGYTPL 710          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: tnksb (tankyrase-1 [Source:NCBI gene;Acc:103045612])

HSP 1 Score: 97.0561 bits (240), Expect = 6.627e-20
Identity = 119/403 (29.53%), Postives = 178/403 (44.17%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALE--IEKLNLIP--------PSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD 2900
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+ +  N   ++ LD+    S K  +  ++K   EL     SGN+D L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      I  A      D  +L  ++     +Q A E  + K+   P        P  +  A+    AS         + LL +G N  +       ++ +T   V   +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD
Sbjct:  135 QTGANVHSRDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADP-SAKTVLTGEYK-KDELLEAARSGNEDKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSHGADPTLLNCHSKSAIDLAPTPELRD--KLTYEFKGHSLLQAAREGDLAKVKKTPQEIISFKHPHSHDSALHCVVASPHPKRKQVTELLLRKGANIHDKN-----KDFMTPFHVAAERAHNDVLE-VLQKHGAKVNA-VDTLGQTALHRAA-LAGHIQTCRLLLSYGAD 513          

HSP 2 Score: 69.3218 bits (168), Expect = 2.285e-11
Identity = 67/251 (26.69%), Postives = 119/251 (47.41%), Query Frame = 3
Query: 2250 DVNQRDYKG--VSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            +VN +D  G   +PLH ++     +++  L++ GA+V+ +D+    PLH+AC +G        E + +LL +GA+   R+N    P+H AA++G+ DV  +LL +     I+       L+L  PS   +                   +K++E  +  R+    +L+    AL   LN+  + +  D  K  P      LHLAA   +   ++ +L+Q GADV+A D     PL  +CS    +  ++++
Sbjct:  104 NVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHSRDDGGLIPLHNACSFG------HAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKTVLTG---------------EYKKDELLEAARSGNEDKLM----ALLTPLNVNCHAS--DGRKSTP------LHLAAGY-NRVRIVQLLLQYGADVHAKDKGGLVPLHNACSYGHYEVTELLL 320          

HSP 3 Score: 65.4698 bits (158), Expect = 3.742e-10
Identity = 105/449 (23.39%), Postives = 176/449 (39.20%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDR---------GFNFKENEAN---QLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N  +++ +D+  +  L+  +  +FK +S L     +  +  L +V    +T  E I            +  H  +H S    V                  SP  +    ++  LL+  GA+++ K++D   P H A      E++  + ++VL   GA +   +      +H AA+ G      LLL Y     I        ++L      F A   G  +  Q L            G N     ++   + L     G+L        DT+  L         D+  R+     T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  274 AAGYNRVRIVQLLLQYGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSAIDLAPTPELRDKLTYEFKGHSLLQ----AAREGDLAKV---KKTPQEII------------SFKHPHSHDSALHCVV----------------ASPHPKRK--QVTELLLRKGANIHDKNKDFMTPFHVAA-----ERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCRLLLSYGADPSI--------VSL----QGFTAAQMGNEAVQQILSGEESVIPVHMAGENVPARNSDVDYRFLEAAKAGDL--------DTVKQLCSPQNVNCRDLEGRH----STPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 646          

HSP 4 Score: 65.0846 bits (157), Expect = 4.395e-10
Identity = 83/312 (26.60%), Postives = 143/312 (45.83%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHDSE-MGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKG--VSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQF-LMPIHCAAMQGRFDVIELLLDYD-----KSKQIQEALEI 2582
             L+A+ + D+ T+K L          +N  D E   +T LH AA       V  LL  GADV+A+++    PL +A       +  +L+  GA ++ A++   T L    +       +   K  ++ S     GN  +  +++ D  T ++ +        ++G   L  AA     LA  + L    ++N RD +G   +PLH ++   +LE+   L+E GADVN +D+    PLH +A YG          I  LL++    +   +++   P+H AA +GR  +  LLL +      K+++ Q AL++
Sbjct:  563 FLEAAKAGDLDTVKQLCS-----PQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPSKKNRDGN--MALDMVKDGDTDIQDL--------LRGDAALLDAAK-KGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGH-------VDIAALLIKFNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTALDL 851          

HSP 5 Score: 56.225 bits (134), Expect = 2.295e-7
Identity = 96/414 (23.19%), Postives = 163/414 (39.37%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--KENEANQLLRNVITGELVLHGQALNDTLNLLLYKTG--ADINKRYPP----------MSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T  H+AA   H D +  L + GA VNA +   QT L  AA       C +LL +GA+ S  +++  T                  +  +E    ++SG + V+            P+                        +A + +     DV+ R  +      ++ DL+ +  L     +VN +D +     PLH +A Y      +++  ++ LL  GA++  ++   L+P+H A   G ++V ELL+ +  S  + +  +   L+         A  G +  C + LL  G +   K  + N  L  V  G+  +      D   L   K G  A + K   P           + T LHLAA   ++ ++   L++ GADVNA D     PL  + S   +  A ++I
Sbjct:  457 TPFHVAAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCRLLLSYGADPSIVSLQGFTAA----------------QMGNEAVQQILSGEESVI------------PVH-----------------------MAGENVPARNSDVDYRFLEAA----KAGDLDTVKQLCSP-QNVNCRDLEGRHSTPLHFAAGY------NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEA-------AAKGKYEIC-KLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGY-NNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI 799          

HSP 6 Score: 51.6026 bits (122), Expect = 6.073e-6
Identity = 30/91 (32.97%), Postives = 48/91 (52.75%), Query Frame = 3
Query: 1764 INWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYI 2036
            +N  D + G   LH AA  GH D    L++    VNA +++  TPL  AA+     +C +LL  GA+ +  N   QT LD+  ++ ++A +
Sbjct:  772 VNAQD-KGGLIPLHNAASYGHVDIAALLIKFNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTALDLATADDIRALL 861          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 96.6709 bits (239), Expect = 8.417e-20
Identity = 112/450 (24.89%), Postives = 191/450 (42.44%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVL---------DICK----SNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLL--DYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGAD---VNATDNEHCTPLFIS 2945
             NN  +  L L A S+N    ++LL +    +   +N    E G + LH+AAI G F     L++ G +++  +R+  TPL  AA+   E +   L+  GA+ +   +     L         D C+    S  L + +    K +   +GF ++  DD                          G T LH AA    T  +  LL    D+N++D  G +PLH ++     + + +L+ AGA+VN  D     PLH +        +    ++ LL  GA+   RN++   P+H +A  G    +ELLL   ++ S   +    +  L+        LA S G   C   LL+ G   +    + + R+V+    V   +  +  + LLL ++ + +   +     T LH+AA +   T+ + +LI +  D    N +D E  TPL ++
Sbjct:  259 PNNRGYTPLHLAAVSTNGALCLELLVN----NGADVNMQSKE-GKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDDF-------------------------GRTCLHAAASGGNTECLNLLLSSGADMNKKDKFGRTPLHYAAANRRYQCVVILVGAGAEVNEPDRSGCTPLHYS----AASTAFCRCVEYLLDNGADPCMRNSKGYSPVHYSAAHGNKQSLELLLVMSFNTSGDAESCGPVSPLH--------LAASAGHWECVNVLLESGMQVE--VCDSVGRSVL---YVASQKGHSRCVELLLSQSASCLFTEHCS-RWTPLHIAA-VNGHTECLQMLISSKEDPDLPNISDTEGQTPLMLA 659          

HSP 2 Score: 85.8853 bits (211), Expect = 1.559e-16
Identity = 107/431 (24.83%), Postives = 182/431 (42.23%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAY-IERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRS-RCIQ--GSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---------------RSSDLEIINL------LIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND---TLNLLL---YKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            G T LH AA  GH D V  LL  GA+++  N F  T L  A  M  E +   L+  GA ++  N R  T L +   ++  A  +E      ++++     G   +    IH   T+ + +  N     C+   G+T LH AA +   L +  L+    D  ++   G+ PLH                S  L  I L      ++ AG D+N  D+     LH+A  G        E + +LL  GA++  ++     P+H AA   R+  + +L+         E  E ++    P  +++ A S  F  C ++LLD G       A+  +RN   G   +H  A +    +L LLL   + T  D     P    + LHLAA      + + +L+++G  V   D+   + L+++  +   +  +++++
Sbjct:  197 GYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDDFGRTCLHAAASG-----GNTECLNLLLSSGADMNKKDKFGRTPLHYAAANRRYQCVVILVGAGA-----EVNEPDRSGCTP--LHYSAASTAFCRCVEYLLDNG-------ADPCMRNS-KGYSPVHYSAAHGNKQSLELLLVMSFNTSGDAESCGP---VSPLHLAAS-AGHWECVNVLLESGMQVEVCDSVGRSVLYVASQKGHSRCVELLLS 603          

HSP 3 Score: 80.1073 bits (196), Expect = 1.031e-14
Identity = 120/465 (25.81%), Postives = 186/465 (40.00%), Query Frame = 3
Query: 1764 INWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELS----------------------------GFVVSGNDDVLEEVIH--DHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLL---------DYDKSKQIQEALEIEKLNLIPPSMN----------------FLAVSGGFASCAQWLLDRG------FNFKENEANQLLRNVIT----GELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            ++W+D E   T LH AA  G    +  L+  G  V+A+     TPL  AA    E   G+LL  GA+++  +   QT L I  +N      +      S L+                            G  +S +D    + IH   +   LE +      + ++G T LH AA       VK LL    ++++ +  G + LH +  +    + N L+  GA+VN  +     PLH A     G       +++L+  GA++  ++ +   P+H AA+ GRF   ++L+         D   +  +  A +     LI   M                  LAV  GF+ C + LL  G       +  +        ++ T    G   LH  A     + LNLLL  +GAD+NK+     +T LH AA        + IL+ AGA+VN  D   CTPL  S
Sbjct:   38 MHWYDQER-RTPLHAAAWLGDVHIMDLLISAGI-VDAQTMCGLTPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVV------KLLRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHLAAVSTNGALC----LELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDDFGRTCLHAAASGGNTECLNLLL-SSGADMNKK-DKFGRTPLHYAA-ANRRYQCVVILVGAGAEVNEPDRSGCTPLHYS 487          

HSP 4 Score: 74.3294 bits (181), Expect = 5.451e-13
Identity = 93/349 (26.65%), Postives = 147/349 (42.12%), Query Frame = 3
Query: 1650 LFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSS--DKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKS-------NSLKAYIERKFK--FYSELSGFVVS------GNDDVLEEVIH---------DHRTKLEPIFINLRSRCIQ------------------GSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD----LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIF---RNNQFLMPIHCAAMQGRFDVIELLLD 2543
            LF ++   W  L + A + +     + L  L SS  D    N  D+E G T L LA +DGH D V  LL+ GA  + ++R  +T L  AA +  E+    LL   A +   +VR +T + +  S       +SL +  +        ++  GF  +      G++D LE V+             T L    IN  S   +                  G T+LH AA       ++ +L +  ++N  D+ G S L  ++D      +  LL  A AD+++ DE+ N  LH AC      K+      ++L E  N +     N+   MP+H AA  G   V++ LL+
Sbjct:  609 LFTEHCSRWTPLHIAAVNGH----TECLQMLISSKEDPDLPNISDTE-GQTPLMLAVLDGHIDCVRLLLDQGACPDGKDRKGRTALHRAALLGWEDCVTALLSHNASVVSRDVRGRTPIHLAASCGHAEILSSLLSAADHSHPQDPITDRHGFTPAHWAAYHGHEDCLEVVLELKPCSIQEGSPFTPLHCALINGHSGSAEMLLNSSFGTSLVNTGDAKGRTVLHAAAVAEDVAGLQLILRMGAEINAVDHAGRSALMVAADKGRSAAVALLLHRAKADLSILDENKNTALHLAC-----SKAHEMCAMLILKEIHNPVLINATNSMLQMPLHIAARNGLATVVQALLN 947          

HSP 5 Score: 58.9214 bits (141), Expect = 3.075e-8
Identity = 68/271 (25.09%), Postives = 106/271 (39.11%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA    T     LL     +N  D  G + LH   +S   E++ LL+  GA ++  D+   QP+H A Y        +E +K+L            +   P+H AA  G  DV++ LL        +   EI++ N    +   +A   G  + A  L++RG N   N+ N                                 N+ Y P     LHLAA  T+    + +L+  GADVN    E  +PL ++        ++++I
Sbjct:  112 TALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAY-----LGHLEVVKLL------------RGYTPLHAAAASGHVDVVKYLL--------RNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANV--NQPN---------------------------------NRGYTP-----LHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILI 317          

HSP 6 Score: 54.299 bits (129), Expect = 7.584e-7
Identity = 107/451 (23.73%), Postives = 178/451 (39.47%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPL-FSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE----RKFKFYSEL--------------------------SGFVVSGNDDVLEEVIH-----DHRTKLEPIFINLRSRCI-----QGSTLLHTAAHFSKTLAVKELLMLRIDV---NQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLD-RGFNFKENEA-NQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            + G T LH AA +  +  V+ L+  GA+VN  +R   TPL +SAA          LL+ GA+    N +  + +    ++  K  +E      F    +                           SG  V   D V   V++      H   +E + ++  + C+        T LH AA    T  ++ L+  + D    N  D +G +PL  +     ++ + LL++ GA  + KD      LH +A  G E      + +  LL   A+++ R+ +   PIH AA  G  +++  LL        Q+ +  ++    P      A   G   C + +L+ +  + +E      L   +I G        LN +    L  TG D   R      T LH AA   D   L  IL + GA++NA D+   + L ++  +   +SA V +
Sbjct:  445 KFGRTPLHYAAANRRYQCVVILVGAGAEVNEPDRSGCTPLHYSAASTAFCRCVEYLLDNGADPCMRNSKGYSPVHYSAAHGNKQSLELLLVMSFNTSGDAESCGPVSPLHLAASAGHWECVNVLLESGMQVEVCDSVGRSVLYVASQKGHSRCVE-LLLSQSASCLFTEHCSRWTPLHIAAVNGHTECLQMLISSKEDPDLPNISDTEGQTPLMLAVLDGHIDCVRLLLDQGACPDGKDRKGRTALHRAALLGWE------DCVTALLSHNASVVSRDVRGRTPIHLAASCGHAEILSSLLSAADHSHPQDPI-TDRHGFTPA---HWAAYHGHEDCLEVVLELKPCSIQEGSPFTPLHCALINGHSGSAEMLLNSSFGTSLVNTG-DAKGR------TVLHAAAVAEDVAGLQLIL-RMGAEINAVDHAGRSALMVAADKG--RSAAVAL 874          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.657e-19
Identity = 119/436 (27.29%), Postives = 189/436 (43.35%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDIC----KSNSLKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLR---IDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVIT------------------------------GELVLHGQALNDTLN--LLLYKTGA--DI-NKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNTALH+A++ G  + V  L++ GAD+NA+++   TPL+ A++ +  ++   LLE G   S A     T L I      +  +   +E   K    L    + +  DD     +   +DH         N   +   G T LH AAH+   + V  LL+ R   +D   R   G++PLH +S   +  ++ LL++ G+ ++ K  D   PLH  C    G  + +E   +LL  GA ++ R    L P+H AA     + ++ LL +   K   + + ++ L  +      +A   G     + LLD+  N     A  LL+N  T                              G   +H  A    LN  LLL + GA  D+ N R     +TALH+AA      +++  L++ GA V+A   E  TPL I+ 
Sbjct:   98 GNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDH---------NADVQSKSGFTPLHIAAHYG-NVNVATLLLNRGAAVDFTAR-QNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLH--CAARSGHDTAVE---LLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQH---KAPVDDVTLDYLTAL-----HVAAHCGHYRVTKLLLDKRAN---PNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR----GETALHMAAR-AGQVEVVRCLLRNGAMVDARAREDQTPLHIAS 501          

HSP 2 Score: 74.3294 bits (181), Expect = 8.373e-13
Identity = 105/428 (24.53%), Postives = 172/428 (40.19%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQ-GSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLME-GANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVIT--GELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAF 3035
            +E G T +H+AA  GH + VL LL+ GA  +  N   +T L  AA      +   LL  GA +      +QT L I         ++   +  +       +G                 P+ I+ R   +   S LL   A  S +LA K              KG +PLH +S    L++  LL++  A  +   ++   PLH A + +       +K+ +LL++ GA+          P+H AA + + ++   LL Y+    I     + K  + P     LA   G +  A  LL +G             NV T  G   LH  A  D + +  +L K GA ++++   +  T L +A H  ++  + F L+++ A VNA      TPL  +  + +     V++      N     G+TA 
Sbjct:  424 TESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNG---------------YTPLHISAREGQLDVASVLLEAGA--SHSLATK--------------KGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDN------QKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNI-----LTKQGVTP---LHLASQEGHSDMAALLLQKGAQV----------NVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQT-KLGYTPLIVACHYGNAKMVNF-LLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTAL 794          

HSP 3 Score: 57.7658 bits (138), Expect = 7.984e-8
Identity = 100/436 (22.94%), Postives = 166/436 (38.07%), Query Frame = 3
Query: 1791 NTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDIC----KSNSLKAYIERKFKFYSE-LSGFV---VSGNDDVLEEVIH------DHRTKLEPIFINLRSRCIQGS------------------TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNN-QPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND-TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL-IQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            NT+   AA  G+ D VL  L+ G D+   N+     L  AA+    ++   LLE G+ +  A  +  T L I     ++  +K  +++     ++  +GF    ++  ++ L+ V +      +  T  E  F  L     QG                     LH AA    T +   LL    + + +   G +PLH ++   ++ +  LL+  GA V+     N   PLH A      ++     +++LL  G+ +  +    L P+HCAA  G    +ELLL+          L   K  L P  M   A  G    C + LL                         H   ++D TL+ L                 TALH+AAH         +L  +A  +  A      TPL I+C +N ++  ++++
Sbjct:   33 NTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVAS-----KRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAP-----ILARTKNGLSPLHM---AAQGDHVECVKHLLQ------------------------HKAPVDDVTLDYL-----------------TALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLV 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000005100.2 (tankyrase-2 [Source:NCBI gene;Acc:103036789])

HSP 1 Score: 94.3597 bits (233), Expect = 4.347e-19
Identity = 75/231 (32.47%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRN 2471
            G  +LH A   GH + V  LL  GAD N+R+ +  TPL  AA     ++C +LL+ GAE++  N   +T LD+ +  + KA +  +++   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D   + PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+  F N
Sbjct:   94 GLVSLHNACSFGHVEVVSHLLRHGADANSRDNWNYTPLHEAAIKGKIDVCIVLLQHGAELTIRNTDGRTALDLAEPFT-KAVLTGEYR-KDELLESARSGNEEKLMSL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRTVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAVDLWRFTPLH-----EAASKNRVEVCSLLLSHGADPTFLN 310          

HSP 2 Score: 69.3218 bits (168), Expect = 2.053e-11
Identity = 104/449 (23.16%), Postives = 176/449 (39.20%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFR--NNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLD-RGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTG-----------ADINKRYPPMSQ-TALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V T++LL     D+ + DK  +           LH A   GH++    L++ GA VNA + ++ TPL  AA  +   +C +LL  GA+ ++ N  N++ +D+  +  LK  +  +F+ ++ L                       E  FI ++                 K L+++ +       ++      + L      +I  +L+  GA++N K  D   PLH A      EKS  + I+VL+   A +  +  ++Q   P+   A  G      LL+                                 A C Q +   +GF +    ANQ ++  +  E VL G    D   L   K+G            ++N R     Q T LH A+     T + + L+Q GADV+A D     PL  +CS    + A++++
Sbjct:  221 AAGYNRVRTVQLLLQHGADVHAKDKGDL---------VPLHNACSYGHYEVTELLVKHGACVNAVDLWRFTPLHEAASKNRVEVCSLLLSHGADPTFLNCHNKSAIDLAPTTLLKERLAYEFRGHALLKAI-------------------RETDFIRIK-----------------KYLSLETINFKHPQTHETALHCAASLSSPKRTQICEMLLRNGANINEKTRDLLTPLHLA-----AEKSHKDVIEVLMKYEAKVPVKTVDSQGQAPLQRVAQCGHLQNCRLLIG--------------------------------AGCDQPITSLQGF-YPAQLANQNIQENLQ-EGVLMGNCDKDRHLLEASKSGDLETVKKLCTLQNVNCRDLEGQQSTPLHFASGYNRVTVVDY-LLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 584          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 2.570e-23
Identity = 115/393 (29.26%), Postives = 184/393 (46.82%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVN 2906
            G   LH A   GH + V  LL  GAD NAR+ +  TPL  AA     ++C +LL+ GA+    N   +T LD+ +  + KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K+++E   +LL  GA+    N      I  A    ++ R         +++   + D ++ +++ L ++ +N   P  +  A+    AS        ++ LL +G N      N+  ++++T   V   +A ND +++LL K GA IN     + QT+LH AAH    T    +L   G D N
Sbjct:  214 GLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTA-KAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLH-----EAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTR-VKKHLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANV-----NEKTKDLLTPLHVASDKAHNDVIDVLL-KHGAKINVT-DSLGQTSLHRAAHAGHLTTCRLLLSH-GCDPN 583          

HSP 2 Score: 83.9593 bits (206), Expect = 1.671e-16
Identity = 110/438 (25.11%), Postives = 176/438 (40.18%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEA-NQLLRNVITGELVLHGQALNDTLNLLLYKTGA---DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    L++ GA VNA + ++ TPL  AA  +   +C +LL +GA+ +  N  +++ +D+  ++ LK  +  +F+ +S L     +   DV     H     L    IN +       T LH A                           SP  +    ++  LL+  GA+VN K +D   PLH A      +K+  + I VLL  GA +   ++     +H AA  G      LLL +     +            P    F A   G  S  Q L +     + ++  +QLL     G+L        DT+  L         D+  R+     T LH AA   +   ++  L+Q GADV+A D     PL  +CS    + A++++
Sbjct:  341 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQ---AAREADVTRVKKH-----LGLDIINFKHPQTH-ETALHCAV-------------------------ASPYPKRK--QVSELLLRKGANVNEKTKDLLTPLHVAS-----DKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNL------------PSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDL--------DTVKQLCTTQTVNCRDMEGRH----STPLHFAAGY-NRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 703          

HSP 3 Score: 77.0258 bits (188), Expect = 2.115e-14
Identity = 87/318 (27.36%), Postives = 138/318 (43.40%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAV 2627
            A+  N V+ ++ L     D+ + DK          G   LH A   GH++    L++ GA VN  + +K TPL  AA      IC +LL+ GA+ +  N    T LD+ K       I+   +  + L      G    ++++            +N R    + ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+  A VN  D+    PLH     E  +K + +   +LL  GA+   +N +   P+  A      DV  LL+D        EAL +      PP++  +A+
Sbjct:  657 AAGYNRVSVVEYLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTD--IQDLLRGDAALLDAAKKGCLARVQKLCSGEN-------VNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATAD---DVRALLID----AMPPEALPVTH---KPPNIPTIAL 941          

HSP 4 Score: 48.521 bits (114), Expect = 9.885e-6
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 3
Query: 2292 RSSDLEIINLLIEAGADVNVKDEDNNQ--PLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCA---QWLLDRGFNFKENE-----ANQLLRNVITGEL----VLHGQALNDTLNLLLYKTGADINKRYP-PMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            R+ D+  +  L+    +VN +D    +  PLH +A +G +      + ++ LL  GAN+  R++  L+P+H A   G  +V+ LLL     +Q  +    +  N  P  ++  A+ G    C    Q   D G    + +     A    + V+TGE     +L      +   L+   T  ++N         T LHLAA   +   ++ +L+Q GADV+A D     PL  +CS    +  ++++
Sbjct:  156 RNGDVGRVKRLVSP-LNVNARDTTGRKSTPLHFAAGFGRK------DVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLL-----RQGADPNARDNWNYTP--LHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGY-NRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLV 387          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 4.557e-23
Identity = 115/416 (27.64%), Postives = 186/416 (44.71%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEK-IKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            +++GNTALH+AA+ G  D V  L+E GA++NA+++   TPL+ AA+ +   I   LL+ GA  S A     T L +         +   +E   K    L    + +  DD     +   H+H   +    + L      G T LH AAH+        LL L   V+     G++PLH   +  +  ++ LL++ GA ++ K  D   PLH A       +S  EK I++LL   A ++ +    L P+H A        ++LLL        Q  ++   L+ + P    +A   G    A+ LLDRG      E N      + G   LH     + + +  LL K GA I+        T +H+A+ +    +++ +L+Q GA  NAT+    TPL ++     L+  K ++
Sbjct:   73 TKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMM-LNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAA------RSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR------QAPVDDVTLDYLTPL--HVAAHCGHYRVAKLLLDRG-----GEPNA---RALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTES-GLTPIHVASFM-GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 463          

HSP 2 Score: 85.1149 bits (209), Expect = 6.052e-17
Identity = 82/306 (26.80%), Postives = 132/306 (43.14%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFIN---LRSRCIQGSTLLHTAAHFSKTLAVKELLMLR-IDVNQRDYKGVSPLHRSSDLE---IINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKS 2555
            KN +   +LLLK  +S   TT                    E G T +H+A+  GH + V  LL+ GA  NA N   +TPL  A+      +   LL+ GA +      +QT L I         ++   +  S+ +    SG+  +       H      +  N   +     +G T LH A+ + + L V  LL+ +    + +   G++PLH ++  +   +  LL++ GA  +   ++   PLH A      +K+Q+E  KVLL  GA       Q + P+H AA +G  D++ LLL    S
Sbjct:  387 KNRIKVMELLLKHGASIHTTT--------------------ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGR-LEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAA-----KKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS 666          

HSP 3 Score: 69.707 bits (169), Expect = 2.900e-12
Identity = 113/436 (25.92%), Postives = 174/436 (39.91%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRC---IQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADIN--------------------------KRYPPMS------QTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQ 2966
            G + LH+A    H   V  LL   A V+       TPL  AA      +  +LL+ G E +   +   T L I CK N +K  +E   K  + +     SG   +       H   ++ +  N  S     ++G T LH A+   +   VK LL    R+ V  R+ +  +PLH +S L   EI+ LL++ G+D N      + PL+ A     G+ + +     LL  GA++     +   P+H A+  GR +V  LLL+   S   +      K  L P     +A        A  LLD+G +      N        G   LH  A  + L +  +L + GA+ N                           R+  +S       TA+HLAA   D  ++  IL +  ADVN T     TPL ++    +++
Sbjct:  311 GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIK-VMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQ--TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASL-----LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK-----GKNGLTPL---HVATHYDHQKVALLLLDKGASPHSTAKN--------GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQ-EDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIK 721          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 2.967e-22
Identity = 115/416 (27.64%), Postives = 184/416 (44.23%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIERKFKFYSELSGF-VVSGNDDVLEEVI---HDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEK-IKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            +++GNTALH+AA+ G  D V  L+E GA++NA+++   TPL+ AA+ +   I   LL+ GA  S A     T L +         +   +E   K    L    + +  DD     +   H+H         N       G T LH AAH+        LL L   V+     G++PLH   +  +  ++ LL++ GA ++ K  D   PLH A       +S  EK I++LL   A ++ +    L P+H A        ++LLL        Q  ++   L+ + P    +A   G    A+ LLDRG      E N      + G   LH     + + +  LL K GA I+        T +H+A+ +    +++ +L+Q GA  NAT+    TPL ++     L+  K ++
Sbjct:   74 TKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEH---------NADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAA------RSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR------QAPVDDVTLDYLTPL--HVAAHCGHYRVAKLLLDRG-----GEPNA---RALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTES-GLTPIHVASFM-GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 456          

HSP 2 Score: 83.1889 bits (204), Expect = 2.043e-16
Identity = 83/308 (26.95%), Postives = 131/308 (42.53%), Query Frame = 3
Query: 1659 KNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFIN---LRSRCIQGSTLLHTAAHFSKTLAVKELLMLR---IDVNQRDYKGVSPLHRSSDLE---IINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKS 2555
            KN +   +LLLK  +S   TT                    E G T +H+A+  GH + V  LL+ GA  NA N   +TPL  A+      +   LL+ GA +      +QT L I         ++   +  S+ +    SG+  +       H      +  N   +     +G T LH A+ + + L V  LL+ +    D       G++PLH ++  +   +  LL++ GA  +   ++   PLH A      +K+Q+E  KVLL  GA       Q + P+H AA +G  D++ LLL    S
Sbjct:  380 KNRIKVMELLLKHGASIHTTT--------------------ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGR-LEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAA-----KKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS 661          

HSP 3 Score: 70.4774 bits (171), Expect = 1.612e-12
Identity = 113/436 (25.92%), Postives = 176/436 (40.37%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDI-CKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRC---IQGSTLLHTAAHFSKTLAVKELLM--LRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADIN--------------------------KRYPPMS------QTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQ 2966
            G + LH+A    H   V  LL   A V+       TPL  AA      +  +LL+ G E +   +   T L I CK N +K  +E   K  + +     SG   +       H   ++ +  N  S     ++G T LH A+   +   VK LL    R+ V  R+ +  +PLH +S L   EI+ LL++ G+D N      + PL+ A     G+ + +     LL  GA++     +   P+H A+  GR +V  LLL+   S   + A +    N + P    +A        A  LLD+G +      N        G   LH  A  + L +  +L + GA+ N                           R+  +S       TA+HLAA   D  ++  IL +  ADVN T     TPL ++    +++
Sbjct:  304 GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIK-VMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQ--TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASL-----LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ----NGLTPL--HVATHYDHQKVALLLLDKGASPHSTAKN--------GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQ-EDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIK 716          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.911e-21
Identity = 117/442 (26.47%), Postives = 191/442 (43.21%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRG--FNFKENEANQLLRNVIT-----------GELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            W   L  A+++  V   + +  + SS            G TALH AA +GH + V  L+  GA++NA ++  +  +  AA M    +  +L+  GA++             CK            K YS L     SG   V++ ++         + +++      G+T LH A +  + + V EL+    +VNQ + +G +PLH     +     + LL+  GADVNV+ +D   PLH +A +G      +  + + L+  G  +   +     P+H AA  G     ELL++      I    +  K  +       LA   GF+ C + LL  G  ++   + +N+   +V++           G   LH  A     + LNLLL  TGAD+NK+     +TALH AA    +   +  L+ +GA +N  D   CTPL
Sbjct:  105 WQTPLHVAAANRAVKCAEAIIPMLSSSNV-----SDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVR------------CKDK----------KGYSPLHAASSSGQIGVVKLLLD--------LGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHG------RFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGH----ELLIN----TLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNE---HVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLL-STGADMNKK-DRFERTALHYAA-ANCNVQCVVTLVASGARLNEQDERRCTPL 491          

HSP 2 Score: 75.0998 bits (183), Expect = 6.839e-14
Identity = 100/390 (25.64%), Postives = 166/390 (42.56%), Query Frame = 3
Query: 1809 AAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLD-ICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            A  +G  D V  L+    +VNA +  K+TPL +AA +    I  +L+  GA ++  + +  T L   C S S +A ++   K  ++                            +N R +  Q  T LH AA        + ++ +    N  D  G + LH ++     E++N L+  GA++N  D+ + + +H A Y         E +KVL+  GA++  ++ +   P+H A+  G+  V++LLLD          ++I+  N    +   +A   G       L+D G N   N+AN+       G   LH  A +    L   LL   GAD+N +      P+  TA+H     T S      LIQ G +++  D +  TPL I+
Sbjct:   13 AIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRS-EAAVQTLLKHSAD----------------------------VNARDKNWQ--TPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAY-----MGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDL--------GVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANV--NQANE------RGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVH--GRFTRSQ----TLIQNGGEIDCEDRDGNTPLHIA 344          

HSP 3 Score: 62.003 bits (149), Expect = 8.503e-10
Identity = 77/299 (25.75%), Postives = 128/299 (42.81%), Query Frame = 3
Query: 1686 LLKASSSNDVTTIKLLTDLFSSDKTFINWHD-SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENIC-GILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFIN---LRSRCIQGSTLLHTAA--HFS----------------KTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA 2504
            L  ASSS  +  +KLL DL       ++  D +  GNTALH+A  +G    V  L++CGA+VN  N    TPL  AA      +C  +L+  GA+++  +   ++ L +   +      +   +   E+      GN  +     + H   +  +  N      R I G   LH AA   FS                 + + + +L    +++  D  G + LH ++   ++E +NLL+  GAD+N KD      LH A          ++ +  L+  GA L  ++ +   P+H AA
Sbjct:  208 LHAASSSGQIGVVKLLLDLG------VDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYA-----AANCNVQCVVTLVASGARLNEQDERRCTPLHYAA 495          

HSP 4 Score: 61.2326 bits (147), Expect = 1.174e-9
Identity = 108/463 (23.33%), Postives = 169/463 (36.50%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVL---------DICK---SNSLKAYIERKFKFYSELS-GFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQME-----KIKV-------------------LLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQI-------------------QEALEIEKLNLIPPSMN--------FLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKT-------GADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            S+ G + LH+ A+ G F     L++ G +++  +R   TPL  AA    E +   L+  GA+ +   +     L         D C+   S   K  I   F     LS GF +   D+                          G T LH AA       +  LL    D+N++D    + LH ++   +++ +  L+ +GA +N +DE    PLH A    +G+ S +       I V                   LL + A+   ++ Q   P+H AA  G    +ELLL+   + Q                      ALE+   +L+   +          LA   G   C + L+  G       A+ LL+        LH  A N   + L LL+           +D N++ P M              TD   +L+  GA +NA DN+ CT L
Sbjct:  301 SKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEF-------------------------GRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYA-AAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHG-------ASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVG-------NGHTDCASLLLSKGASINAKDNKGCTAL 723          

HSP 5 Score: 59.3066 bits (142), Expect = 5.132e-9
Identity = 67/268 (25.00%), Postives = 113/268 (42.16%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNAR-NRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEA----GADVNVKDEDNNQPLHSACY-GEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQI 2564
            G T L LAA+ GH D V  L++ GA V  +    ++T L SAA         +L+E        N  +   +D   +N     +      +++ +  ++S                 +   IN +    +G T LH  A       V  LL   +DV+ R+ +G +PLH ++    + I++ L++A    GA + + D +   PLH ACY G +G    + ++ V   +  N          P+HCA +       E+L+D   +K I
Sbjct:  616 GYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVE--------NADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLS-----------------KGASINAKDN--KGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGN-------AFSPLHCAVLNDNESCAEMLIDTFGAKII 849          

HSP 6 Score: 56.9954 bits (136), Expect = 2.548e-8
Identity = 71/277 (25.63%), Postives = 118/277 (42.60%), Query Frame = 3
Query: 2223 VKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAF 3035
            V+ L+  + +VN  D +  +PLH ++ L   EII LL+ +GA VN KD     PLH AC      +S+   ++ LL   A++  R+  +  P+H AA        E ++    S  +                                 DR                  G   LH  A N   + +N L+ K GA+IN  +    + A+H AA++   T+++ +L+  GADV   D +  +PL  + S   +   K+++   V+I+  N+ G+TA 
Sbjct:   22 VRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRAC----ASRSEA-AVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVS--------------------------------DR-----------------AGRTALHHAAFNGHSEMVNFLVAK-GANINA-FDKKDRRAIHWAAYM-GHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTAL 241          

HSP 7 Score: 55.0694 bits (131), Expect = 9.087e-8
Identity = 84/317 (26.50%), Postives = 128/317 (40.38%), Query Frame = 3
Query: 1689 LKASSSNDVTTIKLL-----TDLFS---SDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEW----GAEISWANVRNQTVLDICKSNSLKAYIE----------RKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPL------HRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKS 2555
            + AS +N+ T + L      TD  S   S    IN  D++ G TALH  A  GH + V  LL+   DV+ R R  + PL  AA      I   L++     GA I   +    T L     N     +E          ++   +S L   V++ N+   E +I     K+    IN      +G   LH AA       ++ LL     VN  D  G SPL       +++ +E+  L+     D+ ++D + N  LH AC       + +   K+  +   N    N     P+H AA  G   V+++LL+   S
Sbjct:  679 VDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNK-GCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKI----INCPD--AKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEV--LVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINAT--NAALQTPLHLAARSGMATVVQVLLNKGAS 984          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.160e-19
Identity = 92/349 (26.36%), Postives = 154/349 (44.13%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHR----TKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLM-LRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENE 2693
            W   L  AS++  +     L  L S+    +N  D   G TALH AA +G+ + V  L+  GA+VNA ++ ++  +  A  M    +  +LL  GA+++W + +  T L    ++     +       +E++ F   GN   L    H+ +    ++L     +   R  +G T LH AA  +      ELL+    DVN + Y G SPLH ++          LI+ G +++  D++ N PLH +A YG E        I  L+  GA+   R +  + P+H AA+ G  D    LL            +++ ++    +    A +GG A C   LL  G +  + +
Sbjct:   14 WQTPLHVASANRAIKCADALIPLLSN----VNVSD-RAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGN-TALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHE------LLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLL--------TPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKD 342          

HSP 2 Score: 71.2478 bits (173), Expect = 9.270e-13
Identity = 76/266 (28.57%), Postives = 115/266 (43.23%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKE-NEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRY----PPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            T LH A+          L+ L  +VN  D  G + LH ++   +LE++NLLI  GA+VN  D+   + +H A Y         E +K+LL  GA++ +++ +   P+H AA  G   V+ LLL            E+ + N    +   +A   G  +    LLD G +    NE          G   LH  A +    +   LL    AD+N +      P+  TA+H     T S      LIQ G +++  D E  TPL I+
Sbjct:   16 TPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGY-----MGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKA--------EMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNE---------RGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIH--GRFTRSQ----TLIQNGGEIDCGDKEGNTPLHIA 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 51.9878 bits (123), Expect = 5.351e-7
Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 3
Query: 1764 INWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARN--RFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLD 2003
            IN  D+  GNTALH AA+ GH + V  L+E GADVN ++   F  TPL  A+     ++   LL+ GA+ +  N +  T  +
Sbjct:  357 INDQDN-AGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 68.9366 bits (167), Expect = 5.144e-13
Identity = 70/242 (28.93%), Postives = 115/242 (47.52%), Query Frame = 3
Query: 2253 VNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQS 2969
            +N+ D  G S LH   R + +E +  LI  G+      ED + PLH AC     +K  ME  ++L+ +GA L  +N++   P+H AA  G FD ++ LL         + + I++ +    +    AV+ G    A  LL++     EN+ + L      G   LH +AL         + G   N+R     Q+ALH+AA L+    ++  L++ GAD+NA D+   TPL  +     +++
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSI-----EDLSTPLHVAC-----KKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLL--------SKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK----DENQKSPLHLACAAGR-ALHVEALT--------RAGLSTNERDEE-GQSALHMAA-LSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKT 209          

HSP 2 Score: 50.0618 bits (118), Expect = 1.203e-6
Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEI 1967
            E G +ALH+AA+ G    V  LL  GAD+NAR+  + TPL  AA+      C  LL+ GA I
Sbjct:  159 EEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 65.855 bits (159), Expect = 1.792e-11
Identity = 65/230 (28.26%), Postives = 111/230 (48.26%), Query Frame = 3
Query: 1683 LLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEV-IHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDL---EIINLLIEAGADVNVKDE 2360
            + L A SS DV  +K L     +    IN+ + + G TALH A ID +FD V  L++ GA ++ R+    T L +AA      I   L+E GA+++  N   +  LD+ +   ++  +  +     E  G  V     V E++ ++D ++ L    IN  S+    ++ LH A+       +  LL L +++N +D    +PLH ++     +   LL E GAD N +++
Sbjct:   52 VFLSAVSSGDVDEVKKLL----AKGADINYQNVD-GLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEI----ENQGIDVDDARAVEEKIMLNDAQSWLNKNCIN-ESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL14])

HSP 1 Score: 58.9214 bits (141), Expect = 1.071e-10
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 2232 LLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQ 2510
            +L  R++VNQ +  GV+ LH SS       +N+L++ GADV+ +D +   PLH+A  G   + +       LL +GAN+  +N+  L PIH A  Q
Sbjct:    1 ILSGRVNVNQLNASGVTALHESSYEGKSRCVNVLVQLGADVDCRDREGWTPLHAAVCGGNHKCAAY-----LLRQGANVRAKNDDGLSPIHIAVQQ 91          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ9])

HSP 1 Score: 52.7582 bits (125), Expect = 1.925e-8
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = 3
Query: 1680 KLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQ 1991
            +LL+K  S+ + TT     D+F              G TALH AA  GH + +  L+  GAD++ R+   QTPLF A   D +    +LL  GA ++  + RN+
Sbjct:   16 RLLIKKGSNLEATTDMDAHDMF--------------GRTALHYAAQQGHMEMIKLLVTRGADIHTRDSEGQTPLFQATIFDQKEAVNVLLLHGACVNAFDHRNR 105          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 51.9878 bits (123), Expect = 2.944e-8
Identity = 29/80 (36.25%), Postives = 43/80 (53.75%), Query Frame = 3
Query: 2307 EIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDY 2546
            E++   I  GAD   KD     PLH AC      + ++E +KVL+  GA++   +N  + P+H AA  G  +V+ LLL Y
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEAC-----ARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTY 75          

HSP 2 Score: 49.2914 bits (116), Expect = 2.873e-7
Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 2223 VKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGAN 2456
            VK+ ++   D   +D  G +PLH +     LE++ +L++ GADVN    D  +PLH A      E   +E +++LL  GA+
Sbjct:    3 VKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDA-----AEGGHVEVLRLLLTYGAD 78          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 107.457 bits (267), Expect = 4.618e-23
Identity = 125/481 (25.99%), Postives = 212/481 (44.07%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEET 3092
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  G+++NA ++  +  +  AA M    +  +L   GAE++  + ++ T L    S+ + + +    KF  +L                           +++      G+T LH A +  + + V EL+     VNQ + KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G   +I  L+  +++   +  +      + P  ++  A+S GF+ C + LL  GF+    +          G   LH  A         LL  TGAD N++     +T LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++N G+ A  Y   Y   +  +L   ET
Sbjct:  107 WQTPLHIAAANKAVRCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVV----KFLLDLG--------------------------VDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLIT-NRADTAKRGIH----GMFP--LHLAALS-GFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNRK-DSFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASET 528          

HSP 2 Score: 70.8626 bits (172), Expect = 6.547e-12
Identity = 103/423 (24.35%), Postives = 179/423 (42.32%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFIN---LRSRCI------------QGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLL--DRGFNFKENEANQLLR--NVITGELVLHGQALNDTLNLLLYKTGADI----NKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA  G    V  LL+ G D+N  N +  TPL  A     + +   L+E GA ++  N +    L    ++       R      EL   V +G D  ++    D +T L    I+    RS+ I             G+T LH AA +   L +  L+  R D  +R   G+ PLH    S   +    L+ +G D++  D+     LH+A  G       +E + +LL  GA+   +++    P+H AA    +  +  L+    S       ++++    P  +++ A S     C ++LL  D     ++N+    +   +     L L   A    L++L+  +G DI    + R P    + LHLAA+       M +L+Q+  D++  +++  TPL ++  +  ++   V+I
Sbjct:  208 TPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAAS-------RHGALCLEL--LVCNGADVNIKS--KDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAG-----GNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVN-----DLDERGCTP--LHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAP---VSPLHLAAY-HGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLI 603          

HSP 3 Score: 67.781 bits (164), Expect = 6.001e-11
Identity = 74/305 (24.26%), Postives = 121/305 (39.67%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEE----------------------------GEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADIN----KRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +                                  +E +++LL  G+N+   + +    IH AA  G  +V++LL  +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L + GA +N    K + P     LH  A        + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHA--------AASSGMISVVKFLLDLGVDINEPNA--------YGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAP-----LHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAII 326          

HSP 4 Score: 56.9954 bits (136), Expect = 1.398e-7
Identity = 76/277 (27.44%), Postives = 112/277 (40.43%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEIS---------------WANVRNQTVLDICKSNSLKAYIERKFKF--YSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLI-EAGADVNVKDEDNNQPLHSACYGEEGEKSQ----MEKIKVLLMEGANLIFRNNQFL-MPIHCAAMQGRFDVIELLL 2540
            G TALH  A+ GH + +  LL+  A    R+   +TP+  AA      + G LL     +                WA        D C    L+  +  K +   +S L   V+  N+   E +I      L P  +N +    +  T LH AA       ++ LL     VN  D  G SPL  +++      + LL+  A AD+ ++D   N  LH AC   +G ++     +EKI        NLI   N  L  P+H AA  G   V++ LL
Sbjct:  686 GRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGH---DTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLI----DTLGPTIVNAKDG--KNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLAC--SKGHETSALLILEKI-----SDRNLINATNAALQTPLHVAARNGLTVVVQELL 946          

HSP 5 Score: 51.9878 bits (123), Expect = 4.116e-6
Identity = 99/402 (24.63%), Postives = 162/402 (40.30%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARN-RFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVN----VKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL--IQAGADVNATDNEHCTPLFISCSRNDL 2963
            G T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA  +  + C  LL   A++       Q+ +DI   N             + L   V+SG+ D +  +++   +        + ++   G T LH  A       ++ LL        RD +G +P+H ++    + ++  L+ A   V     + D     PLH ACY   G  + +E   VLL +        N F  P+HCA ++      E+L+D      +       +  L        A       C Q LL         +A      ++  E   +GQ   + + LL+    AD+  +   +  TALHLA      T  + IL  I     +NAT+    TPL ++ +RN L
Sbjct:  583 GRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAA-TNGHSECLRLLIGNADL-------QSAVDIQDGNG-----------QTPLMLAVLSGHTDCVYSLLNKGAS--------VEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACY--NGHDTCVE---VLLEQEVFHKAEGNPF-SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPL------HAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAE---NGQ--TNAVELLVSSAKADLTIQ-DAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVA-ARNGL 938          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 107.071 bits (266), Expect = 5.918e-23
Identity = 131/507 (25.84%), Postives = 221/507 (43.59%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE----IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALND--TLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL-FISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIRSK 3170
            W   L  A+++  V   + L  L S+    +N  D   G TALH AA  GH + V  LL  G+++NA ++  +  +  AA M    +  +L   GAE++  + ++ T L    S+ + + +    KF  +L                           +++      G+T LH A +  + + V EL+     VNQ + KG +PLH ++        + LL+  GADVN+K +D   PLH +A +G      +  + + ++  GA +   +     P+H AA  G   +I  L+  +++   +  +      + P  ++  A+S GF+ C + LL  GF+    +          G   LH  A         LL  TGAD N++     +T LH AA    +   +F L+ +GA VN  D   CTPL + + S  D +  + ++ N+ N  +++N G+ A  Y   Y   +  +L   ET   +    L  T  T  L D  +R+ 
Sbjct:  107 WQTPLHIAAANKAVRCAEALVPLLSN----VNVSD-RAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVV----KFLLDLG--------------------------VDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHG------RFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLI-TNRADTAKRGIH----GMFP--LHLAALS-GFSDCCRKLLSSGFDIDTPDD--------FGRTCLHAAAAGGNLECLNLLLNTGADFNRK-DSFGRTPLHYAA-ANCNYQCLFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDV----LMETSGTDILNDSDVRAP 550          

HSP 2 Score: 70.4774 bits (171), Expect = 8.237e-12
Identity = 103/423 (24.35%), Postives = 179/423 (42.32%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFIN---LRSRCI------------QGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLL--DRGFNFKENEANQLLR--NVITGELVLHGQALNDTLNLLLYKTGADI----NKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA  G    V  LL+ G D+N  N +  TPL  A     + +   L+E GA ++  N +    L    ++       R      EL   V +G D  ++    D +T L    I+    RS+ I             G+T LH AA +   L +  L+  R D  +R   G+ PLH    S   +    L+ +G D++  D+     LH+A  G       +E + +LL  GA+   +++    P+H AA    +  +  L+    S       ++++    P  +++ A S     C ++LL  D     ++N+    +   +     L L   A    L++L+  +G DI    + R P    + LHLAA+       M +L+Q+  D++  +++  TPL ++  +  ++   V+I
Sbjct:  208 TPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAAS-------RHGALCLEL--LVCNGADVNIKS--KDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAG-----GNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVN-----DLDERGCTP--LHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAP---VSPLHLAAY-HGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLI 603          

HSP 3 Score: 67.0106 bits (162), Expect = 1.184e-10
Identity = 74/305 (24.26%), Postives = 121/305 (39.67%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEE----------------------------GEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALN--DTLNLLLYKTGADIN----KRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+      ++ L++    VN +D K ++PLHR   S   E + +L++  ADVN +D++   PLH A   +                                  +E +++LL  G+N+   + +    IH AA  G  +V++LL  +      ++      L+         A S G  S  ++LLD G +  E  A         G   LH    N  D +   L + GA +N    K + P     LH  A        + +L+  GADVN    +  TPL ++        ++ +I
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHA--------AASSGMISVVKFLLDLGVDINEPNA--------YGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAP-----LHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAII 326          

HSP 4 Score: 56.6102 bits (135), Expect = 1.758e-7
Identity = 76/277 (27.44%), Postives = 112/277 (40.43%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEIS---------------WANVRNQTVLDICKSNSLKAYIERKFKF--YSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLI-EAGADVNVKDEDNNQPLHSACYGEEGEKSQ----MEKIKVLLMEGANLIFRNNQFL-MPIHCAAMQGRFDVIELLL 2540
            G TALH  A+ GH + +  LL+  A    R+   +TP+  AA      + G LL     +                WA        D C    L+  +  K +   +S L   V+  N+   E +I      L P  +N +    +  T LH AA       ++ LL     VN  D  G SPL  +++      + LL+  A AD+ ++D   N  LH AC   +G ++     +EKI        NLI   N  L  P+H AA  G   V++ LL
Sbjct:  686 GRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGH---DTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLI----DTLGPTIVNAKDG--KNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLAC--SKGHETSALLILEKIS-----DRNLINATNAALQTPLHVAARNGLTVVVQELL 946          

HSP 5 Score: 50.8322 bits (120), Expect = 9.210e-6
Identity = 99/402 (24.63%), Postives = 162/402 (40.30%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARN-RFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVN----VKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFIL--IQAGADVNATDNEHCTPLFISCSRNDL 2963
            G T L LAA  GH + V  L+  GA +  ++   K+TP+ +AA  +  + C  LL   A++       Q+ +DI   N             + L   V+SG+ D +  +++   +        + ++   G T LH  A       ++ LL        RD +G +P+H ++    + ++  L+ A   V     + D     PLH ACY   G  + +E   VLL +        N F  P+HCA ++      E+L+D      +       +  L        A       C Q LL         +A      ++  E   +GQ   + + LL+    AD+  +   +  TALHLA      T  + IL  I     +NAT+    TPL ++ +RN L
Sbjct:  583 GRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAA-TNGHSECLRLLIGNADL-------QSAVDIQDGNG-----------QTPLMLAVLSGHTDCVYSLLNKGAS--------VEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACY--NGHDTCVE---VLLEQEVFHKAEGNPF-SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPL------HAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAE---NGQ--TNAVELLVSSAKADLTIQ-DAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVA-ARNGL 938          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: tnksb (tankyrase-1-like [Source:NCBI gene;Acc:105353570])

HSP 1 Score: 105.531 bits (262), Expect = 1.609e-22
Identity = 119/404 (29.46%), Postives = 184/404 (45.54%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADV 2903
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  +A     ++C +LL+ GA+ +  N   ++ LD+  S S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K++ME   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +    P  N  A+    AS         + LL +G N  E   + +    I+ E     +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD 
Sbjct:   15 QTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADS-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKERLTYEFKGHSLLQAAREADIAK-VKKTLALEVIGFKHPQTNETALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHISAE-----RAHNDVLE-VLQKHGAKVNA-VDTLGQTALHRAA-LAGHIQTCKLLLSFGADA 395          

HSP 2 Score: 80.1073 bits (196), Expect = 9.231e-15
Identity = 71/244 (29.10%), Postives = 109/244 (44.67%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAE--------ISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPI 2492
            T LH++A   H D +  L + GA VNA +   QT L  AA       C +LL +GA+         + A + N+ V  I   N      +  ++F         +G+ D ++++         P  +N R    + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL+  GA VNV D     PLH     E   K + E  K+LL  GA+   +N    +P+
Sbjct:  338 TPLHISAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAIVSLQGFTAAQMGNEAVQQILNENVPTRNSDVDYRFLEAAK----AGDLDTVQQLC-------TPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLH-----EAAAKGKYEICKLLLKHGADPTKKNRDGNIPL 565          

HSP 3 Score: 72.7886 bits (177), Expect = 1.789e-12
Identity = 100/436 (22.94%), Postives = 173/436 (39.68%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGADINKR-YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N  +++ +D+  +  LK  +  +FK +S L     +   D+                                 A   KTLA++ +       N+               ++  LL+  GA++N K++D   PLH +      E++  + ++VL   GA +   +      +H AA+ G     +LLL +     I     +         M   AV        Q +L+     + ++ + + L     G+L        DT+  L   T  ++N R       T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  154 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKERLTYEFKGHSLLQ---AAREADI---------------------------------AKVKKTLALEVIGFKHPQTNETALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHIS-----AERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAI-----VSLQGFTAAQMGNEAV--------QQILNENVPTRNSDVDYRFLEAAKAGDL--------DTVQQLC--TPQNVNCRDLEGRHSTPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 515          

HSP 4 Score: 59.3066 bits (142), Expect = 2.656e-8
Identity = 61/216 (28.24%), Postives = 103/216 (47.69%), Query Frame = 3
Query: 2307 EIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCS 2951
            +++  L++ GA+V+ +D+    PLH+AC +G        E + +LL +GA+   R+N    P+H +A++G+ DV  +LL +     I+       L+L   S    AV  G              +K++E  +  R+    +L+    AL   LN+  + +  D  K  P      LHLAA   +   ++ +L+Q GADV+A D     PL  +CS
Sbjct:    8 DVVEHLLQTGANVHARDDGGLIPLHNACSFG------HAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADSSAK--AVLTG-------------EYKKDELLEAARSGNEEKLM----ALLTPLNVNCHAS--DGRKSTP------LHLAAGY-NRVRIVQLLLQHGADVHAKDKGGLVPLHNACS 189          

HSP 5 Score: 58.151 bits (139), Expect = 5.190e-8
Identity = 70/261 (26.82%), Postives = 107/261 (41.00%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKG--VSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLME 2447
            A+  N V  ++ L     D+ + DK          G   LH A   GH++    L+  GA VN  + +K TPL  AA      IC +LL+ GA+ +  N      LD+ K                        G+ D+ +                     ++G   L  AA     LA  + L  + ++N RD +G   +PLH ++   +LE+   L+E GADVN +D+    PLH +A YG        + I+ LLM+
Sbjct:  469 AAGYNRVAVVEYLLHHGADVHAKDKG---------GLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNIPLDMVKD-----------------------GDTDIQD--------------------LLRGDAALLDAAK-KGCLARVQKLCSQENINCRDAQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYG-------ADDIRALLMD 669          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: tnksb (tankyrase-1-like [Source:NCBI gene;Acc:105353570])

HSP 1 Score: 104.76 bits (260), Expect = 3.332e-22
Identity = 119/404 (29.46%), Postives = 184/404 (45.54%), Query Frame = 3
Query: 1755 KTFINWHDSEMGN-TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAA---MQGRF-------DVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFAS-------CAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADV 2903
            +T  N H  + G    LH A   GH + V  LL  GAD NAR+ +  TPL  +A     ++C +LL+ GA+ +  N   ++ LD+  S S KA +  ++K   EL     SGN++ L  +       L P+ +N  +   + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL++ GA VN  D     PLH     E   K++ME   +LL  GA+    N      +  A    ++ R         +++   + D +K +++ L +E +    P  N  A+    AS         + LL +G N  E   + +    I+ E     +A ND L  +L K GA +N     + QTALH AA L        +L+  GAD 
Sbjct:  167 QTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADS-SAKAVLTGEYK-KDELLEAARSGNEEKLMAL-------LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLH-----EAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKERLTYEFKGHSLLQAAREADIAK-VKKTLALEVIGFKHPQTNETALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHISAE-----RAHNDVLE-VLQKHGAKVNA-VDTLGQTALHRAA-LAGHIQTCKLLLSFGADA 547          

HSP 2 Score: 82.8037 bits (203), Expect = 1.900e-15
Identity = 113/428 (26.40%), Postives = 178/428 (41.59%), Query Frame = 3
Query: 1794 TALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAE--------ISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLY--KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFD 3038
            T LH++A   H D +  L + GA VNA +   QT L  AA       C +LL +GA+         + A + N+ V  I   N      +  ++F         +G+ D ++++         P  +N R    + ST LH AA +++   V+ LL    DV+ +D  G+ PLH +      E+  LL+  GA VNV D     PLH     E   K + E  K+LL  GA+   +N    +P+         D+++     D    IQ+ L  +       ++   A  G  A   +       N ++ +     RN       LH  A  + L +  Y  + GAD+N +        LH AA      D+  +LI+    VNATD    TPL  +  +   Q   +++ +  +  +KN  G TA D
Sbjct:  490 TPLHISAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAIVSLQGFTAAQMGNEAVQQILNENVPTRNSDVDYRFLEAAK----AGDLDTVQQLC-------TPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLH-----EAAAKGKYEICKLLLKHGADPTKKNRDGNIPL---------DMVK-----DGDTDIQDLLRGDA------ALLDAAKKGCLARVQKLCSQENINCRDAQG----RNSTP----LHLAAGYNNLEVAEYLLEHGADVNAQ-DKGGLIPLHNAASY-GHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTALD 871          

HSP 3 Score: 71.633 bits (174), Expect = 3.914e-12
Identity = 100/436 (22.94%), Postives = 173/436 (39.68%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEAN-QLLRNVITGELVLHGQALNDTLNLLLYKTGADINKR-YPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            A+  N V  ++LL     D+ + DK          G   LH A   GH++    LL+ GA VNA + ++ TPL  AA  +   +C +LL  GA+ +  N  +++ +D+  +  LK  +  +FK +S L     +   D+                                 A   KTLA++ +       N+               ++  LL+  GA++N K++D   PLH +      E++  + ++VL   GA +   +      +H AA+ G     +LLL +     I     +         M   AV        Q +L+     + ++ + + L     G+L        DT+  L   T  ++N R       T LH AA   +   ++  L+  GADV+A D     PL  +CS    + A++++
Sbjct:  306 AAGYNRVRIVQLLLQHGADVHAKDKG---------GLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKERLTYEFKGHSLLQ---AAREADI---------------------------------AKVKKTLALEVIGFKHPQTNETALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHIS-----AERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAI-----VSLQGFTAAQMGNEAV--------QQILNENVPTRNSDVDYRFLEAAKAGDL--------DTVQQLC--TPQNVNCRDLEGRHSTPLHFAAGY-NRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLV 667          

HSP 4 Score: 68.9366 bits (167), Expect = 2.772e-11
Identity = 78/290 (26.90%), Postives = 122/290 (42.07%), Query Frame = 3
Query: 1695 ASSSNDVTTIKLL----TDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD 2543
            A+  N V  ++ L     D+ + DK          G   LH A   GH++    L+  GA VN  + +K TPL  AA      IC +LL+ GA+ +  N      LD+ K       I+   +  + L      G    ++++            IN R    + ST LH AA ++     + LL    DVN +D  G+ PLH ++    ++I  LLI+    VN  D+    PLH     E  +K + +   +LL  GA+   +N +    +  A      D+  LL+D
Sbjct:  621 AAGYNRVAVVEYLLHHGADVHAKDKG---------GLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNIPLDMVKDGDTD--IQDLLRGDAALLDAAKKGCLARVQKLCSQEN-------INCRDAQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLH-----EAAQKGRTQLCALLLAHGADPTMKNQEGQTALDLATAD---DIRALLMD 884          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036692.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 100.523 bits (249), Expect = 5.272e-21
Identity = 113/406 (27.83%), Postives = 183/406 (45.07%), Query Frame = 3
Query: 1782 EMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH----RSSDLEIINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLL--DYDKSKQ-IQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNF--------KENEANQLLRNVIT--GELVLHGQALN---DTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            ++G T LH AA  GH + V  L+  GA+V+A+++ ++ P+  AA +    +  +L+  GA ++            CK              Y+ L    VSG  DV+  ++   R ++EP   N       G+T LH A +  + +   EL+    ++NQ  Y G +PLH     S  +    LL+  GADV+V+++D   PLH +A YG      +    ++L+  GA +   +     P+H AA  G+  +I  LL    DK++Q I   L +            LA   GF  C + LL  G  +          +   +L  N+    G   LH  A     + LNLLL   GA+++ +   + ++ LH AA    ++     L++AGA+VN  D   C+PL
Sbjct:  138 KLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVT------------CKDK----------HGYTPLHVAAVSGQLDVVSYLL---RLRVEPDEPNSF-----GNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYG------RFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLH-----------LAALCGFPDCCRKLLSSGHFYNSMPSAVGSPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLL-NCGAELDIK-DILGRSPLHYAA-ANGNSQCTVSLVRAGAEVNDADLMGCSPL 493          

HSP 2 Score: 80.8777 bits (198), Expect = 5.621e-15
Identity = 96/367 (26.16%), Postives = 157/367 (42.78%), Query Frame = 3
Query: 1863 DVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL---LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFIS 2945
            +VNA+++ + TPL +A+ +   ++  IL+  GA IS  +    T L    ++  K  +E   K  SE                            +N R +     T LH AA    T     L+     ++  D  G +PLH    S   E++NLL+  GA+V+ KD+   QP+H A +        +E +K+L+  GA++  ++     P+H AA+ G+ DV+  LL           +E ++ N    +   +A   G    A  L++ G N  +   +        G   LH  A +    +   LL   GAD++ +     +T LH+AA     T    ILIQ GA+++  D    TPL I+
Sbjct:   33 NVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRNKRAVELLLKHKSE----------------------------VNSRDKFWH--TPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAH-----LGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLR--------VEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYH--------GNTPLHMAAASSCGVMCFELLVNNGADVSVQNKD-GKTPLHIAAKYGRFTGSQ-ILIQNGAEIDCGDTNGNTPLHIA 346          

HSP 3 Score: 70.8626 bits (172), Expect = 6.375e-12
Identity = 116/470 (24.68%), Postives = 185/470 (39.36%), Query Frame = 3
Query: 1683 LLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLD---ICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSA------CYGEEGEKSQMEKIK---------VLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD--YDKSKQIQEALEIEKLNLIP-------------------------PSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLY----KTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPL 2936
            L + A+SS  V   +LL +   +D +  N    + G T LH+AA  G F     L++ GA+++  +    TPL  AA+   E +   LL  GA+ +   +     L    +C        +     FY+ +   V S +               E + IN+      G T LH AA       +  LL    +++ +D  G SPLH ++   + +    L+ AGA+VN  D     PLH A      C GE    S + + K          LL  G +   +N +    +H AA  G    +ELLL+  ++  ++ +  + +  L+L                            +   LA   GF+ C + LL+ G ++        LR        LH  A    ++ LL     K   D+        +TAL LAA L   TD + IL++  A+ +A D +  T L
Sbjct:  276 LHMAAASSCGVMCFELLVN-NGADVSVQN----KDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHFYNSMPSAVGSPSSG-------------EELDINMSDD--HGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYG-------LREHKRRWTALHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAA-LGCHTDCVHILLEKKANPDAADKKGFTAL 717          

HSP 4 Score: 63.5438 bits (153), Expect = 1.305e-9
Identity = 80/301 (26.58%), Postives = 128/301 (42.52%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNS----LKAYIE--RK---------FKFYSELSGFVVSGNDDVLEEVIHDH------RTKLEPIFINL--------------------RSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSD----LEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEG----ANLI-FRNNQFLMPIHCAAMQGRFDVIELLL 2540
            G TAL LAA+  H D V  LLE  A+ +A ++   T L   A +  E     LLE GA     + + +T L +  S      L A ++  RK         F+ Y+        G++  L  ++ +            P+   L                      +  +G + LH AAH      ++ LL    +VN  D+ G S L  ++D    + +  LL +A  D+++ D +NN  LH AC       ++  ++  LL+ G    ++LI  RNN   MP+H AA +G   V+++LL
Sbjct:  680 GRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRIFSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFLLHKANPDLSLVDANNNTALHLAC-------NKGHEMCALLILGEITDSSLINARNNSLQMPLHIAARKGLATVVQVLL 973          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000069889.1 (SMESG000069889.1)

HSP 1 Score: 2079.29 bits (5386), Expect = 0.000e+0
Identity = 1050/1058 (99.24%), Postives = 1053/1058 (99.53%), Query Frame = 3
Query:  114 MSLAKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPLEKIGSFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEXXXXXXXXXXXXXXDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRXXXXXXXXXXXXGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVDICESKNEILSSSQLEKNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITXXXXXXXXXXLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIERAKSRCTLRPRSKFR 3287
            MSLAKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGS LEKIGSFTGISQIQK+TRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLED KLITQYEFKIFPEKAPI KPKKFKVKKDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRSSSASS NPPKPGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVDICESKNEILSSSQLEKNRTII+ETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLA+SGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHL DSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITNNVNINVKNNLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIERAKSRCTLRPRSKFR
Sbjct:    1 MSLAKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSRLEKIGSFTGISQIQKATRIEWIIKELISWKLLKEDLMINPKLLAARNSEETFSFLMKLVHQDIIFLWQRMEFLQLEDTKLITQYEFKIFPEKAPIAKPKKFKVKKDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRSSSASSLNPPKPGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAILPNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYFTALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVDICESKNEILSSSQLEKNRTIISETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQYEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRDLSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKNKSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAISGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLPDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMITNNVNINVKNNLGHTAFDYIPDYLEWINSDLFDEETVARLKAYNLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIERAKSRCTLRPRSKFR 1058          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000074871.1 (SMESG000074871.1)

HSP 1 Score: 100.523 bits (249), Expect = 4.288e-21
Identity = 119/427 (27.87%), Postives = 191/427 (44.73%), Query Frame = 3
Query: 1674 WCKLLLKASSSNDVTTIKLLTDLFSSDKTFINWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFV----VSGNDDVLEEVIHDH----RTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLM-LRIDVNQRDYKGVSPLHRSSD---LEIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKL--NLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGA--DINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADV 2903
            W +     ++ N V  +KL+          IN  DS+ G TALH A  +GH + +  LL+  A++N R++   T L  A+ M   +I   L+E GAE+     +    L +  +N+    +E   K  +    F+     + + D++EE+  +H    + +LE I   L SR  QG T LH  +         +LL+    + N     G SPLH ++    L+   LLI+A ADVN++D+  N PLH AC +G E      + +++LL   AN        ++PIH A        +  LLD    K     L+ + L  NL+       AV+GG   C + ++  G +    +      N+    L L  +  N  +  +L K GA  D+   Y  M   A+H AA      D++ +L   GA++
Sbjct:  104 WNRAFHVCAAHNSVDCLKLILPHVLG----INITDSD-GRTALHHAVANGHIEILNLLLDNDANMNIRDKDDYTALHIASAMGHIDIVIRLIEKGAELDCVATQGNNALHLASANNHTNIVEELIKALNSSHLFLEHLKSNSHQDLIEEIKDNHFVLIKERLESI---LNSRNYQGLTSLHILSQMDNAHQCVDLLLAYGANPNLLSENGKSPLHFAASRNQLKQAVLLIKAKADVNIQDDHENTPLHIACRFGYE------KFVQMLLEYKANAFVAGEDGMLPIHVATAFKNCGCMHKLLDNVTLKTHINNLDDDGLGRNLV-----HCAVAGGSLKCLETIIRLGGDIHHED------NLKQTPLHLAVKLNNFMITRILIKLGASIDVEDEYTCM---AIHYAAMYNKEGDILKLLFDNGANI 502          

HSP 2 Score: 62.003 bits (149), Expect = 2.785e-9
Identity = 94/406 (23.15%), Postives = 160/406 (39.41%), Query Frame = 3
Query: 1779 SEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRSSDLE---IINLLIEAGADVNVKDEDNNQPLH-SACYGEEGEKSQMEKIKVLLMEGANLI-----------FRNN---------QFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEH 2924
            SE G + LH AA        + L++  ADVN ++  + TPL  A     E    +LLE+ A    A           +   L  ++   FK    +   +    D+V    +  H   L+   +        G  L+H A        ++ ++ L  D++  D    +PLH +  L    I  +LI+ GA ++V+DE     +H +A Y +EG+      +K+L   GAN++             NN         + + P+H A M G FD + LLL+                 ++P              C +  +D   N  +++ + L    +      HG +  + LN L+     +I        +TALHLAA+   + ++ F L+  GA   A D ++
Sbjct:  302 SENGKSPLHFAASRNQLKQAVLLIKAKADVNIQDDHENTPLHIACRFGYEKFVQMLLEYKANAFVAG----------EDGMLPIHVATAFKNCGCMHKLL----DNV---TLKTHINNLDDDGL--------GRNLVHCAVAGGSLKCLETIIRLGGDIHHEDNLKQTPLHLAVKLNNFMITRILIKLGASIDVEDEYTCMAIHYAAMYNKEGDI-----LKLLFDNGANILSPININDHLSFIENNIMDNTSLGKKIVYPVHFAVMSGNFDGMILLLE-----------------MMPNEAKM--------DCIKGHVDSSQNDYQSKDDVL---SLIHLAAYHGHS--EILNYLVQIFSKNIVSTQDRSGRTALHLAAYQGHAINVKF-LLSCGAKPTAVDKDY 646          

HSP 3 Score: 60.077 bits (144), Expect = 1.019e-8
Identity = 70/304 (23.03%), Postives = 128/304 (42.11%), Query Frame = 3
Query: 2181 TLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHR---SSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQE-----ALEIE-----------------KLNLIPPSMN---FLAVSGGFASCAQWLLDRGFN--------FKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            T LH AA+   +     L+   IDVN +D  GV+PL +   S+   ++ +LI +GAD N +D   N+  H  C       + ++ +K++L     +   ++     +H A   G  +++ LLLD D +  I++     AL I                  +L+ +    N    LA +    +  + L+ +  N         K N    L+  +     VL  + L   LN          ++ Y  +  T+LH+ + + ++   + +L+  GA+ N       +PL  + SRN L+ A ++I
Sbjct:   40 TALHLAAYIGNSNIADILIKYGIDVNSKDVNGVTPLFKACASNSHNVLTVLISSGADTNCRDNKWNRAFH-VC----AAHNSVDCLKLILPHVLGINITDSDGRTALHHAVANGHIEILNLLLDNDANMNIRDKDDYTALHIASAMGHIDIVIRLIEKGAELDCVATQGNNALHLASANNHTNIVEELI-KALNSSHLFLEHLKSNSHQDLIEEIKDNHFVLIKERLESILN----------SRNYQGL--TSLHILSQMDNAHQCVDLLLAYGANPNLLSENGKSPLHFAASRNQLKQAVLLI 325          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.400e-20
Identity = 110/399 (27.57%), Postives = 180/399 (45.11%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRID-VNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD-----YDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNT+LH+A++ G  + V  LLE  A++N +++   TPL+ AA+ +  ++  +LLE+GA        NQ +                   ++ L+  +  GND V++            I ++  SR       LH AA      A   L+    D V+ +   G +PLH ++   ++ +  LLIE  ADVN   ++N  PLH A  +G+E      E +K+L+ + AN+       L PIHCAA  G  ++I +LL+       KSK    AL+             +A  G  A   Q L+++G      + + +  + +T    LH  A    +N   +L K   ++N R      T LH+A     S  ++ +LI+  A +N+T     TPL I+ 
Sbjct:  138 GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGA--------NQAI--------------TTDDGFTPLAVALQQGNDKVVQ------------ILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKE------EMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQ-------------MATQGDQAEVCQTLINKGI-----DVDAVTMDYLTA---LHVAAHCGNINAAEVLLKNNCNVNARA-LNGFTPLHIACKKIQS-KMVELLIKYKAHINSTTETGLTPLHIAA 473          

HSP 2 Score: 80.4925 bits (197), Expect = 7.788e-15
Identity = 104/442 (23.53%), Postives = 182/442 (41.18%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE------------RKFKFYSELSGFVVSGNDDVLEE----------VIHDHRTKL---------EPIFINLRSRC------IQGSTLLHTAAHFSKTLAVKELLM-LRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G T LH+A        V  L++  A +N+      TPL  AA M  + I  ILL+ GA IS   ++ +  L +   N+ +   +            R  +  + L   V  GN  ++E+          V  D+ T L         E   + L  +C       +G T LH A+ + +    ++LL+  +++ N   + G++PLH ++     E+I LL++  A+VN   ++   PLH        +K+ +E  K+L+  GAN+  ++ +   P+H  +M G  +++ELLLD +                                               + N    N +T    LH  A  +  +++  L KT ADI+ +   M  TALH A H       + +L++   DVNA  N  CT L ++  +  +   ++++
Sbjct:  432 GFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLV-----AKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANA----------------------------------------------DVNHQAENGLTA---LHLAAEKNRTDIVEQLLKTEADISTKT-QMGYTALHTAVHF-GQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLL 817          

HSP 3 Score: 65.4698 bits (158), Expect = 2.373e-10
Identity = 68/269 (25.28%), Postives = 116/269 (43.12%), Query Frame = 3
Query: 2196 AAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            AA       VKE L   I  +  +  G++ +H   +  + E++ LLIE G  V++     N  LH A         ++E + +LL   AN+  ++     P++ AA +   DV+++LL+Y  ++ I        L         +A+  G     Q LLD       N++   +R        LH  A  D +N   LL  +  D          T LH+AAH  ++ ++  +LI+  ADVN     + TPL ++      +  K++I+
Sbjct:   79 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLA-----GKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPL--------AVALQQGNDKVVQILLD-------NDSRSKVR-----LPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHY-NNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLIS 321          

HSP 4 Score: 57.7658 bits (138), Expect = 5.813e-8
Identity = 61/276 (22.10%), Postives = 121/276 (43.84%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPP 2606
            G T LH+A    H++ +  LL+  A+VN   +   TPL   A+ ++  +  +L++ GA +   N ++Q                   K ++ L    ++GN +++E ++  +         ++  +   G T LH AA  ++T  V++LL    D++ +   G + LH +     ++ + +L+E   DVN +       LH A      ++  +  +++LL    ++  +N Q L  +  A  Q   ++ E L       ++    E +KL L  P
Sbjct:  632 GLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANV---NAQSQ-------------------KGFTPLHLNSMAGNKEIMELLLDAN--------ADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLA-----AQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQP 872          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.409e-20
Identity = 110/399 (27.57%), Postives = 180/399 (45.11%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRID-VNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD-----YDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNT+LH+A++ G  + V  LLE  A++N +++   TPL+ AA+ +  ++  +LLE+GA        NQ +                   ++ L+  +  GND V++            I ++  SR       LH AA      A   L+    D V+ +   G +PLH ++   ++ +  LLIE  ADVN   ++N  PLH A  +G+E      E +K+L+ + AN+       L PIHCAA  G  ++I +LL+       KSK    AL+             +A  G  A   Q L+++G      + + +  + +T    LH  A    +N   +L K   ++N R      T LH+A     S  ++ +LI+  A +N+T     TPL I+ 
Sbjct:  158 GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGA--------NQAI--------------TTDDGFTPLAVALQQGNDKVVQ------------ILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKE------EMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQ-------------MATQGDQAEVCQTLINKGI-----DVDAVTMDYLTA---LHVAAHCGNINAAEVLLKNNCNVNARA-LNGFTPLHIACKKIQS-KMVELLIKYKAHINSTTETGLTPLHIAA 493          

HSP 2 Score: 80.1073 bits (196), Expect = 8.286e-15
Identity = 104/442 (23.53%), Postives = 182/442 (41.18%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE------------RKFKFYSELSGFVVSGNDDVLEE----------VIHDHRTKL---------EPIFINLRSRC------IQGSTLLHTAAHFSKTLAVKELLM-LRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G T LH+A        V  L++  A +N+      TPL  AA M  + I  ILL+ GA IS   ++ +  L +   N+ +   +            R  +  + L   V  GN  ++E+          V  D+ T L         E   + L  +C       +G T LH A+ + +    ++LL+  +++ N   + G++PLH ++     E+I LL++  A+VN   ++   PLH        +K+ +E  K+L+  GAN+  ++ +   P+H  +M G  +++ELLLD +                                               + N    N +T    LH  A  +  +++  L KT ADI+ +   M  TALH A H       + +L++   DVNA  N  CT L ++  +  +   ++++
Sbjct:  452 GFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLV-----AKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANA----------------------------------------------DVNHQAENGLTA---LHLAAEKNRTDIVEQLLKTEADISTKT-QMGYTALHTAVHF-GQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLL 837          

HSP 3 Score: 65.4698 bits (158), Expect = 2.358e-10
Identity = 68/269 (25.28%), Postives = 116/269 (43.12%), Query Frame = 3
Query: 2196 AAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            AA       VKE L   I  +  +  G++ +H   +  + E++ LLIE G  V++     N  LH A         ++E + +LL   AN+  ++     P++ AA +   DV+++LL+Y  ++ I        L         +A+  G     Q LLD       N++   +R        LH  A  D +N   LL  +  D          T LH+AAH  ++ ++  +LI+  ADVN     + TPL ++      +  K++I+
Sbjct:   99 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLA-----GKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPL--------AVALQQGNDKVVQILLD-------NDSRSKVR-----LPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHY-NNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLIS 341          

HSP 4 Score: 57.7658 bits (138), Expect = 5.677e-8
Identity = 61/276 (22.10%), Postives = 121/276 (43.84%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPP 2606
            G T LH+A    H++ +  LL+  A+VN   +   TPL   A+ ++  +  +L++ GA +   N ++Q                   K ++ L    ++GN +++E ++  +         ++  +   G T LH AA  ++T  V++LL    D++ +   G + LH +     ++ + +L+E   DVN +       LH A      ++  +  +++LL    ++  +N Q L  +  A  Q   ++ E L       ++    E +KL L  P
Sbjct:  652 GLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANV---NAQSQ-------------------KGFTPLHLNSMAGNKEIMELLLDAN--------ADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLA-----AQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQP 892          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.810e-20
Identity = 110/399 (27.57%), Postives = 177/399 (44.36%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRID-VNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSAC-YGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLD-----YDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISC 2948
            GNT+LH+A++ G  + V  LLE  A++N +++   TPL+ AA+ +  ++  +LLE+GA        NQ +                   ++ L+  +  GND V++            I ++  SR       LH AA      A   L+    D V+ +   G +PLH ++   ++ +  LLIE  ADVN   ++N  PLH A  +G+E      E +K+L+ + AN+       L PIHCAA  G  ++I +LL+       KSK    AL+             +A  G  A   Q L+++G +      + L          LH  A    +N   +L K   ++N R      T LH+A     S  ++ +LI+  A +N+T     TPL I+ 
Sbjct:   78 GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGA--------NQAI--------------TTDDGFTPLAVALQQGNDKVVQ------------ILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKE------EMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQ-------------MATQGDQAEVCQTLINKGIDVDAVTMDYL--------TALHVAAHCGNINAAEVLLKNNCNVNARA-LNGFTPLHIACKKIQS-KMVELLIKYKAHINSTTETGLTPLHIAA 413          

HSP 2 Score: 80.1073 bits (196), Expect = 8.763e-15
Identity = 104/442 (23.53%), Postives = 182/442 (41.18%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIE------------RKFKFYSELSGFVVSGNDDVLEE----------VIHDHRTKL---------EPIFINLRSRC------IQGSTLLHTAAHFSKTLAVKELLM-LRIDVNQRDYKGVSPLHRSS---DLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLL--LYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMI 2984
            G T LH+A        V  L++  A +N+      TPL  AA M  + I  ILL+ GA IS   ++ +  L +   N+ +   +            R  +  + L   V  GN  ++E+          V  D+ T L         E   + L  +C       +G T LH A+ + +    ++LL+  +++ N   + G++PLH ++     E+I LL++  A+VN   ++   PLH        +K+ +E  K+L+  GAN+  ++ +   P+H  +M G  +++ELLLD +                                               + N    N +T    LH  A  +  +++  L KT ADI+ +   M  TALH A H       + +L++   DVNA  N  CT L ++  +  +   ++++
Sbjct:  372 GFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLV-----AKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANA----------------------------------------------DVNHQAENGLTA---LHLAAEKNRTDIVEQLLKTEADISTKT-QMGYTALHTAVHF-GQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLL 757          

HSP 3 Score: 65.4698 bits (158), Expect = 2.544e-10
Identity = 68/269 (25.28%), Postives = 116/269 (43.12%), Query Frame = 3
Query: 2196 AAHFSKTLAVKELLMLRIDVNQRDYKGVSPLH---RSSDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLLDRGFNFKENEANQLLRNVITGELVLHGQALNDTLNL--LLYKTGADINKRYPPMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDLQSAKVMIT 2987
            AA       VKE L   I  +  +  G++ +H   +  + E++ LLIE G  V++     N  LH A         ++E + +LL   AN+  ++     P++ AA +   DV+++LL+Y  ++ I        L         +A+  G     Q LLD       N++   +R        LH  A  D +N   LL  +  D          T LH+AAH  ++ ++  +LI+  ADVN     + TPL ++      +  K++I+
Sbjct:   19 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLA-----GKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPL--------AVALQQGNDKVVQILLD-------NDSRSKVR-----LPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHY-NNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLIS 261          

HSP 4 Score: 57.7658 bits (138), Expect = 6.081e-8
Identity = 61/276 (22.10%), Postives = 121/276 (43.84%), Query Frame = 3
Query: 1788 GNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAAEMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSELSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSKTLAVKELLMLRIDVNQRDYKGVSPLHRS---SDLEIINLLIEAGADVNVKDEDNNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQGRFDVIELLLDYDKSKQIQEALEIEKLNLIPP 2606
            G T LH+A    H++ +  LL+  A+VN   +   TPL   A+ ++  +  +L++ GA +   N ++Q                   K ++ L    ++GN +++E ++  +         ++  +   G T LH AA  ++T  V++LL    D++ +   G + LH +     ++ + +L+E   DVN +       LH A      ++  +  +++LL    ++  +N Q L  +  A  Q   ++ E L       ++    E +KL L  P
Sbjct:  572 GLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANV---NAQSQ-------------------KGFTPLHLNSMAGNKEIMELLLDAN--------ADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLA-----AQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQP 812          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK22.580e-2326.30ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANKRD281.047e-2226.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD281.490e-2226.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD281.490e-2226.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANK21.823e-2126.71ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-444.489e-1924.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.489e-1924.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.616e-1924.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.616e-1924.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.619e-1924.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.209e-2327.36gene:FBgn0261788 transcript:FBtr0303122[more]
Ank21.333e-2327.17gene:FBgn0261788 transcript:FBtr0303118[more]
Ank21.511e-2327.17gene:FBgn0261788 transcript:FBtr0344222[more]
Ank22.123e-2327.36gene:FBgn0261788 transcript:FBtr0303124[more]
Ank22.200e-2327.36gene:FBgn0261788 transcript:FBtr0303113[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd28b1.577e-2425.82ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
ankrd28b1.577e-2425.82ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
tnksa1.040e-2029.53tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksa1.040e-2029.53tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksa1.040e-2029.53tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rev16.943e-2627.22REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev16.954e-2627.22REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev17.516e-2627.22REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev18.766e-2627.22REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev19.299e-2627.22REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd283.126e-2326.82ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd284.342e-2326.82ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Tnks5.794e-2129.67tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
Ankrd443.367e-2026.06ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ank24.029e-1926.79ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q505D1|ANR28_MOUSE2.186e-2226.82Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|O15084|ANR28_HUMAN7.155e-2226.82Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q54KA7|SECG_DICDI1.555e-2026.94Ankyrin repeat, PH and SEC7 domain containing prot... [more]
sp|Q6PFX9|TNKS1_MOUSE4.053e-2029.67Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus mu... [more]
sp|O95271|TNKS1_HUMAN1.175e-1927.79Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo s... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8020.000e+038.18uncharacterized protein LOC106152547 OS=Lingula un... [more]
A0A1S3II610.000e+038.18uncharacterized protein LOC106164510 OS=Lingula un... [more]
A0A210QPB30.000e+036.84Ankyrin-2 OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A267E2G10.000e+036.54ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8G9Y60.000e+036.44ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.012e-2228.16ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
tnksb6.627e-2029.53tankyrase-1 [Source:NCBI gene;Acc:103045612][more]
ankrd52a8.417e-2024.89ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ENSAMXT00000017800.21.657e-1927.29pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ENSAMXT00000005100.24.347e-1932.47tankyrase-2 [Source:NCBI gene;Acc:103036789][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009608.12.570e-2329.26pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000000093.14.557e-2327.64pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.12.967e-2227.64pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000003991.12.911e-2126.47pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.11.160e-1926.36pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HOS45.351e-739.02Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387255.144e-1328.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.792e-1128.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356261.071e-1036.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359871.925e-833.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341612.944e-836.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd28b4.618e-2325.99ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b5.918e-2325.84ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
tnksb1.609e-2229.46tankyrase-1-like [Source:NCBI gene;Acc:105353570][more]
tnksb3.332e-2229.46tankyrase-1-like [Source:NCBI gene;Acc:105353570][more]
ENSORLT00000036692.15.272e-2127.83serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069889.10.000e+099.24SMESG000069889.1[more]
SMESG000074871.14.288e-2127.87SMESG000074871.1[more]
SMESG000026655.12.400e-2027.57SMESG000026655.1[more]
SMESG000026655.12.409e-2027.57SMESG000026655.1[more]
SMESG000026655.12.810e-2027.57SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007869 ID=SMED30007869|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3416bp
AAATAATTTCAATAACAACTATCAAATCTGGATTTTTATTTATCAATTCC
GTTTTGTTTAAATACATCAATGGAATTAACACACTGACTACTAAAAGCTG
AGAATTTCAAACTATGTCATTGGCAAAAATTCACGCTTTCTCTGCTTGGG
TTAATTTACGTTTGGAAATTCGCGGGAAAAATAGATTGCAGAATGTGCTC
GTGGATTTATTTCAGGATTTTCATTGGCAGAATCTCGTCGAAAAATTTAC
TGGATCTCCCCTTGAAAAAATCGGAAGCTTCACTGGCATATCGCAAATCC
AAAAATCCACAAGAATTGAATGGATTATTAAAGAATTAATTTCATGGAAG
CTACTCAAAGAAGACTTGATGATTAATCCGAAATTATTAGCTGCGCGAAA
CTCCGAAGAAACATTTTCTTTTCTAATGAAATTGGTTCACCAGGATATTA
TATTTTTATGGCAAAGAATGGAATTCCTTCAGCTTGAAGACGCTAAGCTG
ATTACTCAATATGAATTTAAGATATTTCCCGAGAAAGCTCCAATAGTAAA
GCCTAAAAAGTTCAAAGTTAAAAAAGATTTATTAGCAGGTTTTGGATCAG
CTGCAGAAACCTACACTGAAATCATTGATGAAAATGAAACGCCACTTATT
AAAGAACGGAAATTCCATCATGATGAGGAGATGTTAGCATACAAAAGATC
GAGTTCAGCTAGCTCTCCAAATCCTCCAAAACCTGGCAACTGCATTCTCT
ATTTGATAAAAAATCACTTGAAAATGACAAAATCAGGGAAAATTATCAAA
TTTAATAAATTGCCCGATCTGTGTGACATTCGTGTTCTCTGTGCATTTTT
CAATGCGATCCTCCCGAATACTTTCTCCGGTGAAATTTTGCCAAATGACA
GGTGGTCAATCAATCATATTTTGAAAACATTAGAAAAAATATTAAGGATT
GATTCCGACTTTGAAGCCGCTGATCTTAATTCGGATGAAGACGCTTCACT
TATGGCTTATTTTACGGCGTTGCTTTTGATTATTTATCAATTTAGGCAGT
CCATGAAAGTTATAGAGTATAAAGAAGATCTCGAATATAAGATTCGTTAT
CAAACCTTGTCGGTGGATATATGTGAGAGTAAAAATGAAATTTTGTCCAG
CAGTCAATTAGAAAAGAATCGAACAATAATTAATGAAACAATTTTAGAAC
TGGACAGCCTGAAAGAAAGATTTGATATCAAATTTTGTGAAGCATGGAAA
ATTCATTCTAAAAATGTTATAGCTGAGTCAAAAGAGGTTTTGAAAAGAAA
AACTGAATATCAGTATGAAATAATGCAAGTTCCTCGGATTCTTTCTATTG
CTGATTTATGTAACAGATATTTCATTTATACGAAATCTTTGGGGTCCAGC
GGATATTATCAGCTAAGGAATGGCGAGACAGTGAATGATGATCGAAAGAT
AATTCTACGAGATTTGAGCAATGAAAAAATCATTATTGACATAGAAGGGA
AAGCCAAATCCAAGGTGAGGTCAACTCTGAAAGTTCATCAAGTCGGGCCA
GTCTATCTGGAACCGGAAAAAATCACAAAATATGAGATTTATTTGGATTC
TTATTCGAAAAATAAATCCCTCTCAGTAGATGAGAAATTCCTTTATCAGC
TCTTTCCTAAAAATAATGTCACTTGGTGTAAGTTACTCCTAAAAGCCAGC
TCCAGCAACGACGTCACAACTATCAAGTTATTAACAGATCTTTTTTCGTC
GGATAAAACATTTATTAATTGGCATGATTCGGAAATGGGAAATACTGCGT
TACATTTGGCGGCGATTGATGGGCATTTTGACGCAGTTCTGTGCTTACTA
GAATGCGGTGCGGATGTTAACGCAAGGAACCGATTCAAGCAGACGCCATT
GTTTAGTGCCGCCGAGATGGATCTGGAAAACATTTGCGGAATTTTGTTGG
AATGGGGAGCAGAAATCAGTTGGGCAAATGTTCGCAACCAGACCGTTCTA
GACATTTGCAAGAGTAATTCTTTAAAAGCTTATATTGAAAGAAAATTTAA
GTTCTATTCAGAACTTTCGGGATTTGTAGTGAGTGGAAATGATGACGTCC
TTGAAGAAGTCATACATGATCACAGGACCAAATTAGAGCCGATATTTATC
AATTTGAGAAGCAGATGCATTCAAGGCAGCACTCTTCTCCATACAGCTGC
CCATTTCTCTAAAACATTAGCTGTCAAAGAACTATTAATGCTTCGAATAG
ATGTCAACCAACGAGACTATAAAGGCGTATCGCCATTACATAGGTCTTCT
GATTTGGAAATTATAAATCTCTTGATTGAAGCTGGTGCTGATGTTAATGT
GAAGGATGAAGACAATAACCAGCCTCTTCATTCAGCCTGTTACGGCGAGG
AAGGCGAAAAAAGTCAAATGGAAAAGATTAAAGTTTTATTAATGGAAGGA
GCAAATCTCATATTTAGAAATAACCAATTCTTGATGCCGATCCATTGTGC
AGCGATGCAGGGAAGATTCGACGTGATTGAGTTGTTGTTAGATTATGATA
AGTCCAAACAGATCCAGGAAGCGTTAGAAATTGAAAAGCTCAATTTAATT
CCACCAAGCATGAACTTTTTAGCCGTATCAGGAGGATTCGCCTCTTGTGC
TCAATGGTTGCTAGACCGAGGATTTAATTTTAAGGAAAATGAAGCTAACC
AACTTCTTCGAAATGTTATTACCGGTGAATTGGTTCTCCATGGTCAAGCT
CTCAATGACACTCTTAATCTCCTGCTCTATAAAACTGGAGCAGACATAAA
TAAACGCTATCCGCCCATGTCTCAGACAGCTCTTCATTTGGCAGCCCATT
TGACTGATTCAACGGATTTAATGTTTATTCTTATCCAAGCCGGGGCGGAT
GTTAATGCTACTGATAATGAGCACTGCACCCCGTTGTTCATTTCATGTTC
AAGAAACGACCTGCAGTCTGCAAAGGTTATGATAACCAACAACGTCAATA
TCAATGTCAAAAATAATTTGGGCCACACGGCATTTGACTACATTCCAGAC
TATTTGGAATGGATAAATTCTGATTTATTCGACGAAGAAACTGTTGCCAG
ATTAAAAGCATACAATTTAAAGAGCACCCGAAACACTTTGAGGTTAATTG
ACAAAAAGATTCGCAGTAAACATGATGATGGCTACCAATTGAGACAGCTT
GAGTCGAGGTTGGATCAAAATTTATTCGAAGACAAAATAGAAAGAGCTAA
AAGTCGTTGCACATTGCGACCGAGGTCGAAATTCCGATAAGTTCTTTCTA
AAAATTAATCAAGTCGCATTTTTGACAATCAAAGAATTTTTAGTTTGACT
ATACTCAAAATTTTACTTTTTATGATTTTTTAATGTAATTTTTGATAATA
TTATCTAATTACTTGC
back to top

protein sequence of SMED30007869-orf-1

>SMED30007869-orf-1 ID=SMED30007869-orf-1|Name=SMED30007869-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1059bp
MSLAKIHAFSAWVNLRLEIRGKNRLQNVLVDLFQDFHWQNLVEKFTGSPL
EKIGSFTGISQIQKSTRIEWIIKELISWKLLKEDLMINPKLLAARNSEET
FSFLMKLVHQDIIFLWQRMEFLQLEDAKLITQYEFKIFPEKAPIVKPKKF
KVKKDLLAGFGSAAETYTEIIDENETPLIKERKFHHDEEMLAYKRSSSAS
SPNPPKPGNCILYLIKNHLKMTKSGKIIKFNKLPDLCDIRVLCAFFNAIL
PNTFSGEILPNDRWSINHILKTLEKILRIDSDFEAADLNSDEDASLMAYF
TALLLIIYQFRQSMKVIEYKEDLEYKIRYQTLSVDICESKNEILSSSQLE
KNRTIINETILELDSLKERFDIKFCEAWKIHSKNVIAESKEVLKRKTEYQ
YEIMQVPRILSIADLCNRYFIYTKSLGSSGYYQLRNGETVNDDRKIILRD
LSNEKIIIDIEGKAKSKVRSTLKVHQVGPVYLEPEKITKYEIYLDSYSKN
KSLSVDEKFLYQLFPKNNVTWCKLLLKASSSNDVTTIKLLTDLFSSDKTF
INWHDSEMGNTALHLAAIDGHFDAVLCLLECGADVNARNRFKQTPLFSAA
EMDLENICGILLEWGAEISWANVRNQTVLDICKSNSLKAYIERKFKFYSE
LSGFVVSGNDDVLEEVIHDHRTKLEPIFINLRSRCIQGSTLLHTAAHFSK
TLAVKELLMLRIDVNQRDYKGVSPLHRSSDLEIINLLIEAGADVNVKDED
NNQPLHSACYGEEGEKSQMEKIKVLLMEGANLIFRNNQFLMPIHCAAMQG
RFDVIELLLDYDKSKQIQEALEIEKLNLIPPSMNFLAVSGGFASCAQWLL
DRGFNFKENEANQLLRNVITGELVLHGQALNDTLNLLLYKTGADINKRYP
PMSQTALHLAAHLTDSTDLMFILIQAGADVNATDNEHCTPLFISCSRNDL
QSAKVMITNNVNINVKNNLGHTAFDYIPDYLEWINSDLFDEETVARLKAY
NLKSTRNTLRLIDKKIRSKHDDGYQLRQLESRLDQNLFEDKIERAKSRCT
LRPRSKFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 559..574
score: 44.02
coord: 733..747
score: 42.2
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 936..965
e-value: 0.18
score: 20.9
coord: 750..784
e-value: 190.0
score: 10.4
coord: 788..817
e-value: 2.5
score: 17.1
coord: 720..746
e-value: 3.4
score: 16.6
coord: 591..620
e-value: 580.0
score: 6.8
coord: 687..716
e-value: 39.0
score: 13.1
coord: 558..587
e-value: 2.1E-5
score: 33.9
coord: 902..932
e-value: 0.15
score: 21.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 727..749
score: 8.843
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 687..719
score: 9.137
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 902..935
score: 11.594
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 558..590
score: 14.265
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 877..982
e-value: 5.2E-18
score: 67.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 646..876
e-value: 4.3E-32
score: 113.5
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 498..645
e-value: 1.5E-25
score: 91.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 522..638
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 661..976
NoneNo IPR availablePFAMPF13857Ank_5coord: 923..976
e-value: 2.9E-7
score: 30.6
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 524..641
coord: 688..816
coord: 883..989
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 731..815
e-value: 7.0E-8
score: 32.9
coord: 527..618
e-value: 2.2E-9
score: 37.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 558..974
score: 51.17