Otoferlin

Overview
NameOtoferlin
Smed IDSMED30007867
Uniprot Best hitOtoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1 (E=8.69544e-148)
Length (bp)6169
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otoferlin (SMED30007867) t-SNE clustered cells

Violin plots show distribution of expression levels for Otoferlin (SMED30007867) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otoferlin (SMED30007867) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otoferlin (SMED30007867) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007867

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30007867SMESG000010400.1 SmedASXL_017845SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30007867SMESG000010400.1 SmedASXL_017847SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007867SMESG000010400.1 dd_Smed_v4_14162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007867SMESG000010400.1 dd_Smed_v4_14162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30007867SMESG000010400.1 dd_Smed_v4_13850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30007867SMESG000010400.1 dd_Smed_v4_14162_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007867SMESG000010400.1 dd_Smed_v4_13850_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007867SMESG000010400.1 dd_Smed_v4_13850_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 394/1283 (30.71%), Postives = 652/1283 (50.82%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVS-----------GNENL--------------------------------GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVE-SDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPK---HIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+L++ L++++ ++   +   KV FR   F +   +  +   +    F WP+A  +D+ + L I+    ++   +KL G   +VL  ++ +  + + +T +D+   I   +L  E+ Y +              G+E+L                                G+S F+  +  L K   H+   + P + + +E  D D+      D +D       S  +L      K  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   +SG KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+ +      TS P+ +    V V    P+S + AGK E + LF +  EA++I +  G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  +  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M     +    +   T+   ++   +F++ L     +PQH +PD+F++M+ +N RVAY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA++++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K           +L  +   V D  +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFS--AMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGD--KPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMI-KTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----------ADLPPINGPV-DVDRG----PIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1229          

HSP 2 Score: 500.745 bits (1288), Expect = 5.471e-145
Identity = 262/589 (44.48%), Postives = 363/589 (61.63%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V       +D+  E   +S    F                         +DP  ++ +VRVYVV+  +LHPADINGKADPYI +R+G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC+   +  P +      V++  + F   S IED++G +  + E +AL+ L +WEDI    C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR++I  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD SF+ FLNP  + +YF+
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVP----LPEDVSREAGYDSTYGMF--------------------QGIPSNDP--INVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPG-RVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFL 1958          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 394/1283 (30.71%), Postives = 652/1283 (50.82%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVS-----------GNENL--------------------------------GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVE-SDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPK---HIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+L++ L++++ ++   +   KV FR   F +   +  +   +    F WP+A  +D+ + L I+    ++   +KL G   +VL  ++ +  + + +T +D+   I   +L  E+ Y +              G+E+L                                G+S F+  +  L K   H+   + P + + +E  D D+      D +D       S  +L      K  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   +SG KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+ +      TS P+ +    V V    P+S + AGK E + LF +  EA++I +  G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  +  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M     +    +   T+   ++   +F++ L     +PQH +PD+F++M+ +N RVAY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA++++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K           +L  +   V D  +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFS--AMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGD--KPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMI-KTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----------ADLPPINGPV-DVDRG----PIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1229          

HSP 2 Score: 501.13 bits (1289), Expect = 4.174e-145
Identity = 264/592 (44.59%), Postives = 364/592 (61.49%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V       +D+  E   +S    F                         +DP  ++ +VRVYVV+  +LHPADINGKADPYI +R+G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC+   +  P +      V++  + F   S IED++G +  + E +AL+ L +WEDI    C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR++I  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD +F+ FLNP  +IKY I  R
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVP----LPEDVSREAGYDSTYGMF--------------------QGIPSNDP--INVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPG-RVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTR 1961          
BLAST of Otoferlin vs. Ensembl Human
Match: FER1L6 (fer-1 like family member 6 [Source:HGNC Symbol;Acc:HGNC:28065])

HSP 1 Score: 553.132 bits (1424), Expect = 9.417e-164
Identity = 388/1282 (30.27%), Postives = 623/1282 (48.60%), Query Frame = 1
Query:  511 SDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKV-IGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-------------------------------------------TSQPDSIKIG---VDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKK------EENF-------ESQYVHSLTEPKYAYTF---------DNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKM-KMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFT----SKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLE--NLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLD--HESDHLQ-------SLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVT--------------NPVPGEPEK-----------------LIRFVPKEEMESA-DWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDI 4005
             DT +++ +  + +  P  D+   D   +   S  P+R  KL   I    ++ +++QI++TI EAR L G+NI+P+  +  G +K+ + +K  TN+PFYNEYF FDF   ++ L ++II+I         V  H   G V IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV+  GD  K   KT   E+P IE N+LIP      +R      V +Y+AE LP MN+ IM+N+ +A +GD K L DP+VEVSFAG  G T V      P W++Q+IF E FPP   R++I V D   + D  ++T FIDL KI N  + ++ GFLPT+GP+WINLYG+PR +S   ++   Q  N+   EGV+FRGR+L+ I                                              SQ  S K     V+V S +     V  K E +LLF + FEAT+I ++IG K  P++FE+SIG  G   D  SH   K      EE+        +    H +  P  + T          +  Y ++P+ +KKPC+Y I+   D   RL   N+L+K+   L E + +V  L    ++    + +K  +  F       +S  +       +T LD K   L    LE M K +  +  +     ++D  I +  +FV+ +   + +PQH +PDVF++M+ +N RVAY RI ++DL++S +  + G+ CG + T +LK        +   +++QA++ +YLWLG +K        LP G+  +  +    +  PP  + Y E+  FQLR ++Y  R LI +D +GLSDPF KV    H + + +  +T SP W++ ++ +++V + + K +   PP VV+E++D D+    E++G     P V +   +Y   +L +  ++ G +  GD+L  F+L+++ P      + G P +E  ++ ++                  +P ++RP +  +R+E+L WGVR++++++++S                V++P+ +IE GG  +KS +I+ +  +PNF+    +  + LP N    PP+SI  +++  FG   +VG + I  L ++    K+ E L    + D  Q       SLTA     A+S      A     +  P  T     + A+P +                PV  EP K                   R +  E  E+  DWW++YYA+L          P+ +        DE+  DI
Sbjct:   29 GDTEALQEEPSHQEG-PRGDLVHDDASIFPVPSASPKRRSKLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKIS--------VFHHKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKTSDTEEP-IEKNLLIPNGF-PLERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDK-GFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGDK--PISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEK-MKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPG----KRPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAVGKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPPSG----LQGLPPVEPPDITQIYP----------------VPANIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINYLKQFLC--KLREPLAPITQVDGTQPGHDISDSLTATESSGAHSSSQDPPADHIYVDVEPPPTVVPDSAQAQPAILVDVPDSSPMLEPEHTPVAQEPPKDGKPKDPRKPSRRSTKRRKRTIADESAENVIDWWSKYYASLKKAQKAKERNPKGKKGNTEAKPDEVVVDI 1250          

HSP 2 Score: 493.426 bits (1269), Expect = 4.475e-143
Identity = 276/625 (44.16%), Postives = 381/625 (60.96%), Query Frame = 1
Query: 4234 IKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMI-EDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDS-IVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD--PFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            ++IY  +LE+  ++  F+   ++F L+RGK  E+D G +  DR  G FKG+ CIY   +D+  E        D  +L                      ++ + +   H V  ++RVY+V   NL PAD +GK+DPYI++++G  EI+DR+ YIPK LNP+FGR FE++ TFP+ES L + +YD D +  DDLIGET IDLENR+ S HR  CGL S Y   GY  W+D+  PT IL  LC+ N +  P +      ++I  + F+  ++  E+D    ++S E LAL VLH+WEDI PE  C+LV EHIETRPLY ++KPG+EQG L+MWVDMFP     P PP+DISPR+P  YELR+ I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRF+F F YL AE   ++ K +NI+ +++ E KTP  L +QV D + L SD  +G L+  L+ FP+ AK  K+CD   F+++    K ++F+ K+VRGWWP                E+ G VE E  LV  EEAE NP G  R+EP PL KPNRPD SF  F++P+  + Y I    K  +I   I++I ++ +VLFIY  PG  SR IV
Sbjct: 1277 LQIYDGDLES--EFNNFEDWVKTFELFRGKSTEDDHGLD-GDRVIGKFKGSFCIYKSPQDSSSE--------DSGQL----------------------RIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHP--GKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDI-PEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPF-----------SKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 498.434 bits (1282), Expect = 2.573e-149
Identity = 264/592 (44.59%), Postives = 364/592 (61.49%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V       +D+  E   +S    F                         +DP  ++ +VRVYVV+  +LHPADINGKADPYI +R+G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC+   +  P +      V++  + F   S IED++G +  + E +AL+ L +WEDI    C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR++I  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD +F+ FLNP  +IKY I  R
Sbjct:  638 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVP----LPEDVSREAGYDSTYGMF--------------------QGIPSNDP--INVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPG-RVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLAR------NENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTR 1194          

HSP 2 Score: 250.366 bits (638), Expect = 1.619e-66
Identity = 149/509 (29.27%), Postives = 258/509 (50.69%), Query Frame = 1
Query: 2152 RYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            R ++  +E       + LS     +G + +T LD +  K     LE M     +    +   T+   ++   +F++ L     +PQH +PD+F++M+ +N RVAY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA++++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K           +L  +   V D  +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:   11 RRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----------ADLPPINGPV-DVDRG----PIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 482          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 497.664 bits (1280), Expect = 4.120e-149
Identity = 262/589 (44.48%), Postives = 363/589 (61.63%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V       +D+  E   +S    F                         +DP  ++ +VRVYVV+  +LHPADINGKADPYI +R+G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC+   +  P +      V++  + F   S IED++G +  + E +AL+ L +WEDI    C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR++I  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD SF+ FLNP  + +YF+
Sbjct:  638 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVP----LPEDVSREAGYDSTYGMF--------------------QGIPSNDP--INVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPG-RVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFL 1191          

HSP 2 Score: 250.751 bits (639), Expect = 1.171e-66
Identity = 149/509 (29.27%), Postives = 258/509 (50.69%), Query Frame = 1
Query: 2152 RYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            R ++  +E       + LS     +G + +T LD +  K     LE M     +    +   T+   ++   +F++ L     +PQH +PD+F++M+ +N RVAY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA++++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K           +L  +   V D  +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:   11 RRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----------ADLPPINGPV-DVDRG----PIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 482          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 126.331 bits (316), Expect = 1.939e-28
Identity = 109/380 (28.68%), Postives = 164/380 (43.16%), Query Frame = 1
Query: 5059 GSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFP-SGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKF------PKPAKYYKS---------------------CDPFQHSDACA-------------------------KFNLFKNKKVRGWWPLV---YNPKXXXXXXXNGLEIG-------GTVEMEMDLVLGEEAESNPAGLGREEPLP---LEKPNRPDGSFLNFLNPW------NTIKYFIKY 5982
            GSQ   L+ +AL +L        +  LV EH+E+RPL+  +    ++G L M+VD+FP    AIP P +I+PRKP +Y+LRI ++          +F   E   D+Y+KA++        KTDTHFR L G G FNWRF+  FDY   E  +V   KN +     E      L +++ D +    D ++G ++  L  F      P     Y +                     C  F     C                            N+F+++ + GWWP++   Y  ++    ++   ++G       G VEM+M L+  +EA+  PAG  R EP     LEKP+R      ++ N W        IKYF  Y
Sbjct: 1635 GSQ---LQTIALFILR-------QMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK-----SWANSWLVSRIKPCIKYFWHY 1996          

HSP 2 Score: 97.4413 bits (241), Expect = 1.208e-19
Identity = 54/148 (36.49%), Postives = 77/148 (52.03%), Query Frame = 1
Query: 4564 VDFI------VRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYD 4989
            VDF+      VRVY+++   L      G+ D Y+ +  G + +  ++NY  +  +PIFG   +M VT P E  L + V    R+  D  IG TTIDLENR L+  R T GL   +   G ++W+D   P  ILKS C K  +  PK +
Sbjct: 1375 VDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIE 1522          

HSP 3 Score: 89.3521 bits (220), Expect = 2.917e-17
Identity = 91/405 (22.47%), Postives = 174/405 (42.96%), Query Frame = 1
Query: 2731 MEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNV-YRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLI---SVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY--YVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDL 3927
            M+   +QLR Y+  G +L+    +  S  FV++   ++ +++ +   +++PIW+ET++  +++     + +   PP V +E+    S+ +E  +G    +P+V I G+       QW+ + +      G +L  F+L   +              ++L+ +  +   N K     E+  IP + RP    F ++ L WGVR L        K+H ++ ++R        P + + IG        ++D    PNF + +I    VI  LP   +  PP+ IN  +   F  + +VG+ +++DL +Y  ++  K+      +SDH +    Q D+      V  + FD             ++    P +T                + M   DWW+RYYA++   
Sbjct:  967 MQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEED-------------KDLIPLEPKCKHNYK-----ERSEIPTEFRPQFDKFHVQFLCWGVRNL--------KKHKLLAVRR--------PFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVI--LPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKV------KSDHAERW-EQLDL------VITEEFDQI-----------IRMVRVPTLTT---------------DPMVPLDWWSRYYASMSQF 1294          

HSP 4 Score: 75.0998 bits (183), Expect = 6.613e-13
Identity = 120/604 (19.87%), Postives = 232/604 (38.41%), Query Frame = 1
Query:  931 IGEFSIDAKTVYSNESHSFFYKWAVL----IDPKAP---TSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWN-------QQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPV--SNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRG------KKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTA-KKTLLDVKYQKLIRM--GLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQ--AQLQIYLWLGLLKDMRLYK 2661
            +GEFS     V  +   S   KW  L    +D + P        G++KV LSV    + P      D +E           QI          + + V+  E L     + M N ++      K     YV V    +   T + S     D N       Q+I    ++P  +S +  ++ D        I    + +  I       E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  F GRL IAI      +     +     +P+  + ++    E Y  F S+    +I  +      P+   +SIG+ G   +E+            +  +S T P        +YF +P+ + +P   + AP E    R+ + N+L K+   L   + +V  + ++         ++A+  +++ ++    S  K L  I      A  + +LD + +K++++    EK   S   +   +    + M +K  +  ++  +    D Q  +P V + M+     + + +I   ++  S    + G+ CG    + ++   +  L  + N   +  A L   +W G    +  +K
Sbjct:  175 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKE-----------QIWSGAHLIDYTLKIRVFSVEQL----IRQMINERKI-----KKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFAS--DPVCIMMSIGSFGSTSNEF------------RSCNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQID----SASKYLGRINPVSSNALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAE----DVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ---WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 727          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 125.946 bits (315), Expect = 2.181e-28
Identity = 109/380 (28.68%), Postives = 164/380 (43.16%), Query Frame = 1
Query: 5059 GSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFP-SGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKF------PKPAKYYKS---------------------CDPFQHSDACA-------------------------KFNLFKNKKVRGWWPLV---YNPKXXXXXXXNGLEIG-------GTVEMEMDLVLGEEAESNPAGLGREEPLP---LEKPNRPDGSFLNFLNPW------NTIKYFIKY 5982
            GSQ   L+ +AL +L        +  LV EH+E+RPL+  +    ++G L M+VD+FP    AIP P +I+PRKP +Y+LRI ++          +F   E   D+Y+KA++        KTDTHFR L G G FNWRF+  FDY   E  +V   KN +     E      L +++ D +    D ++G ++  L  F      P     Y +                     C  F     C                            N+F+++ + GWWP++   Y  ++    ++   ++G       G VEM+M L+  +EA+  PAG  R EP     LEKP+R      ++ N W        IKYF  Y
Sbjct: 1508 GSQ---LQTIALFILR-------QMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK-----SWANSWLVSRIKPCIKYFWHY 1869          

HSP 2 Score: 97.0561 bits (240), Expect = 1.335e-19
Identity = 54/148 (36.49%), Postives = 77/148 (52.03%), Query Frame = 1
Query: 4564 VDFI------VRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYD 4989
            VDF+      VRVY+++   L      G+ D Y+ +  G + +  ++NY  +  +PIFG   +M VT P E  L + V    R+  D  IG TTIDLENR L+  R T GL   +   G ++W+D   P  ILKS C K  +  PK +
Sbjct: 1248 VDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIE 1395          

HSP 3 Score: 89.7373 bits (221), Expect = 2.596e-17
Identity = 91/405 (22.47%), Postives = 174/405 (42.96%), Query Frame = 1
Query: 2731 MEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNV-YRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLI---SVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY--YVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDL 3927
            M+   +QLR Y+  G +L+    +  S  FV++   ++ +++ +   +++PIW+ET++  +++     + +   PP V +E+    S+ +E  +G    +P+V I G+       QW+ + +      G +L  F+L   +              ++L+ +  +   N K     E+  IP + RP    F ++ L WGVR L        K+H ++ ++R        P + + IG        ++D    PNF + +I    VI  LP   +  PP+ IN  +   F  + +VG+ +++DL +Y  ++  K+      +SDH +    Q D+      V  + FD             ++    P +T                + M   DWW+RYYA++   
Sbjct:  840 MQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEED-------------KDLIPLEPKCKHNYK-----ERSEIPTEFRPQFDKFHVQFLCWGVRNL--------KKHKLLAVRR--------PFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVI--LPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKV------KSDHAERW-EQLDL------VITEEFDQI-----------IRMVRVPTLTT---------------DPMVPLDWWSRYYASMSQF 1167          

HSP 4 Score: 75.0998 bits (183), Expect = 5.757e-13
Identity = 120/604 (19.87%), Postives = 232/604 (38.41%), Query Frame = 1
Query:  931 IGEFSIDAKTVYSNESHSFFYKWAVL----IDPKAP---TSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWN-------QQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPV--SNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRG------KKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTA-KKTLLDVKYQKLIRM--GLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQ--AQLQIYLWLGLLKDMRLYK 2661
            +GEFS     V  +   S   KW  L    +D + P        G++KV LSV    + P      D +E           QI          + + V+  E L     + M N ++      K     YV V    +   T + S     D N       Q+I    ++P  +S +  ++ D        I    + +  I       E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  F GRL IAI      +     +     +P+  + ++    E Y  F S+    +I  +      P+   +SIG+ G   +E+            +  +S T P        +YF +P+ + +P   + AP E    R+ + N+L K+   L   + +V  + ++         ++A+  +++ ++    S  K L  I      A  + +LD + +K++++    EK   S   +   +    + M +K  +  ++  +    D Q  +P V + M+     + + +I   ++  S    + G+ CG    + ++   +  L  + N   +  A L   +W G    +  +K
Sbjct:   48 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKE-----------QIWSGAHLIDYTLKIRVFSVEQL----IRQMINERKI-----KKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFAS--DPVCIMMSIGSFGSTSNEF------------RSCNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQID----SASKYLGRINPVSSNALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAE----DVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ---WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 600          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 125.946 bits (315), Expect = 2.181e-28
Identity = 109/380 (28.68%), Postives = 164/380 (43.16%), Query Frame = 1
Query: 5059 GSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFP-SGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKF------PKPAKYYKS---------------------CDPFQHSDACA-------------------------KFNLFKNKKVRGWWPLV---YNPKXXXXXXXNGLEIG-------GTVEMEMDLVLGEEAESNPAGLGREEPLP---LEKPNRPDGSFLNFLNPW------NTIKYFIKY 5982
            GSQ   L+ +AL +L        +  LV EH+E+RPL+  +    ++G L M+VD+FP    AIP P +I+PRKP +Y+LRI ++          +F   E   D+Y+KA++        KTDTHFR L G G FNWRF+  FDY   E  +V   KN +     E      L +++ D +    D ++G ++  L  F      P     Y +                     C  F     C                            N+F+++ + GWWP++   Y  ++    ++   ++G       G VEM+M L+  +EA+  PAG  R EP     LEKP+R      ++ N W        IKYF  Y
Sbjct: 1508 GSQ---LQTIALFILR-------QMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK-----SWANSWLVSRIKPCIKYFWHY 1869          

HSP 2 Score: 97.0561 bits (240), Expect = 1.335e-19
Identity = 54/148 (36.49%), Postives = 77/148 (52.03%), Query Frame = 1
Query: 4564 VDFI------VRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYD 4989
            VDF+      VRVY+++   L      G+ D Y+ +  G + +  ++NY  +  +PIFG   +M VT P E  L + V    R+  D  IG TTIDLENR L+  R T GL   +   G ++W+D   P  ILKS C K  +  PK +
Sbjct: 1248 VDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIE 1395          

HSP 3 Score: 89.7373 bits (221), Expect = 2.596e-17
Identity = 91/405 (22.47%), Postives = 174/405 (42.96%), Query Frame = 1
Query: 2731 MEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNV-YRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLI---SVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY--YVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDL 3927
            M+   +QLR Y+  G +L+    +  S  FV++   ++ +++ +   +++PIW+ET++  +++     + +   PP V +E+    S+ +E  +G    +P+V I G+       QW+ + +      G +L  F+L   +              ++L+ +  +   N K     E+  IP + RP    F ++ L WGVR L        K+H ++ ++R        P + + IG        ++D    PNF + +I    VI  LP   +  PP+ IN  +   F  + +VG+ +++DL +Y  ++  K+      +SDH +    Q D+      V  + FD             ++    P +T                + M   DWW+RYYA++   
Sbjct:  840 MQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEED-------------KDLIPLEPKCKHNYK-----ERSEIPTEFRPQFDKFHVQFLCWGVRNL--------KKHKLLAVRR--------PFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVI--LPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKV------KSDHAERW-EQLDL------VITEEFDQI-----------IRMVRVPTLTT---------------DPMVPLDWWSRYYASMSQF 1167          

HSP 4 Score: 75.0998 bits (183), Expect = 5.757e-13
Identity = 120/604 (19.87%), Postives = 232/604 (38.41%), Query Frame = 1
Query:  931 IGEFSIDAKTVYSNESHSFFYKWAVL----IDPKAP---TSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWN-------QQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPV--SNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRG------KKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTA-KKTLLDVKYQKLIRM--GLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQ--AQLQIYLWLGLLKDMRLYK 2661
            +GEFS     V  +   S   KW  L    +D + P        G++KV LSV    + P      D +E           QI          + + V+  E L     + M N ++      K     YV V    +   T + S     D N       Q+I    ++P  +S +  ++ D        I    + +  I       E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  F GRL IAI      +     +     +P+  + ++    E Y  F S+    +I  +      P+   +SIG+ G   +E+            +  +S T P        +YF +P+ + +P   + AP E    R+ + N+L K+   L   + +V  + ++         ++A+  +++ ++    S  K L  I      A  + +LD + +K++++    EK   S   +   +    + M +K  +  ++  +    D Q  +P V + M+     + + +I   ++  S    + G+ CG    + ++   +  L  + N   +  A L   +W G    +  +K
Sbjct:   48 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKE-----------QIWSGAHLIDYTLKIRVFSVEQL----IRQMINERKI-----KKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFAS--DPVCIMMSIGSFGSTSNEF------------RSCNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQID----SASKYLGRINPVSSNALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAE----DVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ---WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 600          
BLAST of Otoferlin vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 57.3806 bits (137), Expect = 8.502e-8
Identity = 30/84 (35.71%), Postives = 47/84 (55.95%), Query Frame = 1
Query: 4582 VYVVKGINLHPADINGKADPYILVR--IGNKEIRDRENYIPKT-LNPIFGRCFEMEVTFPQ--ESFLLVQVYDWDRLTKDDLIG 4818
            + V K  NL P DI G +DPY+ +      K  + +++   +  LNP+F      ++   Q  E+ +L+QV DWDR+ KDDL+G
Sbjct:  286 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 369          
BLAST of Otoferlin vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 56.9954 bits (136), Expect = 9.012e-8
Identity = 30/84 (35.71%), Postives = 47/84 (55.95%), Query Frame = 1
Query: 4582 VYVVKGINLHPADINGKADPYILVR--IGNKEIRDRENYIPKT-LNPIFGRCFEMEVTFPQ--ESFLLVQVYDWDRLTKDDLIG 4818
            + V K  NL P DI G +DPY+ +      K  + +++   +  LNP+F      ++   Q  E+ +L+QV DWDR+ KDDL+G
Sbjct:  221 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 304          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273291)

HSP 1 Score: 318.931 bits (816), Expect = 1.642e-93
Identity = 177/474 (37.34%), Postives = 264/474 (55.70%), Query Frame = 1
Query: 4561 SVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +V  +VRVYVV+G+ + P D+ G +D Y+ + +G K   DR ++ P   NP+FGR FEME T P +  L V VYD D++ KD++IG+T IDLE+RW + HR T GL + Y   GY  W D +LP+ IL  LC+K  I  P Y    + +E+ G  F  +++I  D+  Q    E L+L VL N  D +P    KLV EH+ETR L   + P +EQG L++W+++F +   +P PIDI+P  PA +E+R+V+     ++  D N F K  S D+Y+  W +  D   Q TD H+RS +G   FNWR VF   Y   ED +V + K    ++E E+K P  + +QV D D+L  D  +  L+  LS    P    + C P+       + NLFK K + GW+PL  N      +        G +++ +++    EA + PAG G++ P+ LE P RPD SF    +P  + ++ +
Sbjct:  152 TVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNM-DKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMS-DVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR--KRINLFKRKVINGWFPLQSN--AHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 610          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273287)

HSP 1 Score: 320.472 bits (820), Expect = 8.961e-89
Identity = 177/474 (37.34%), Postives = 264/474 (55.70%), Query Frame = 1
Query: 4561 SVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +V  +VRVYVV+G+ + P D+ G +D Y+ + +G K   DR ++ P   NP+FGR FEME T P +  L V VYD D++ KD++IG+T IDLE+RW + HR T GL + Y   GY  W D +LP+ IL  LC+K  I  P Y    + +E+ G  F  +++I  D+  Q    E L+L VL N  D +P    KLV EH+ETR L   + P +EQG L++W+++F +   +P PIDI+P  PA +E+R+V+     ++  D N F K  S D+Y+  W +  D   Q TD H+RS +G   FNWR VF   Y   ED +V + K    ++E E+K P  + +QV D D+L  D  +  L+  LS    P    + C P+       + NLFK K + GW+PL  N      +        G +++ +++    EA + PAG G++ P+ LE P RPD SF    +P  + ++ +
Sbjct:  855 TVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNM-DKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMS-DVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR--KRINLFKRKVINGWFPLQSN--AHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1313          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273290)

HSP 1 Score: 319.316 bits (817), Expect = 3.414e-88
Identity = 177/474 (37.34%), Postives = 264/474 (55.70%), Query Frame = 1
Query: 4561 SVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +V  +VRVYVV+G+ + P D+ G +D Y+ + +G K   DR ++ P   NP+FGR FEME T P +  L V VYD D++ KD++IG+T IDLE+RW + HR T GL + Y   GY  W D +LP+ IL  LC+K  I  P Y    + +E+ G  F  +++I  D+  Q    E L+L VL N  D +P    KLV EH+ETR L   + P +EQG L++W+++F +   +P PIDI+P  PA +E+R+V+     ++  D N F K  S D+Y+  W +  D   Q TD H+RS +G   FNWR VF   Y   ED +V + K    ++E E+K P  + +QV D D+L  D  +  L+  LS    P    + C P+       + NLFK K + GW+PL  N      +        G +++ +++    EA + PAG G++ P+ LE P RPD SF    +P  + ++ +
Sbjct:  943 TVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNM-DKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMS-DVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR--KRINLFKRKVINGWFPLQSN--AHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1401          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273289)

HSP 1 Score: 319.701 bits (818), Expect = 8.227e-88
Identity = 177/474 (37.34%), Postives = 264/474 (55.70%), Query Frame = 1
Query: 4561 SVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +V  +VRVYVV+G+ + P D+ G +D Y+ + +G K   DR ++ P   NP+FGR FEME T P +  L V VYD D++ KD++IG+T IDLE+RW + HR T GL + Y   GY  W D +LP+ IL  LC+K  I  P Y    + +E+ G  F  +++I  D+  Q    E L+L VL N  D +P    KLV EH+ETR L   + P +EQG L++W+++F +   +P PIDI+P  PA +E+R+V+     ++  D N F K  S D+Y+  W +  D   Q TD H+RS +G   FNWR VF   Y   ED +V + K    ++E E+K P  + +QV D D+L  D  +  L+  LS    P    + C P+       + NLFK K + GW+PL  N      +        G +++ +++    EA + PAG G++ P+ LE P RPD SF    +P  + ++ +
Sbjct: 1151 TVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNM-DKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMS-DVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR--KRINLFKRKVINGWFPLQSNAH--PSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1609          

HSP 2 Score: 79.337 bits (194), Expect = 4.542e-14
Identity = 66/307 (21.50%), Postives = 133/307 (43.32%), Query Frame = 1
Query:  670 KDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTS------GEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAIL---GDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLY 1563
            ++F I +T+++A  +          +   K  + T+    T  PF+NEYF F+F  +  EL+   I  +    K H+  +      V+GE  +D  +V++  +H +F KW  L  P              G++++DL+++ +   P       +E+D        +       ++++            L  +N    SNI+  +    G     ++  ++VSFAG+ G T V+  + +P WN +I F   +P    R  I +   + ++ + ++   + L +I  +         P+ GP++++LY
Sbjct:   13 QEFLICITVHKAAQVGVTTGELYVRISLDKMTKSTKSFPNTENPFFNEYFVFEFHCTLTELLRLTILFEL---KKHMTYKK---NVVVGELLVDLHSVWNQSNHGYFKKWGRLEAPIGENQTLENAVAPHGYLQLDLAIV-SQHSPVSYALGSEEQDTQNLNKWTVDHDFDDIEKNL------------LTNVNIFAPSNIRYFVAFYRGYFIKQSNYMIQVSFAGFNGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWKCVAEFELCLEEIAFNGT-------PSLGPTYLHLY 293          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273285)

HSP 1 Score: 306.99 bits (785), Expect = 5.329e-86
Identity = 171/453 (37.75%), Postives = 253/453 (55.85%), Query Frame = 1
Query: 4561 SVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKP 5913
            +V  +VRVYVV+G+ + P D+ G +D Y+ + +G K   DR ++ P   NP+FGR FEME T P +  L V VYD D++ KD++IG+T IDLE+RW + HR T GL + Y   GY  W D +LP+ IL  LC+K  I  P Y    + +E+ G  F  +++I  D+  Q    E L+L VL N  D +P    KLV EH+ETR L   + P +EQG L++W+++F +   +P PIDI+P  PA +E+R+V+     ++  D N F K  S D+Y+  W +  D   Q TD H+RS +G   FNWR VF   Y   ED +V + K    ++E E+K P  + +QV D D+L  D  +  L+  LS    P    + C P+       + NLFK K + GW+PL  N      +        G +++ +++    EA + PAG G++ P+ LE P
Sbjct:  608 TVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNM-DKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMS-DVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR--KRINLFKRKVINGWFPLQSN--AHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPP 1045          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 422/1392 (30.32%), Postives = 698/1392 (50.14%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEY------------------------------NSPVSGNENL-----GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP---SDDIDVK--------DGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIK-----TTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYS-----------------------HLPKKEENFESQYVHSL--TEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIE--YYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSD-----AKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATL 3918
            M+L+V L+++T ++   +   KV FR   F +   +  +        F WPI  ++D  + L I+    ++   ++L G   +VL  ++ +  + + +T +D+        ++ EI+Y                              +S +SG         G+S   +P++   K  +          T + + D   GD+     ++D+D K        D D  S  S+      +  +  K    ++P S +  D+QISVT+ EAR L G N++P+  V  G++K+ T +K  TN P+YNEYF FDF +    + ++II+I  +  K+ + +     G ++G F +D  TVY+   H F +KWA+L DP   T+G KG+VK D++V+  GD  K P+K  + ++ +IE N+L+P+ +  ++R      V +Y+AE LP MNT IM+N+K+A +G+ + L DPYV V FAG  G T V   SY P WN+Q+IFTE FPP   RL++ +RDSD + D  I T FIDL K+ N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLLI+I      TTS        V +   + +S +  GK E + LF S  EAT+I ++IG   KP++FE++IG  G   D  S                       H   +EE  +   + S+  T P      D  YFH+PY  KKPC+Y+ +  +D R RL+  NI+DK+  +L E +  V  +  + +K    R ++  +E    S  + ++     +  + +T LD +  K     +E M          +   T+   +K + +F++ L     +PQH +PDVF++MI +N R+AY RI ++D+++S +  E G+ CG V  V+L+      LP K       + +QA+L++YLWLGL K  + + +GLP GF      K      +PP  + Y  +  FQLR ++Y  R+L  +D SGLSDPF +V    H + + V  ET  P WD+ ++ DN+        ++  PP +V+E++D D+    EFIGR F +P   +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  +       P ++          D+ +G      L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L +  Y   DK   +  H  D + +++ + ++K     V  +A           T A VK D      + +       + E++    P E M   DWW++Y+A++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFR--KAGKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNLLRS-----GTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGV-PSERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEII-KTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLR------LPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPIDG-------PTDSDRG----PILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFIYSPPDKTANNWAHTGDIVVNMSPEPNIKKMDTVVKIEA----------TTDAVVKVDLNEDEKEKEKKKKKKKKGEEVEEEEPDESM--LDWWSKYFASI 1326          

HSP 2 Score: 509.99 bits (1312), Expect = 2.558e-148
Identity = 268/597 (44.89%), Postives = 371/597 (62.14%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEI-QDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            ++ + +Y+ ELE+  ++G F+    +F+LYRGK  ++DD   + +DR  G FKG++C+Y +   + I  +  FD +                             +  F S PH+  ++ +VR+Y+++  +LHPADINGKADPYI++++G  +IRD+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+ S Y+ HGY  W+D Q P  IL  LC++  +  P Y      V++  + F   + IED+ G + ++ E LAL VL +WE+I P   CKL+ EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRFVF FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L+KFP+ AK  K C  D           ++FK K+V+GWWP V       + E +  E+ G VE E+ L+  EEAE +P GLGR +P PLEKPNRPD +FL FL+P   I+Y I  R
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPN-----------------------------MGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEI-PRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFV------AQNENDEFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTTFLWFLSPLKAIRYLICNR 1956          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 422/1392 (30.32%), Postives = 698/1392 (50.14%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEY------------------------------NSPVSGNENL-----GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP---SDDIDVK--------DGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIK-----TTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYS-----------------------HLPKKEENFESQYVHSL--TEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIE--YYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSD-----AKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATL 3918
            M+L+V L+++T ++   +   KV FR   F +   +  +        F WPI  ++D  + L I+    ++   ++L G   +VL  ++ +  + + +T +D+        ++ EI+Y                              +S +SG         G+S   +P++   K  +          T + + D   GD+     ++D+D K        D D  S  S+      +  +  K    ++P S +  D+QISVT+ EAR L G N++P+  V  G++K+ T +K  TN P+YNEYF FDF +    + ++II+I  +  K+ + +     G ++G F +D  TVY+   H F +KWA+L DP   T+G KG+VK D++V+  GD  K P+K  + ++ +IE N+L+P+ +  ++R      V +Y+AE LP MNT IM+N+K+A +G+ + L DPYV V FAG  G T V   SY P WN+Q+IFTE FPP   RL++ +RDSD + D  I T FIDL K+ N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLLI+I      TTS        V +   + +S +  GK E + LF S  EAT+I ++IG   KP++FE++IG  G   D  S                       H   +EE  +   + S+  T P      D  YFH+PY  KKPC+Y+ +  +D R RL+  NI+DK+  +L E +  V  +  + +K    R ++  +E    S  + ++     +  + +T LD +  K     +E M          +   T+   +K + +F++ L     +PQH +PDVF++MI +N R+AY RI ++D+++S +  E G+ CG V  V+L+      LP K       + +QA+L++YLWLGL K  + + +GLP GF      K      +PP  + Y  +  FQLR ++Y  R+L  +D SGLSDPF +V    H + + V  ET  P WD+ ++ DN+        ++  PP +V+E++D D+    EFIGR F +P   +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  +       P ++          D+ +G      L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L +  Y   DK   +  H  D + +++ + ++K     V  +A           T A VK D      + +       + E++    P E M   DWW++Y+A++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFR--KAGKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNLLRS-----GTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGV-PSERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEII-KTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLR------LPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPIDG-------PTDSDRG----PILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFIYSPPDKTANNWAHTGDIVVNMSPEPNIKKMDTVVKIEA----------TTDAVVKVDLNEDEKEKEKKKKKKKKGEEVEEEEPDESM--LDWWSKYFASI 1326          

HSP 2 Score: 511.146 bits (1315), Expect = 1.152e-148
Identity = 267/594 (44.95%), Postives = 371/594 (62.46%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEI-QDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            ++ + +Y+ ELE+  ++G F+    +F+LYRGK  ++DD   + +DR  G FKG++C+Y +   + I  +  FD +                             +  F S PH+  ++ +VR+Y+++  +LHPADINGKADPYI++++G  +IRD+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+ S Y+ HGY  W+D Q P  IL  LC++  +  P Y      V++  + F   + IED+ G + ++ E LAL VL +WE+I P   CKL+ EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRFVF FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L+KFP+ AK  K C  D           ++FK K+V+GWWP V       + E +  E+ G VE E+ L+  EEAE +P GLGR +P PLEKPNRPD S + F+NP  +I+YFI
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPN-----------------------------MGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEI-PRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFV------AQNENDEFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFI 1953          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 360/1087 (33.12%), Postives = 590/1087 (54.28%), Query Frame = 1
Query:  535 DSDNGDNEPS----DDIDVKDGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPDSI-KIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKE-----ENFESQYVH----------------SLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSF---VKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            D   G +EP+    +D+ + D D  S  S+      +  +  K    I+P + +  DFQ+SVT+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +    + ++I+++  +  K+ + +     G ++G F +D  T+Y+   H FF+KWA L DP+  T+G KG+VK D++V+  GD  K P+K ++ ++ +IE+N+L+P+ +   +R      + +Y+AE LP MNT IM+N+K+A +G+ K L DPYV+V FAG  G T +   SY P WN+QI+FTE+FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R+Y+   ++   Q  N+ L EGV+FR RLLI++      TS P+ +    V V     +S+N  GK E + LF S  EAT+I ++IG   KP+ FE++IG  G   D  +    K+     ++ ES+ +H                S T P      D  YFH+PY  +KPC+Y+ +  +D R RL+  N+LDK+  +L E +  V  +  + +K    R ++  +E    S    +S   + +  A +T LD +  KL    +E M          +    +   IK   +F   ++FL D   +PQH +PD++++MI +N R+AY R+ ++D+++S++  E G+ CG V T++ K      LP K       + +QA+ ++YLWLGL +  + Y  GLP GF      K       PP  + Y  +  FQLRV++Y  R+L  +D +GLSDPF ++    H + + V +ET  P WD+ ++ D++        ++  PP +V+EI+D D+    +F+GR F +P   +  + Y   +    L+++ +YRG   AG++L +F+L++I P  K       P ++          D  +G      L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L ++
Sbjct:   11 DDGKGQDEPAILETEDMRMPDPDTISLASVTAVTTNVSNKRSKPDIKIEPSAGRPMDFQVSVTVIEARQLVGLNMDPVVCVEIGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRS-----GTLVGSFKLDVGTIYTQPDHQFFHKWATLCDPEDITAGLKGYVKCDIAVVAKGDTIKTPHKANENDEDDIESNLLLPEDV-PAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLVDPYVQVLFAGQKGKTSIQKSSYEPIWNEQIVFTEQFPPLCRRMKLQIRDSDKVNDVAIGTHFIDLRKIANDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEVMSSTEVQVEGIPNISDNATGKVEEFFLFGSFLEATMIDRKIGD--KPINFEVTIGNYGSELDTPTKPKSKKKKGDGDDEESELIHGSSDEEVDDGGDVTSVSTTPPMKPVITDRNYFHLPYFERKPCIYIYSWWQDQRRRLYNANVLDKMADKLEEGLNDVQEII-KTEKAYPERRLRGVLEELSNSCSTFVSLANNDQNQAGRTKLDKERVKLCMQEVESMGQQAKTMRSQVKKSNVKDRIKLAQNFLHKLRFLSD---EPQHSVPDIYIWMISNNKRIAYARVPSKDILYSSVEEECGKDCGKVQTIFFK------LPGKKSFGPAGWTVQAKTELYLWLGLNRQRKDYLCGLPNGFEENKAVKGPGVQSSPPISLMYTMKQIFQLRVHMYQARSLFAADSTGLSDPFARIFFSTHSQVTEVLNETLCPTWDQLLVFDHVELYGEAGELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPGGK----ADLPPIDG-------PTDIDRG----PILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTLRKF 1042          

HSP 2 Score: 504.597 bits (1298), Expect = 1.478e-147
Identity = 262/595 (44.03%), Postives = 369/595 (62.02%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEE---DDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            IE  K+Y+ ELE   +Y  F+    +F+L+RGK  ++   D     +DR  G FKG++CIY V  D++     FD +                             +  F + PH+  ++ +VR+YVV+  +LHPADINGKADPYI +++G  EI+D+ENYI K LNP+FG+ F++E T P +S L V +YDWD +  DDLIGET IDLENR+ S HR TCG+ STY  HGY  W+D   P+ IL  LC+   I  P+Y      V++  + +   + +ED++G + ++ E LAL VL++WEDI P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFP   + P P +DISPRKP  +ELR+++  T+ V L D + FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRF++ FDYL+AE+ IV  K ++++  DE EYK P  LN+QV D+D   +D  +G ++  L++FP+ AK  K C  +   + +     N+FK K+++GWWP V   +       + LEI G VE E+ L+ GEEAE +P G GR EP PLEKPNRPD +FL F+ P   I++ +
Sbjct: 1179 IEEFKVYNRELE--YEYNQFEDWLHTFNLHRGKCSDDADVDQNAADEDRLIGKFKGSLCIYKVSSDDMSRDMGFDSN-----------------------------MGMFQNIPHNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKSEIKDKENYISKQLNPVFGKSFDVEATLPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISSTYAIHGYNVWRDPLKPSHILAKLCKDGKIDAPQYGP-GGRVKVTNRVYTGPTEVEDENGLKKQTDEHLALAVLNHWEDI-PRIGCKLVPEHMETRPLLNPDKPGIEQGRIEMWVDMFPKDMSAPGPALDISPRKPKKFELRVIVWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLQAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMVTNENEMPMVNIFKQKRIKGWWPFVARDE------NDELEITGKVEAELQLLTGEEAEKSPVGEGRNEPEPLEKPNRPDTAFLWFMMPLKAIRHLV 1734          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 464.151 bits (1193), Expect = 4.951e-145
Identity = 272/621 (43.80%), Postives = 368/621 (59.26%), Query Frame = 1
Query: 4240 IYSCELENIKDYGGFKQPFRSFSLYRGKQEEED-DGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIV-PECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVD 6090
            +Y  ELE   ++G F    ++F L+RGK  EED   YE   RF G FKG  C+Y + E         D + +E  + S                    K+ + +    +V+ ++RVY+    NLHPAD +GKADPYI++++G  EI+DR+NYIPK LNP+FGR FE + TFP+ES L + +YD+D +  DDLIGET IDLENR+ S HR TC L + Y   GY  W+D   P  +L  LC++N +  P++      + I  K F   ++  D+D   ++S E LAL VLH W ++    CKLV EHIETR LYL++KPGI+QG L+MWVD+FP     P PP+DISPRKP  YELRI+I  TE+V L DTNF T ++S DIY+K W+K  + D Q+TD H+ SL+G+G FNWRFVF F YL AE  +V  K ++IY +D+ E K P  L MQV D + L SD  +G ++  L  FP+ AK  K+C     ++     ++F+ K+ +GWWP +              E+ G VE E  LV  EEAE NP G  R+EP PLEKPNRPD SF  F+NP+    + I    K  +I  L++LI  L +VL  Y  PG  S  IV+
Sbjct:    1 VYDKELE--AEFGPFDDWVKTFELFRGKANEEDGSAYE---RFVGKFKGRFCLYKLPEA--------DGEAEEGYVDS-----------------GQFKINQGIPPNTAVNVLIRVYIA--FNLHPADPDGKADPYIVLKLGKTEIKDRDNYIPKQLNPVFGRSFEFQATFPKESLLTILIYDYDLVGGDDLIGETQIDLENRFYSRHRATCSLPTEYAIEGYNAWRDCMKPVDLLIKLCKENRLDNPQFSP--GRITIGNKVFMGKTVFPDED-QMVESYEHLALKVLHRWSEMPNGGCKLVPEHIETRALYLKDKPGIDQGHLQMWVDIFPLDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKVVVVQKRESIYSLDKTEQKMPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKSAKACKMEMLTELTENISIFQQKRSKGWWPFI-----------KAGELTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTSFSWFMNPFKCFFHLIWGNYKKYIIAGLVLLILTLFLVLLFYTLPGALSTKIVN 575          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 495.352 bits (1274), Expect = 2.921e-144
Identity = 326/1045 (31.20%), Postives = 522/1045 (49.95%), Query Frame = 1
Query:  664 KIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGD-KPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT--------------------------------TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKE------------ENFESQYVHSLTEPKYAYTFDNQ--YFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLS-AIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIE----CLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH--KDCFTSK--MPPKIIDYMEESD-FQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDL 3627
            K ++FQIS+ I E R L G NI+P   +  G  K+ T +K  TN PFYNEYF FD   ++    +++I++  +  K       I     +G F ID  TVYS   H F  KWA L DP     G KG++K D+SV   GD  P     +D EE   I+ ++L+P+ L   +R      V VY+AE LP +N+ IM+N+ +A +GD  AL DPYVEVSF G  G T     S  P WN+Q++F E FPP   RL+I V D   + D  I T +IDLH I N  + +  GFLPT+GP+WINLYG+ R    + ++   Q  N+ + EGV++RGRL I +                                    +  S  IG +V    P         E +LLF  +FEA++I ++IG +  P+T E +IG  G   D  +  P K+            +   +    S T P+     D Q  Y H+P  ++KPC+Y+ +  ED   RL   N+LD +     E V +V  L  +    +A   +   +  F     + ++ A K  +G+   TLLD K   + +  LE M       +E     L+V  + +  + +   ++FL +   +PQH LPDVF+ ++ +N RVAY RI ARDL+ S  P ++G+ CG + T++LK      + +   + +QA+L ++LWLG   +       LP GF      F  +   PP+ + Y  ++  F+LR ++Y  R LI +D++GLSDPF  V    H + + +  +T +P W++ I + N+        +   PP +V+E++D D     E++G     P V +  ++Y+  +LQ+  ++ G++  GDIL +F+LI+    S        P L+               E D   + +P  +RP +  +R+E+L WG+R+L++++++S                V++P++ I+  G  + S +I+ +  +PNF   + +  + LP +    PP+++  +++  FG   +VG+HVI +L
Sbjct:  102 KPQNFQISINITEIRQLVGDNIDPSVVIEIGDDKKQTSVKEGTNAPFYNEYFVFDIYCNQDIFFDKVIKLSVMHSK-------IMKSYCVGTFKIDVGTVYSQPGHQFINKWATLTDPADIRVGVKGYLKCDISVSGKGDVAPPSQKFSDAEE--QIDKHLLLPEGL-NPERPWARFYVIVYRAEGLPRINSSIMANVTKAFVGDTTALIDPYVEVSFFGQVGRTSTQKSSADPVWNEQVVFKEMFPPLCQRLKIRVLDEGSMNDVAIGTHYIDLHTISNDTDGDN-GFLPTFGPAWINLYGSLRN---STLVDDSQELNEGVGEGVSYRGRLYIELSVEILSGGAAESKSLLSKFSPKDAKGGKTGTGAGGEEEKSKMIGPEVIPVEPPQKMRDEDMETFLLFGCVFEASMIDRKIGDR--PVTLEFTIGNFGNLIDGAAPPPSKKKLEDVSVTAPLLDTTATMPCKSTTTPERPIFGDAQRHYMHLPIAAQKPCVYVYSSWEDRAYRLHHANMLDTIALMFEEGVAKVTEL-DKMLSPEAWSLMHHVLREFRRDAKEFIAFAEKKVKGS-NLTLLDKKRLTMCKQELESMTEMAGGLLEPKRRSLTVKEMLLEAQKIKKKLRFLVE---EPQHTLPDVFVCLVSNNKRVAYARIPARDLLFSESPEQRGRDCGKIKTLFLK----PPVKRAPGWTVQAKLDVFLWLGTCAESSRMLDNLPSGFELVSTSFEDRTGAPPEYLLYTGKTHMFELRAHMYQARGLIAADNTGLSDPFAWVSFLSHSQCTGIIKQTLTPTWNQVIKMTNMSLYGGLYDIAQEPPLIVIEVYD-DDAVGSEYLGSTVAVPVVKLSEEQYSPPQLQYSPLFCGSLSGGDILGAFELIQSGEHS-------LPVLD---------------EPDGVVIPVPSYIRPVLCKYRIEVLFWGLRELKKVQLLS----------------VDRPQVFIKCAGSGVNSSVIQSYKKNPNFTIIVDAFDVELPEDEHLLPPLTLTVVDWRAFGRSTLVGSHVINNL 1082          

HSP 2 Score: 481.1 bits (1237), Expect = 1.546e-139
Identity = 279/657 (42.47%), Postives = 385/657 (58.60%), Query Frame = 1
Query: 4132 LFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEED-DGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIV-PECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVD 6090
            LF++ S      KEV    ++E  +L+       +++Y  ELE   ++G F    ++F L+RGK  EED   YE   RF G FKG  C+Y + E +   ++ +  D  + K+                         + +    +V+ ++RVY+V   NLHPAD +GKADPYI++++G  EI+DR+NYIPK LNP+FGR FE + TFP+ES L + +YD+D +  DDLIGET IDLENR+ S HR TC L + Y   GY  W+D   P  +L  LC++N +  P++      + I  K F   ++  D+D   ++S E LAL VLH W ++    CKLV EHIETR LYL++KPGI+QG L+MWVD+FP     P PP+DISPRKP  YELRI+I  TE+V L DTNF T ++S DIY+K W+K  + D Q+TD H+ SL+G+G FNWRFVF F YL AE  +V  K ++IY +D+ E K P  L MQV D + L SD  +G ++  L  FP+ AK  K+C     ++     ++F+ K+ +GWWP +              E+ G VE E  LV  EEAE NP G  R+EP PLEKPNRPD SF  F+NP+    + I    K  +I  L++LI  L +VL  Y  PG  S  IV+
Sbjct: 1183 LFENTSGMRDRKKEVNYKSVIEQPRLA------TLQVYDKELE--AEFGPFDDWVKTFELFRGKANEEDGSAYE---RFVGKFKGRFCLYKLPEADGEAEEGY-VDSGQFKI------------------------NQGIPPNTAVNVLIRVYIVAAFNLHPADPDGKADPYIVLKLGKTEIKDRDNYIPKQLNPVFGRSFEFQATFPKESLLTILIYDYDLVGGDDLIGETQIDLENRFYSRHRATCSLPTEYAIEGYNAWRDCMKPVDLLIKLCKENRLDNPQFSP--GRITIGNKVFMGKTVFPDED-QMVESYEHLALKVLHRWSEMPNGGCKLVPEHIETRALYLKDKPGIDQGHLQMWVDIFPLDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKVVVVQKRESIYSLDKTEQKMPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKSAKACKMEMLTELTENISIFQQKRSKGWWPFI-----------KAGELTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTSFSWFMNPFKCFFHLIWGNYKKYIIAGLVLLILTLFLVLLFYTLPGALSTKIVN 1789          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 586.645 bits (1511), Expect = 4.781e-175
Identity = 393/1328 (29.59%), Postives = 655/1328 (49.32%), Query Frame = 1
Query:  247 FILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGN------------ENLGKSDFNVPSYNLTKLERHEGHIRLPS--------------DTSSVESDSDNGDNEPS----DDIDVK--------DGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIF-PGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTE-----------------------PKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIE--YYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDV------------TNPVPGEPEKLIRFVPKEEMESADWWTRYYATL 3918
            + +  RFG  +L G   +VL  ++ +  + + +T +D+       +++ E+ Y + + G+             NL       P + +    R   + RLP                 +    D     +EP+    +D+D K        D D  S  S+      +  +  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       + R +A+ K S I ++++   G ++G F +D  TVY+   H F++KWA+L DP   T+G KG++K D++V+  GD  K P+K ++ ++ +IE N+L+P  +   +R      V +Y+AE LP MNT IM+N+K+A++G+ K L DPYV+V+FAG  G T V   SY P WN+QIIFTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT+GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+++      T+ P+ +    V +    PV+    GK E + LF +  E+T+I ++IG K  P+ FE++IG  G   D  S    ++       V   TE                              D  YFH+P+  KKPC Y+ +  +D R RL+  NI+DK+  +L E +  V+ +  + +K    R ++  +E    S  + ++     +    +T LD +  K     LE M          +   T+   +K + +F++ L     +PQH +PD+F++M+ +N R+AY RI ++D+++S +  E G+ CG V  V+LK      LP K       + +QA++++Y+WLGL K  R +  GLP GF      K       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K       P +E              G  D E+   L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H ++ L    Y   DK ++     +  +    A  + +  S        + + E   +K +  VK +A   V                    E++    P E M   DWW++Y+A++
Sbjct:   46 YCVFLRFGA-RLIGTFRMVLQQVVEEAQLEVTDTLIDDNNSAIRTSVSIELRYQT-MDGSVGAWNDGEFMDGTNLQSESMATPLWPVPTPHRTLSNRRLPLICRVGKGVFSAMKLGKTRPPKDESRKQDEPAVLETEDLDRKAIRLAGGLDPDTISLASVTAVTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVPRDRAV-KVSVIHSKNLLRSGTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGV-PAERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLEEGLNDVHEMI-KTEKPYPERRLRGVLEELSSSCFRFVTLANKDQNQNGQTKLDRERLKSCMRELENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK------LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQIGPAGKS----DLPQIE--------------GPTDIERGPILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPDKNSQQWTTAAKLMNGYLAMTNGRPRSRTTGEIVINMEPEAPVKKMETMVKLEAVSSVFILLGGEEEKDKKKKKKKGVEEIEEEEPDESM--LDWWSKYFASI 1311          

HSP 2 Score: 503.056 bits (1294), Expect = 3.389e-146
Identity = 269/588 (45.75%), Postives = 367/588 (62.41%), Query Frame = 1
Query: 4240 IYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD-PFQHSDA-CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +Y+ ELE   +Y  F+    +F+L RGK  ++DD    ++R  G FKG++C+Y V   +++ ++  +D         +FG                      F   P++  ++ +VRVYVV+  +LHPADINGKADPY+++++G  +I+D+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY  HGY  W+D   PT IL  LC++  I  P Y      V++  + F   + I+D++G + ++ E LAL VL +WEDI P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRF+F FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C       D      ++FK K+V+GWWP V         E + +E+ G VE E+ L+  EEAE  PAGLGR EP PLEKPNRPD SF+ FLNP  +I+YFI
Sbjct: 1333 VYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYD--------PNFG---------------------MFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP-GGRVKVTNRVFTGPTEIDDENGQKKQTDEHLALSVLQHWEDI-PRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFV------ARNENDEMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIRYFI 1881          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 548.895 bits (1413), Expect = 4.705e-164
Identity = 334/1024 (32.62%), Postives = 530/1024 (51.76%), Query Frame = 1
Query:  697 YEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTE-----------------------PKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQ-AMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIE-IDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDL 3627
            ++AR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       +I  K L +           G ++G F +D  TVY+   H F++KWA+L DP   T+G KG++K D++V+  GD  K P+K ++ ++ +IE N+L+P  +   +R      V +Y+AE LP MNT IM+N+K+A++G+ K L DPYV+V+FAG  G T V   SY P WN+QIIFTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT+GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+++      T+ P+ +    V +    PV+    GK E + LF +  E+T+I ++IG K  P+ FE++IG  G   D  S    ++       V   TE                              D  YFH+P+  KKPC Y+ +  +D R RL+  NI+DK+  +L      + YL  +G + + A    +   E        V       R T         + +   MG +   M   V        T+   +K + +F++ L     +PQH +PD+F++M+ +N R+AY RI ++D+++S +  E G+ CG V  V+LK      LP K       + +QA++++Y+WLGL K  R +  GLP GF      K       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++ I P  K       P +E              G  D E+   L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H ++ L
Sbjct:    3 FKARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNLLRS----------GTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGV-PAERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKL-----SICYLGQQGPEPEWADETGQGEAEVLHEGAGNVFVLEGLGRLTGDGLTNHDCFAQQENMGTQAKTMRSQVKKN-----TVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK------LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVIGPAGKS----DLPQIE--------------GPTDIERGPILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 950          

HSP 2 Score: 464.922 bits (1195), Expect = 5.945e-135
Identity = 257/584 (44.01%), Postives = 348/584 (59.59%), Query Frame = 1
Query: 4240 IYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD-PFQHSDA-CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTI 5964
            +Y+ ELE   +Y  F+    +F+L RGK  ++DD    ++R  G FKG++C+Y V   +++ ++  +D         +FG                      F   P++  ++ +VRVYVV+  +LHPADINGKADPY+++++G  +I+D+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY  HGY  W+D   PT IL  LC++  I  P Y                        G + ++ E LAL VL +WEDI P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRF+F FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C       D      ++FK K+V+GWWP V         E + +E+ G VE E+ L+  EEAE  PAGLGR EP PLEKPNRP+ S    L+P   +
Sbjct: 1028 VYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYD--------PNFG---------------------MFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP----------------------GQKKQTDEHLALSVLQHWEDI-PRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFV------ARNENDEMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVV 1551          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 546.584 bits (1407), Expect = 2.725e-163
Identity = 341/1071 (31.84%), Postives = 547/1071 (51.07%), Query Frame = 1
Query:  592 NYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSN-----------NVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTE-----------------------PKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQ--VNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIE-IDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDL 3627
            ++SE  ++P   +  P    P+       Q+S+T+ EAR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       +I  K L +           G ++G F +D  TVY+   H F++KWA+L DP   T+G KG++K D++V+  GD  K P+K ++ ++ +IE N+L+P  +   +R      V +Y+AE LP MNT IM+N+K+A++G+ K L DPYV+V+FAG  G T V   SY P WN+QIIFTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT+GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+++      T+ P+ +    V +    PV+               GK E + LF +  E+T+I ++IG K  P+ FE++IG  G   D  S    ++       V   TE                              D  YFH+P+  KKPC Y+ +  +D R RL+  NI+DK+  +L     Q     L      V  +  + +       + D    A +   GT  KT+     +  ++   +K+K+                 +++    ++FL D   +PQH +PD+F++M+ +N R+AY RI ++D+++S +  E G+ CG V  V+LK      LP K       + +QA++++Y+WLGL K  R +  GLP GF      K       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++ I P  K       P +E              G  D E+   L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H ++ L
Sbjct:   10 HFSEPQVIPPSLYLFPFIPTPVPSVPSLPQVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNLLRS----------GTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGV-PAERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAEVRTTLSYHLHLTCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLVNETGQGEAEVLHEGAGNVFVLEGLGRLTGDGLTNHD--CFAQQENMGTQAKTMRSQVKKNTVK---DKLKL-----------------VQNFLQKLRFLAD---EPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK------LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVIGPAGKS----DLPQIE--------------GPTDIERGPILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 989          

HSP 2 Score: 472.241 bits (1214), Expect = 2.267e-137
Identity = 260/594 (43.77%), Postives = 355/594 (59.76%), Query Frame = 1
Query: 4210 SDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD-PFQHSDA-CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTI 5964
            +   W     +Y+ ELE   +Y  F+    +F+L RGK  ++DD    ++R  G FKG++C+Y V   +++ ++  +D         +FG                      F   P++  ++ +VRVYVV+  +LHPADINGKADPY+++++G  +I+D+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY  HGY  W+D   PT IL  LC++  I  P Y      V++  + F          G + ++ E LAL VL +WEDI P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRF+F FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C       D      ++FK K+V+GWWP V         E + +E+ G VE E+ L+  EEAE  PAGLGR EP PLEKPNRP+ S    L+P   +
Sbjct: 1000 NSQQWTTAGIVYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYD--------PNFG---------------------MFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP-GGRVKVTNRVFT---------GQKKQTDEHLALSVLQHWEDI-PRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFV------ARNENDEMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVV 1545          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 535.798 bits (1379), Expect = 2.235e-158
Identity = 372/1204 (30.90%), Postives = 593/1204 (49.25%), Query Frame = 1
Query:  676 FQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNK-TDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAI----------------------------------------------KTTSQPDSI-KIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQ----------------------YVHSLTEPKYAYTFDNQYFH-IPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAK---KTLLDVKYQKLIRMGLEKMKMSWSVTIEC---LSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKT--NYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKM------PPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSD-GVSNKAFDNKDEK---------------GPEKTKAGVKSDAKPDVTNPVPGE------PEKLIRFVPKEEMESA-DWWTRYYATLGDLDDPNLYKPEDEI 3963
             QI++TI EAR L G+NI+P+  +  G  K+ T +K  TN PFYNEYF FDF   + +L ++IIR+  +  K       +    +IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV   GD  +   K +D EE   IE N+LIP+    ++R      V +Y+AE LP MN+ IM+N+ +A +GD K L DPYV V FAG  G T        P W++QI+F E FPP   R++I V D   + D  ++T FIDL KI +  + ++ GFLPT+GP+WINLYG+PR  +   +++  Q  N+   EGV+FRGR+LI I                                              K TS  D    I V+V   +        K E +LLF SIFEATLI ++IG K   ++FE S+G  G   D  SH   K+++ E +                      ++   T  K   T  N+ +H +P+  +KPC+Y+ +   D   RL+  N+L K+   L + + QV  L     K+  +   +K  +     I++  + I +    +K    T LD K   L R  LE M  +    ++    +S+  +   ++ L   +KFL D   +PQH +PDVF++++ +N RVAY RI ARD+++S +  E+G  CG + T++ K      LP K    +N+QA++ +YLWLG  K        LP G+  +  ++        PP  + Y  +  FQLR ++Y  R LI +D SGLSDPF KV    H + + +  +T SP W++ ++ +N+V     K +   PP++V+E++D D+ +  E+IG     P+V +    Y+ +KL +  ++ G +  G++L +F+L+++ P S    V   P +E      AQ+              +P ++RP +  +R+E+L WGVR+L++++++S                V++P+++IE  G  +KS +I+ + ++PNFN       + LP N    PP+SI  +++  FG   +VG H I  L ++  +         ++  +  L AQ     + D G  +  + + D                  P  T A   + A    ++P   +       +K  R +  E  E+  DWW++YYA++  L      +P D I
Sbjct:   19 LQIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRLSVMHNK-------LLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKISDAEE--QIEKNLLIPKGF-PSERPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISDEQDGDK-GFLPTFGPAWINLYGSPRNTT---LMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPPEFQEEKSEDFLLFGSIFEATLIDRKIGDKG--ISFECSVGNYGNVLDGVSHSGTKKKSPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELV----KISDLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTLCRQELEAMSANAKAIVQQKKKMSLSDMTREMQSLIDNIKFLVD---EPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFK------LPGKRPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALSKSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQV-PESG---VQSLPPIET--PDAAQI------------YPVPSNIRPVLSKYRVEVLFWGVRELKKVQLLS----------------VDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFLYKPH-----REQTSAIVGLVAQSPPYDSPDPGEQDHIYVDIDPSLRKDMPQSRPHSPAPSPTATLAPSPTPAAGPASDPAASKGSLRRSTKKKKRTIADESAENVIDWWSKYYASVEKLQKVISLEPTDII 1154          

HSP 2 Score: 486.493 bits (1251), Expect = 2.193e-141
Identity = 273/592 (46.11%), Postives = 362/592 (61.15%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQD-RFAGVFKGNICIY-NVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAED-SIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDAC--AKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +  ++IYS ELEN  ++  F+   R+F L RGK    DD + + D R  G FKG+  IY NV  D+ + KD              G Q               L++ + +   H+V  ++RVY+V G NL PAD +GK+DPYI++R+G  EI+DR+NYIPK LNP+FGR FEM+ TFP++S L + +YD D +  DDLIGET IDLENR+ S HR TCGL S Y   GY  W+DS  PT IL  LC+ N +  P        ++I GK F   ++   DD  Q++S E LAL  LH+W DI P+  C LV EHIETRPLY ++KPGIEQG ++MWVDMFP+   +P PP+DISPRKP  YELRI+I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRFVF F YL AE   +V K +NI+ +++ E K P  L +QV D D L SD  +G ++  L+ F + AK  K CD    +      K ++F+ K++RGWWP V +            E+ G VE E  LV  EEAE NP G  R+EP PLEKPNRP+ SF  F+NP+  + + I
Sbjct: 1174 LATLQIYSNELEN--EFKNFEDWVRTFELLRGKST--DDEHSVHDDRIIGKFKGSFSIYKNV--DDTNPKD--------------GGQ---------------LRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLRP--GQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDI-PDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCDLSMAATPKDENKISIFQQKRIRGWWPFVKSG-----------ELTGKVEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLI 1715          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 521.161 bits (1341), Expect = 1.429e-153
Identity = 356/1178 (30.22%), Postives = 572/1178 (48.56%), Query Frame = 1
Query:  676 FQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAI----------------------------------------------KTTSQPD---SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFEL-SIGTTGICPDEYSHLPKKEENFESQ----------------------YVHSLTEPKYAYTFDNQYFH-IPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKT--NYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKM------PPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESA-DWWTRYYATLGDLDDPNLYKPEDEI 3963
             QI++TI EAR L G+NI+P+  +  G  K+ T +K  TN PFYNEYF FDF   + +L ++IIR+  +  K       +    +IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV   GD  +   K    E+  IE N+LIP+    ++R      V +Y+AE LP MN+ IM+N+ +A +GD K L DPYV V FAG  G T        P W++QI+F E FPP   R++I V D   + D  ++T FIDL KI +  + ++ GFLPT+GP+WINLYG+PR  +   +++  Q  N+   EGV+FRGR+LI I                                              K TS  D   SI++ V+     P  +    K E +LLF SIFEATLI ++IG K   ++FE+ S G  G   D  SH   K+++ E +                      ++   T  K   T  N+ +H +P+  +KPC+Y+ +   D   RL+  N+L K+   L + + QV  L     K+  +   +K  +     I++  + I +    +K T      +K + +              C     +     +L+ F       +  PQH +PDVF++++ +N RVAY RI ARD+++S +  E+G  CG + T++ K      LP K    +N+QA++ +YLWLG  K        LP G+  +  ++        PP  + Y  +  FQLR ++Y  R LI +D SGLSDPF KV    H + + +  +T SP W++ ++ +N+V     K +   PP++V+E++D D+ +  E+IG     P+V +    Y+ +KL +  ++ G +  G++L +F+L++         V   P +E      AQ+              +P ++RP +  +R+E+L WGVR+L++++++S                V++P+++IE  G  +KS +I+ + ++PNFN       + LP N    PP+SI  +++  FG   +VG H I  L ++  +            H +  +A   + A S     ++  +     P  T A V+   +           +K  R +  E  E+  DWW++YYA++  L      +P D I
Sbjct:   39 LQIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRLSVMHNK-------LLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKISDAEE-QIEKNLLIPKGF-PSERPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISDEQDGDK-GFLPTFGPAWINLYGSPRNTT---LMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPPEVSFSVEKSEDFLLFGSIFEATLIDRKIGDKG--ISFEIISTGNYGNVLDGVSHSGTKKKSPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELV----KISDLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTL--------------CRQELVVGPKRYNLSHF-------LAQPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFK------LPGKRPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALSKSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQSG-------VQSLPPIET--PDAAQI------------YPVPSNIRPVLSKYRVEVLFWGVRELKKVQLLS----------------VDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFLYK-----------PHREQTSAIVGLVAQSPKDMPQSRPHSPAPSPTATLALVRGSLRRST--------KKKKRTIADESAENVIDWWSKYYASVEKLQKVISLEPTDII 1114          

HSP 2 Score: 486.878 bits (1252), Expect = 1.110e-141
Identity = 274/588 (46.60%), Postives = 360/588 (61.22%), Query Frame = 1
Query: 4237 KIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQD-RFAGVFKGNICIY-NVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAED-SIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDAC--AKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            KIYS ELEN  ++  F+   R+F L RGK    DD + + D R  G FKG+  IY NV  D+ + KD              G Q               L++ + +   H+V  ++RVY+V G NL PAD +GK+DPYI++R+G  EI+DR+NYIPK LNP+FGR FEM+ TFP++S L + +YD D +  DDLIGET IDLENR+ S HR TCGL S Y   GY  W+DS  PT IL  LC+ N +  P        ++I GK F   ++   DD  Q++S E LAL  LH+W DI P+  C LV EHIETRPLY ++KPGIEQG ++MWVDMFP+   +P PP+DISPRKP  YELRI+I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRFVF F YL AE   +V K +NI+ +++ E K P  L +QV D D L SD  +G ++  L+ F + AK  K CD    +      K ++F+ K++RGWWP V +            E+ G VE E  LV  EEAE NP G  R+EP PLEKPNRP+ SF  F+NP+  + + I
Sbjct: 1137 KIYSNELEN--EFKNFEDWVRTFELLRGKST--DDEHSVHDDRIIGKFKGSFSIYKNV--DDTNPKD--------------GGQ---------------LRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLRP--GQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDI-PDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCDLSMAATPKDENKISIFQQKRIRGWWPFVKSG-----------ELTGKVEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLI 1674          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 390/1280 (30.47%), Postives = 652/1280 (50.94%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSP---------------------------------------VSGNENLGKSDFNV-PSYNLTKLERHEGHIRLPSDTSSVE-SDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPK---HIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+LIV L++++ ++   +   KV FR   F +   +  +   +    F WP+A  +D+ + L I+    ++   +KL G   +VL  ++ +  + + +T +D+   I   +L+ E+ Y +                                        +SG ++  ++  +V  +  L K   H+   +   + + +E  D D+   +  D +D       S  +L      K  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   ++G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RL++ +      TS P+ +    V V    PVS +  G+ E + LF +  EA++I ++ G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  V  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M          +   T+   ++   +F++ L     +PQH +PDVF++M+ +N R+AY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA+L++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG+  AGD+L +F+L++I P  K       P +   ++M        +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISGEKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGD--KPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMI-KTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----ADLPPINGPVDM-------DRG----PIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1228          

HSP 2 Score: 495.738 bits (1275), Expect = 1.760e-143
Identity = 258/593 (43.51%), Postives = 366/593 (61.72%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V   +++  +  +D         ++G                      F   P +  ++ +VR+YVV+  +LHPADINGKADPYI +++G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC++  +  P +   +  V +  + F   S IED++G +  + E +AL  L +WEDI P   C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR+++  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD SF+ FLNP  + +YF+
Sbjct: 1405 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYD--------PTYG---------------------MFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDI-PRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFL 1958          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 347/1038 (33.43%), Postives = 560/1038 (53.95%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   ++G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RL++ +      TS P+ +    V V    PVS +  G+ E + LF +  EA++I ++ G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  V  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M          +   T+   ++   +F++ L     +PQH +PDVF++M+ +N R+AY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA+L++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG+  AGD+L +F+L++I P  K       P +   ++M        +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:  258 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGD--KPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMI-KTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----ADLPPINGPVDM-------DRG----PIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1243          

HSP 2 Score: 496.893 bits (1278), Expect = 6.759e-144
Identity = 260/596 (43.62%), Postives = 367/596 (61.58%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V   +++  +  +D         ++G                      F   P +  ++ +VR+YVV+  +LHPADINGKADPYI +++G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC++  +  P +   +  V +  + F   S IED++G +  + E +AL  L +WEDI P   C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR+++  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD +F+ FLNP  +IKY I  R
Sbjct: 1400 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYD--------PTYG---------------------MFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDI-PRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTR 1956          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 544.658 bits (1402), Expect = 7.460e-161
Identity = 347/1103 (31.46%), Postives = 562/1103 (50.95%), Query Frame = 1
Query:  619 ERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPK-RPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAI--------------------------------------------------KTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFE---------------------SQYVHSLTEPKYAYTFDNQ--YFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMK-MSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKT--NYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKD----CFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVP-GFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESD 3681
            +R  KL   I    +K +++QI+VTI EAR L G+NI+P+  +  G  K+ + +K  TN+PFYNEYF FDF   ++ L ++II+I  L  K       +    +IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV   GD  K  P  +D EE   IE N+LIPQ    ++R      V +Y+AE LP MN+ IM+N+ +A +GD K L DP+VEVSFAG TG T V      P W++Q++F E FPP   R++I V D   + D  ++T FIDL KI N  + ++ GFLPT+GP+WINLYG+PR +S   ++   Q  N+   EGV+FRGR+L+ I                                                  +TT + +S ++ V+  +  P    +  K E +LLF + FEAT+I ++IG K  P++FE+S+G  G   D  SH   K+++ E                     +  + S T P+     D    Y ++P+ +KKPC+  I+   D   RL   N+L+K+   L E + +V  L    ++    + +K ++  F       +S  +    T  +T LD K   L    L+ M   +  V  +     ++D  I++  +FV+ +   + +PQH +PDVF++M+ +N RVAY RI A+DL++S I  + G+ CG + T +LK      LP K    + +QA++ IYLWLG  +        LP G+  +       +  PP  + Y  +  FQLR ++Y  R LI +D +GLSDPF KV      + + +  +T SP W++ ++ + +V +   K +   PP VV+E++D D+    E++G     P V +   +Y   KL +  ++ G +  GD+L  F+L+++ P   +   P G P +  +                     +P ++RP +  +R+E+L WGVR++++++++S                V++P+++IE GG  +KS +I+ +  +PNF+    +  + LP N    PP+SI  +++  FG   +VG + I  L ++  + +    L  ++D
Sbjct:   63 KRRAKLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVLHHK-------LIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKTSDAEE--QIEKNLLIPQGF-PSERPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDK-GFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGDK--PISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEK-MKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLK------LPGKRPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAVGKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPPSGLQGLPPTGPPDITQIYP-------------------VPSNIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCKPRETFALTSQTD 1105          

HSP 2 Score: 494.197 bits (1271), Expect = 1.747e-143
Identity = 281/628 (44.75%), Postives = 384/628 (61.15%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQ-IKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGT-AIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD--PFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            +  +KIY  +LE+  ++  F+   ++F L+RGK  EED G +  DR  G FKG+ CIY   ED+  E        D  +L                      ++ + +   H V  ++RVY+V   NL PAD +GK+DPYI++R+G  EI+DR+ YIPK LNP+FGR FE++ TFP+ES L V +YD D +  DDLIGET IDLENR+ S HR  CGL S Y   GY  W+D+  PT IL  LC+ N +  P +      ++I  K F+  ++  ++D  + ++S E LAL VLH+WEDI PE   +LV EHIETRPLY ++KPG+EQG L+MWVDMFP  T  + PP+DISPRKP  YELR+ I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRF+F F YL AE  +V  K +NI+ +++ E KTP  L +QV D + L SD  +G L+  L+ FP+ AK  K+CD   F+++    K ++F+ K+VRGWWP   +            E+ G VE E  LV  EEAE NP G  R+EP PL KPNRPD SF  F++P+  + + I    K  +I   I++I ++ +VLFIY  PG  SR IV
Sbjct: 1278 LAALKIYDGDLES--EFNNFEDWVKTFELFRGKSTEEDHGLD-GDRVIGKFKGSFCIYKSPEDSTSE--------DSGQL----------------------RIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYF--RPGKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDI-PEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFAKSK-----------ELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 544.658 bits (1402), Expect = 7.460e-161
Identity = 347/1103 (31.46%), Postives = 562/1103 (50.95%), Query Frame = 1
Query:  619 ERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPK-RPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAI--------------------------------------------------KTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFE---------------------SQYVHSLTEPKYAYTFDNQ--YFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMK-MSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKT--NYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKD----CFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVP-GFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESD 3681
            +R  KL   I    +K +++QI+VTI EAR L G+NI+P+  +  G  K+ + +K  TN+PFYNEYF FDF   ++ L ++II+I  L  K       +    +IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV   GD  K  P  +D EE   IE N+LIPQ    ++R      V +Y+AE LP MN+ IM+N+ +A +GD K L DP+VEVSFAG TG T V      P W++Q++F E FPP   R++I V D   + D  ++T FIDL KI N  + ++ GFLPT+GP+WINLYG+PR +S   ++   Q  N+   EGV+FRGR+L+ I                                                  +TT + +S ++ V+  +  P    +  K E +LLF + FEAT+I ++IG K  P++FE+S+G  G   D  SH   K+++ E                     +  + S T P+     D    Y ++P+ +KKPC+  I+   D   RL   N+L+K+   L E + +V  L    ++    + +K ++  F       +S  +    T  +T LD K   L    L+ M   +  V  +     ++D  I++  +FV+ +   + +PQH +PDVF++M+ +N RVAY RI A+DL++S I  + G+ CG + T +LK      LP K    + +QA++ IYLWLG  +        LP G+  +       +  PP  + Y  +  FQLR ++Y  R LI +D +GLSDPF KV      + + +  +T SP W++ ++ + +V +   K +   PP VV+E++D D+    E++G     P V +   +Y   KL +  ++ G +  GD+L  F+L+++ P   +   P G P +  +                     +P ++RP +  +R+E+L WGVR++++++++S                V++P+++IE GG  +KS +I+ +  +PNF+    +  + LP N    PP+SI  +++  FG   +VG + I  L ++  + +    L  ++D
Sbjct:   63 KRRAKLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVLHHK-------LIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKTSDAEE--QIEKNLLIPQGF-PSERPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDK-GFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGDK--PISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEK-MKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLK------LPGKRPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAVGKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPPSGLQGLPPTGPPDITQIYP-------------------VPSNIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCKPRETFALTSQTD 1105          

HSP 2 Score: 494.197 bits (1271), Expect = 1.747e-143
Identity = 281/628 (44.75%), Postives = 384/628 (61.15%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQ-IKSLEPLALVVLHNWEDIVPEC--KLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGT-AIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD--PFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            +  +KIY  +LE+  ++  F+   ++F L+RGK  EED G +  DR  G FKG+ CIY   ED+  E        D  +L                      ++ + +   H V  ++RVY+V   NL PAD +GK+DPYI++R+G  EI+DR+ YIPK LNP+FGR FE++ TFP+ES L V +YD D +  DDLIGET IDLENR+ S HR  CGL S Y   GY  W+D+  PT IL  LC+ N +  P +      ++I  K F+  ++  ++D  + ++S E LAL VLH+WEDI PE   +LV EHIETRPLY ++KPG+EQG L+MWVDMFP  T  + PP+DISPRKP  YELR+ I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRF+F F YL AE  +V  K +NI+ +++ E KTP  L +QV D + L SD  +G L+  L+ FP+ AK  K+CD   F+++    K ++F+ K+VRGWWP   +            E+ G VE E  LV  EEAE NP G  R+EP PL KPNRPD SF  F++P+  + + I    K  +I   I++I ++ +VLFIY  PG  SR IV
Sbjct: 1278 LAALKIYDGDLES--EFNNFEDWVKTFELFRGKSTEEDHGLD-GDRVIGKFKGSFCIYKSPEDSTSE--------DSGQL----------------------RIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYF--RPGKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDI-PEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFAKSK-----------ELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l4 (fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:MGI:1921812])

HSP 1 Score: 516.153 bits (1328), Expect = 2.142e-150
Identity = 390/1408 (27.70%), Postives = 642/1408 (45.60%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFN----------VPSYNLTKLERHEGHI---------RLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSL-KIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKS--HIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAI--------------KTTS----------------------------QPDSIKIG-----------VDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQY--VHSLTE-----------------PKYAYTFDNQ--YFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTL-----LDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAI---KDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLY------------KMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVED----KINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATL 3918
            M+L V ++ LTG+    +  +++ FR    +T         ++G  F WP        +SL ++ +  +R    +  G + I L  L     + L E  VDE++R++ I +  +++Y  P        + DF           +P+     +E  E  +         RL     + + + +  + EP  + +     +    S L  R   LP+  DP  + K +DFQ+ VT+ EA+ L G NINP   V  G Q++ T     TN PFYNEYF F+F  +RL L + ++ I A   ++   + TR       IG F +D           F  KWA L DP+   +G KG+VK+ LSV   GD P  P         +IE N+L+P  + Q +R    + V VY+AE LP + T ++ ++ +A L D   L DPYV VSF G  G T V     +P WN+Q+ F E FPP    LR+ +RD+  + D  ++T  +DL +I NS      GF PT+GP+W+ LYG+        +    Q  N+ L EG+ FRGRLL+A+              +TT                             QP S               V+V    P+  N     E +LLF  +FEAT+I   + KK  P++ E+SIG  G   ++     + +E  ES    V  L E                  ++    D    Y  +P R +KPCL++ +  ED+  RL   N + K+ + L   +++V  +  R       R +K+++E        V  + + C G  ++T+     LD    KL+   L  M       +  L +  +   +   K L + ++FL     +PQ  LPDV ++M     RVAY RI A+D+++S +  E+G+ CG + ++ L       +P      + A+L+++LWLGL K  +                GLP+  ++D F                FQLR +LY  R ++ +DDSGLSDPF +V+I    + + V  +T SP+WDE ++ D ++ +   + ++  PP VV+ +FD +      F+GR F  P V +  D Y   +LQ++ + +G   AG+++ +F+LIE+D +S  +  P  PS     ++ + V   S        L +P  VRP +  FR+E+L WG+R L R+                 +F + +P++++E+ G R++S+++ ++  +PNF + +  V + LP      PP+SI  I    FG   +VG+H++  ++ + ++     +  E+ + E+  L     Q +      G S +       K P K          P++   +P +PE++            DWW++YYA+L
Sbjct:    1 MALTVCVRHLTGLPGTHDRQVRLCFRGFTQKTRKIHCGREADVGELFRWPHYGSPLAGESLSVQVVNCSRVFSPRPLGTLVISLQQLQSAGHLVLREALVDERLRVSPIQVELDLKYQPPEGAAGTWAEEDFGTPIRDSLELIIPNVGFQDMEPGEAQLERRAVALGRRLARSLGTQDDEENELELEPELEEEPDVEISGVVFSPLKSRALGLPRG-DPFKVCKAQDFQVGVTVLEAQKLVGVNINPYVAVRVGDQRKVTATLRGTNCPFYNEYFLFEFHETRLHLQDLLLEITAFHSQTLPFMATR-------IGTFRMDLGMALDQPDGHFHQKWAPLHDPRDTRAGTKGFVKITLSVRARGDLPLPPPPPCPGTSSDIEKNLLLPHGV-QAERPWARLRVRVYRAEGLPTVRTGLLGSLARA-LHDQNVLLDPYVRVSFLGQQGETSVRGEETAPKWNEQLSFVELFPPLTRSLRLQLRDNAPLVDVALATHVLDLRQISNSGRAA--GFNPTFGPAWVPLYGS---LPSGRLRDDLQSLNEGLGEGIWFRGRLLVAVSMEVYEGRVEPKPSQTTQRSGLSRLTGKKKKKKEKTRQGQTPAGILQPASASTSEDAPEIPSAMEVEVEDLLPLPENALASFEDFLLFGVLFEATMIDPSLAKK--PISLEISIGHAGRQEEQSGQGSRADEGSESSTLEVQPLLESEDRGAGQEEQELLGTPAQWPEPVDGNGPYLCLPLRHRKPCLHVWSCWEDYTWRLQSSNSVCKVAERLDHGLQEVEKMQRRSGPGACTR-LKQTLEEL------VAGSRQFCHGAERRTMTRPNALDRCRAKLLTHSLNLMARQGLRLLRSLRLNNMQRTVVLAKKLLARLRFLAQ---EPQPPLPDVLVWMFSGQRRVAYARIPAQDILYSVVEEERGRDCGKIQSLLL------TVPGAAPGEVCAKLELFLWLGLGKQAKACTSELPMDLLPEPSSGLPQSLYRDDFRY--------------FQLRAHLYQARGVLAADDSGLSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFDQLIVDGRREHLREEPPLVVINVFDHNKFGPAVFLGRAFAAPRVKLIEDPYQRPELQFFPLRKGPQAAGEVIATFELIELD-YSGHLE-PSVPSDVEPRDLASLVEPISG------HLSLPPSVRPVLRAFRVEVLFWGLRGLGRVH----------------LFEIEKPQVVLEVAGRRVESEVLPNYRENPNFTELVRHVTVDLPEQPYLQPPLSILVIERRAFGRTVLVGSHIVPHMLRFILQGHEDPQEEEETEEETRDLVPHGPQGEKSLPEAGTSRQLL-----KAPLKKLTLGLLGQGPELEEDIP-DPEEM------------DWWSKYYASL 1319          

HSP 2 Score: 406.757 bits (1044), Expect = 1.768e-114
Identity = 251/661 (37.97%), Postives = 356/661 (53.86%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIK-----SLEPLALVVLHNWEDIVP-ECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNK-NIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSD-ACAKFNLFKNKKVRGWWPLV---------------------------YNPKXXXXXXXNG--LEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVDKI 6096
            I  +KIY+  LE+  ++  F+     F LYRG+  ++ +G      F G FKG+  IY                  ES+  SF E   ++                 +     +  +VRVY+VK  NL PAD NGKADPY++V  G ++   +E YIPK LNPIFG   E+ V+ P +  L V V+D D +  DDLIGET IDLENR+ S HR  CGL S Y+ +GY  W+D+  P+ IL  LC++  +P P+Y      V++  + F + S     D  + K     S E  AL VL  W+++     +LV EH+ETRPLY    PG+ QG L MW+D+FPS    PPP+DI PR+P SYELR+VI  T++V L D N  T E+S DIY+K+W+K  + D Q+TD HF SL+G+G FNWRFVF+FDYL  E  +  + K   + ++E E++ P  L +QV D D + ++  +G L+ +L    + A+  + C      D A  + NLF+  ++RGWWP+V                             P+D +  +  G    + G VE E +L+  EEAE  P G GR+EP PLEKPNRP  SF  F+NP  T  +FI  R   IL+ +L++ +  + ++L  Y  PG  S VI   +
Sbjct: 1368 IATLKIYNSSLED--EFSHFEDWLSVFPLYRGQGGQDGEGEGASGHFVGKFKGSFLIY-----------------PESEAKSFSEPQISRG----------------VPQNRPIKLLVRVYIVKATNLAPADPNGKADPYVVVSAGKEQRDTKERYIPKQLNPIFGEVLELSVSLPAQPELTVAVFDHDLVGSDDLIGETHIDLENRFYSHHRANCGLASQYDVNGYNAWRDAFRPSQILAGLCQRCGLPVPEYRA--GAVKVGSRVFLTPSEAPPPDDRKPKVTSEASEEAQALHVLRRWQEMPGLGIQLVPEHVETRPLYHPRSPGLLQGSLHMWIDIFPSDVPAPPPVDIKPRQPISYELRVVIWNTDDVALDDVNPLTGERSSDIYVKSWVKGLEQDRQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVRRKPGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARDPEHCSVRLALDGAGPRCNLFRCHRLRGWWPVVKMKDMEDVEREAREAQAGKKRKRKRRAGRPEDLEFTDTGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKEPEPLEKPNRPKTSFNWFVNPLKTFIFFIWRRYWRILVLLLLLALITIFLLLVFYTIPGQISEVIFSPV 1991          
BLAST of Otoferlin vs. UniProt
Match: sp|Q5SPC5|OTOF_DANRE (Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 422/1392 (30.32%), Postives = 698/1392 (50.14%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEY------------------------------NSPVSGNENL-----GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP---SDDIDVK--------DGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIK-----TTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYS-----------------------HLPKKEENFESQYVHSL--TEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIE--YYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSD-----AKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATL 3918
            M+L+V L+++T ++   +   KV FR   F +   +  +        F WPI  ++D  + L I+    ++   ++L G   +VL  ++ +  + + +T +D+        ++ EI+Y                              +S +SG         G+S   +P++   K  +          T + + D   GD+     ++D+D K        D D  S  S+      +  +  K    ++P S +  D+QISVT+ EAR L G N++P+  V  G++K+ T +K  TN P+YNEYF FDF +    + ++II+I  +  K+ + +     G ++G F +D  TVY+   H F +KWA+L DP   T+G KG+VK D++V+  GD  K P+K  + ++ +IE N+L+P+ +  ++R      V +Y+AE LP MNT IM+N+K+A +G+ + L DPYV V FAG  G T V   SY P WN+Q+IFTE FPP   RL++ +RDSD + D  I T FIDL K+ N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLLI+I      TTS        V +   + +S +  GK E + LF S  EAT+I ++IG   KP++FE++IG  G   D  S                       H   +EE  +   + S+  T P      D  YFH+PY  KKPC+Y+ +  +D R RL+  NI+DK+  +L E +  V  +  + +K    R ++  +E    S  + ++     +  + +T LD +  K     +E M          +   T+   +K + +F++ L     +PQH +PDVF++MI +N R+AY RI ++D+++S +  E G+ CG V  V+L+      LP K       + +QA+L++YLWLGL K  + + +GLP GF      K      +PP  + Y  +  FQLR ++Y  R+L  +D SGLSDPF +V    H + + V  ET  P WD+ ++ DN+        ++  PP +V+E++D D+    EFIGR F +P   +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  +       P ++          D+ +G      L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L +  Y   DK   +  H  D + +++ + ++K     V  +A           T A VK D      + +       + E++    P E M   DWW++Y+A++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFR--KAGKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNLLRS-----GTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGV-PSERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEII-KTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLR------LPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPIDG-------PTDSDRG----PILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFIYSPPDKTANNWAHTGDIVVNMSPEPNIKKMDTVVKIEA----------TTDAVVKVDLNEDEKEKEKKKKKKKKGEEVEEEEPDESM--LDWWSKYFASI 1326          

HSP 2 Score: 511.146 bits (1315), Expect = 8.695e-148
Identity = 267/594 (44.95%), Postives = 371/594 (62.46%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEI-QDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            ++ + +Y+ ELE+  ++G F+    +F+LYRGK  ++DD   + +DR  G FKG++C+Y +   + I  +  FD +                             +  F S PH+  ++ +VR+Y+++  +LHPADINGKADPYI++++G  +IRD+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+ S Y+ HGY  W+D Q P  IL  LC++  +  P Y      V++  + F   + IED+ G + ++ E LAL VL +WE+I P   CKL+ EH+ETRPL   +KPGIEQG +EMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRFVF FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L+KFP+ AK  K C  D           ++FK K+V+GWWP V       + E +  E+ G VE E+ L+  EEAE +P GLGR +P PLEKPNRPD S + F+NP  +I+YFI
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPN-----------------------------MGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEI-PRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFV------AQNENDEFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFI 1953          
BLAST of Otoferlin vs. UniProt
Match: sp|Q9HC10|OTOF_HUMAN (Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 394/1283 (30.71%), Postives = 652/1283 (50.82%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVS-----------GNENL--------------------------------GKSDFNVPSYNLTKLERHEGHIRLPSDTSSVE-SDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPK---HIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+L++ L++++ ++   +   KV FR   F +   +  +   +    F WP+A  +D+ + L I+    ++   +KL G   +VL  ++ +  + + +T +D+   I   +L  E+ Y +              G+E+L                                G+S F+  +  L K   H+   + P + + +E  D D+      D +D       S  +L      K  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   +SG KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLL+ +      TS P+ +    V V    P+S + AGK E + LF +  EA++I +  G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  +  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M     +    +   T+   ++   +F++ L     +PQH +PD+F++M+ +N RVAY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA++++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K           +L  +   V D  +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFS--AMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGD--KPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMI-KTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----------ADLPPINGPV-DVDRG----PIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1229          

HSP 2 Score: 500.745 bits (1288), Expect = 2.627e-144
Identity = 262/589 (44.48%), Postives = 363/589 (61.63%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V       +D+  E   +S    F                         +DP  ++ +VRVYVV+  +LHPADINGKADPYI +R+G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC+   +  P +      V++  + F   S IED++G +  + E +AL+ L +WEDI    C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR++I  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD SF+ FLNP  + +YF+
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVP----LPEDVSREAGYDSTYGMF--------------------QGIPSNDP--INVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPG-RVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFL 1958          
BLAST of Otoferlin vs. UniProt
Match: sp|Q9ESF1|OTOF_MOUSE (Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 390/1280 (30.47%), Postives = 652/1280 (50.94%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSP---------------------------------------VSGNENLGKSDFNV-PSYNLTKLERHEGHIRLPSDTSSVE-SDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPK---HIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+LIV L++++ ++   +   KV FR   F +   +  +   +    F WP+A  +D+ + L I+    ++   +KL G   +VL  ++ +  + + +T +D+   I   +L+ E+ Y +                                        +SG ++  ++  +V  +  L K   H+   +   + + +E  D D+   +  D +D       S  +L      K  K    ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   ++G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RL++ +      TS P+ +    V V    PVS +  G+ E + LF +  EA++I ++ G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  V  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M          +   T+   ++   +F++ L     +PQH +PDVF++M+ +N R+AY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA+L++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D SGLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG+  AGD+L +F+L++I P  K       P +   ++M        +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISGEKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGD--KPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMI-KTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----ADLPPINGPVDM-------DRG----PIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1228          

HSP 2 Score: 495.738 bits (1275), Expect = 1.351e-142
Identity = 258/593 (43.51%), Postives = 366/593 (61.72%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V   +++  +  +D         ++G                      F   P +  ++ +VR+YVV+  +LHPADINGKADPYI +++G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC++  +  P +   +  V +  + F   S IED++G +  + E +AL  L +WEDI P   C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR+++  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD SF+ FLNP  + +YF+
Sbjct: 1405 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYD--------PTYG---------------------MFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDI-PRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFL 1958          
BLAST of Otoferlin vs. UniProt
Match: sp|Q9ERC5|OTOF_RAT (Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2)

HSP 1 Score: 601.282 bits (1549), Expect = 3.819e-179
Identity = 346/1038 (33.33%), Postives = 559/1038 (53.85%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH----LPKKEENFESQY------------------VHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            ++P + +  D+Q+S+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +S   + ++II+I  +  K+ + +     G ++G F +D  TVYS   H F +KWA+L DP   ++G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT +M+N+K+A +G+ K L DPYV+V FAG  G T V   SY P WN+Q++FT+ FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RL++ +      TS P+ +    V V    PVS +  G+ E + LF +  EA++I ++ G   KP+TFE++IG  G   D  S      P+KE   E +                     S T P      D  YFH+PY  +KPC+Y+ +   D R RL+  NI+D +  +L E +  V  +  + +K    R ++  +E       + LS     +G + +T LD +  K     LE M          +   T+   ++   +F++ L     +PQH +PDVF++M+ +N R+AY R+ ++DL+ S +  E G+ C  V T++LK      LP K       + +QA+L++YLWLGL K  + +  GLP GF      +       PP  + Y ++  FQLR ++Y  R+L  +D +GLSDPF +V      + + V +ET  P WD+ ++ DN+        ++  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ +YRG   AGD+L +F+L++I P  K       P +   ++M        +G      + +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNFN  +    + LP N    PP++I  ++   FG   +VG+H ++ L  +
Sbjct:  259 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRS-----GTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGD--KPVTFEVTIGNYGNEVDGTSRPQRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMI-KTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGHSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK------LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQTFQLRAHMYQARSLFAADSTGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPSGK----ADLPPINGPVDM-------DRG----PIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRF 1244          

HSP 2 Score: 497.278 bits (1279), Expect = 3.381e-143
Identity = 260/596 (43.62%), Postives = 368/596 (61.74%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDA--CAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            I+ +K+Y  ELE+  ++  F+    +F+L RGK  +++DG   ++R  G FKG++C+Y V   +++  +  +D         ++G                      F   P +  ++ +VR+YVV+  +LHPADINGKADPYI +++G  +IRD+ENYI K LNP+FG+ F++E +FP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+  TY+ HGY  W+D   P+ IL  LC++  +  P +   +  V++  + F   S IED++G +  + E +AL  L +WEDI P   C+LV EH+ETRPL   +KPGIEQG LE+WVDMFP     P  P+DISPRKP  YELR+++  T+ V L D +FFT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWR++F FDYL AE+ IV  K ++++  DE EYK P  L +Q+ D+D   +D  +G ++  L++FP+ AK  K C     +        ++FK K+V+GWWPL+         E +  E+ G VE E+ L+  EEAE NP GL R EP PLEKPNRPD +F+ FLNP  +IKY I  R
Sbjct: 1401 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYD--------PTYG---------------------MFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVKVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDI-PRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLL------ARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTR 1957          
BLAST of Otoferlin vs. UniProt
Match: sp|Q2WGJ9|FR1L6_HUMAN (Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FER1L6 PE=2 SV=2)

HSP 1 Score: 553.132 bits (1424), Expect = 4.522e-163
Identity = 388/1282 (30.27%), Postives = 623/1282 (48.60%), Query Frame = 1
Query:  511 SDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKV-IGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-------------------------------------------TSQPDSIKIG---VDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKK------EENF-------ESQYVHSLTEPKYAYTF---------DNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKM-KMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFT----SKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLE--NLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLD--HESDHLQ-------SLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVT--------------NPVPGEPEK-----------------LIRFVPKEEMESA-DWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDI 4005
             DT +++ +  + +  P  D+   D   +   S  P+R  KL   I    ++ +++QI++TI EAR L G+NI+P+  +  G +K+ + +K  TN+PFYNEYF FDF   ++ L ++II+I         V  H   G V IG F +D  TVY+   H F  KWA+L DP    +G KG++K D+SV+  GD  K   KT   E+P IE N+LIP      +R      V +Y+AE LP MN+ IM+N+ +A +GD K L DP+VEVSFAG  G T V      P W++Q+IF E FPP   R++I V D   + D  ++T FIDL KI N  + ++ GFLPT+GP+WINLYG+PR +S   ++   Q  N+   EGV+FRGR+L+ I                                              SQ  S K     V+V S +     V  K E +LLF + FEAT+I ++IG K  P++FE+SIG  G   D  SH   K      EE+        +    H +  P  + T          +  Y ++P+ +KKPC+Y I+   D   RL   N+L+K+   L E + +V  L    ++    + +K  +  F       +S  +       +T LD K   L    LE M K +  +  +     ++D  I +  +FV+ +   + +PQH +PDVF++M+ +N RVAY RI ++DL++S +  + G+ CG + T +LK        +   +++QA++ +YLWLG +K        LP G+  +  +    +  PP  + Y E+  FQLR ++Y  R LI +D +GLSDPF KV    H + + +  +T SP W++ ++ +++V + + K +   PP VV+E++D D+    E++G     P V +   +Y   +L +  ++ G +  GD+L  F+L+++ P      + G P +E  ++ ++                  +P ++RP +  +R+E+L WGVR++++++++S                V++P+ +IE GG  +KS +I+ +  +PNF+    +  + LP N    PP+SI  +++  FG   +VG + I  L ++    K+ E L    + D  Q       SLTA     A+S      A     +  P  T     + A+P +                PV  EP K                   R +  E  E+  DWW++YYA+L          P+ +        DE+  DI
Sbjct:   29 GDTEALQEEPSHQEG-PRGDLVHDDASIFPVPSASPKRRSKLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKIS--------VFHHKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKTSDTEEP-IEKNLLIPNGF-PLERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDK-GFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGDK--PISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEK-MKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPG----KRPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAVGKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPPSG----LQGLPPVEPPDITQIYP----------------VPANIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINYLKQFLC--KLREPLAPITQVDGTQPGHDISDSLTATESSGAHSSSQDPPADHIYVDVEPPPTVVPDSAQAQPAILVDVPDSSPMLEPEHTPVAQEPPKDGKPKDPRKPSRRSTKRRKRTIADESAENVIDWWSKYYASLKKAQKAKERNPKGKKGNTEAKPDEVVVDI 1250          

HSP 2 Score: 493.426 bits (1269), Expect = 2.149e-142
Identity = 276/625 (44.16%), Postives = 381/625 (60.96%), Query Frame = 1
Query: 4234 IKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMI-EDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDS-IVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD--PFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            ++IY  +LE+  ++  F+   ++F L+RGK  E+D G +  DR  G FKG+ CIY   +D+  E        D  +L                      ++ + +   H V  ++RVY+V   NL PAD +GK+DPYI++++G  EI+DR+ YIPK LNP+FGR FE++ TFP+ES L + +YD D +  DDLIGET IDLENR+ S HR  CGL S Y   GY  W+D+  PT IL  LC+ N +  P +      ++I  + F+  ++  E+D    ++S E LAL VLH+WEDI PE  C+LV EHIETRPLY ++KPG+EQG L+MWVDMFP     P PP+DISPR+P  YELR+ I  TE+V L D N FT +KS DIY+K W+K  + D Q+TD H+ SL+G+G FNWRF+F F YL AE   ++ K +NI+ +++ E KTP  L +QV D + L SD  +G L+  L+ FP+ AK  K+CD   F+++    K ++F+ K+VRGWWP                E+ G VE E  LV  EEAE NP G  R+EP PL KPNRPD SF  F++P+  + Y I    K  +I   I++I ++ +VLFIY  PG  SR IV
Sbjct: 1277 LQIYDGDLES--EFNNFEDWVKTFELFRGKSTEDDHGLD-GDRVIGKFKGSFCIYKSPQDSSSE--------DSGQL----------------------RIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHP--GKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDI-PEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPF-----------SKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. TrEMBL
Match: gnl|BL_ORD_ID|18219921 (tr|A0A267FNI5|A0A267FNI5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000102g4 PE=4 SV=1)

HSP 1 Score: 1291.17 bits (3340), Expect = 0.000e+0
Identity = 805/2181 (36.91%), Postives = 1178/2181 (54.01%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDH-QFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVP------------SYNLTKLERHEGHIR----LPSDTSSVESDSDNGDNEPS-----DDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPK-RPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-------TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG------------------------------------------ICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKS-CRGT--AKKTLLDVKYQKLIRMGLEKMKMSWSVTIECL--------------SVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIR---------------VAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKM-GLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFI---RGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGF-PSLENLMEMTAQVNDNSKGEKDE-------EKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINE-----------------DLDHESDHLQSL-TAQFDMKANSD-GVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN-------------------------------------PVPGE------PEKLIRFVP-KEEMESADWWTRYYATLGDLDD-------PNLYKPEDE-----ILVESESE-DEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLF-----QHKSTKELFLKEVQEHLILEDEKLS------DNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPP-IDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            M+LIV+L+SL G++   +  +KV FR + Q  +P   ++     G +F WP+ R +D+ DSL I+    ++   ++  GV+ I L  L     ++L E  +D     T++ L+ E+ Y SP S   +  + DF  P             +N  +     GH       P+D  ++ ++S   D+  S     D+      D  S L     +  ++   +DP   +++DFQ+SVTI EAR LSG NINP  EV  G Q + T+ +M TN+P+YN+YF+F+FR ++ +LM+Q+I I+A++K S +++R +F G +IGEF +D +TVYS     FF KWA LIDPK   SG KG+VK D++VL  G+K K +P KT   ++ +IEAN+L+P I    +R + ++SV +Y+AE LP MNT +M++IKQA+ GD K LADPYV+VSFAG++  TK I  SY+P WN+ IIFTE FPP  +R+RI++ D D + +E I+T FIDL +IMN++   E G LP +GPSW+NLYGTPR Y+Y  M    +  N  + EGVA+RGRLL+AIKT              K G  V S   V   V G++E YLL   +F+A  I  +IGKK K LTFELSIGT G                                          +     +   +K      Q+  S + P         Y+H+P+  +KPCLY+    EDHR R+ I NILD+L  E    + +   L SR K+    R ++ ++     +I    + +++ C GT    +T LD + +  +R+ LEK ++        L              S  ++   ++D  +  + + +   +PQH LPDVF++++  +                 +A+ R+ AR ++ +A   E G+ CG V T++L+K       Q + + +Q QL++ LWLG  ++        +P G+  D    + PP  + Y E +  + R Y++M RNLIGSD+SGLSD F +V+IG+ +  + V  E+ SP+WD T+ +  ++   N   V   PP VV+E+FD D+    EF+GR FCRP V +   + DEY   +L WW VYRG + AG++L SF+L+++D   +    P F  SLE +   +A +   S G  D+         L +P  VRP +  +R+E+L WGVR L R+++ S                V+ PRI +E GG R+ S+ IE     PNF  NL  + L LPVN  +WPP+   C +   FG   +VGNHV+  +++Y  +DK                    +  H  D L +  TA+    A+S  GV N +F  + E  PE         A P  T+                                      +PG       P+K  +  P +E++   DWW R+YA + +LDD       P      DE     I VE  SE D    D  +   VE    D++ +     +    +KK++K  KKKK+K+R F     + K  +  +L E  E    +DE+        DN W+ ++K+Y   LE ++D+GGF   F +F LYRGKQE  DD    + R  G+FKGN+C+Y + +           +  E  L S                     L+K L   + V  +VRVY+V+ ++LHPAD NGK+DPY+++R+GN  I ++ENYIPK LNP+FG+CFE+E  FPQ+S L + V DWD L+ DDLIGET IDLENR  S HR TCGL   Y+  GY +W+D QLP+ IL  LC +N + PPKY+     V + G+TF   S +ED+ G++ +S EPLAL VL+NW D V    LV EH+E+RPL+  EKPGIEQG +EMWVD+FP+    PPP +DISPR+P +YELR++I  T  V+L +T+  +     DI++K WMK   ID Q TD H+RSL+G+G FNWRF+FQF+YLKAED IVYK K+  + IDE E K PC L++QV D+D++ +D  +G L  RLS+ P+ AK  K+C  FQ          ++F+N++ RGWWP +   +DE  E+    E+GG V+ E+ L+   EAE+NPAGLGR EP PL +PNRP+ SF   L+P   +K+ I
Sbjct:    1 MALIVSLRSLDGLEGKSDRILKVTFRGNTQTTSPVASSRFQCYFGQQFQWPVGRPIDEADSLEIRAYNYSKILNNRQIGVLRISLQHLAETGSLDLREHLIDANNAPTNVILDCELRYYSPDSRIGDWQQDDFLYPVDGGVLKDGDGSDFNDDEALEAGGHAEDEADWPADARALLANS--ADDRLSSLQFEDEAASMLSDGASSLGNEMRKTLEVAAVLDPTLHRMEDFQVSVTIVEARQLSGANINPCVEVRIGDQLKRTDTQMSTNSPYYNQYFAFEFRTTKADLMDQVIHIRAVNKGSMMISR-LFAGDLIGEFRLDVRTVYSAPDRMFFQKWACLIDPKDALSGPKGYVKCDINVLGKGEKLKVQPKKTKSSDEEDIEANLLLP-IGVPIKRQMADISVIIYRAEGLPKMNTDLMASIKQALAGDSKPLADPYVQVSFAGHSAKTKSIKNSYNPHWNEAIIFTELFPPLCNRIRISLFDWDAVYNECIATHFIDLGQIMNNS---ENGHLPIFGPSWVNLYGTPRNYNYENMFHPKEELNHGMGEGVAYRGRLLMAIKTEIKQAGGVGGGGGSKAGARVVSAAQVPEAVTGRKEDYLLAGILFDAGAIDADIGKKGKLLTFELSIGTHGNHVDGSFDDASDEDSADEASDFSDSAAGEDSDAELEGAQNRRLLAGGTAVAKEKLRGQRHQWCRSQSRPLMPLPAHEDYYHVPFMERKPCLYIRFGHEDHRQRMLIANILDRLCSEFESGIEEAQELVSREKRGAPSR-LRDALRRLSGAIPTASTTVRTVCHGTRAGPRTRLDQRRELAVRLALEKARVKSGALARQLRRHCAKAATNSSGGSASSLRGHLRDCRALARRIRELAEEPQHALPDVFVWLLAQDGGGGGGGQRQRRRQQQRLAFARLPARQVLQAAGEHETGRDCGRVITLFLRKPGRKGAGQ-SGWTLQCQLKLLLWLGPFREAATSLWPAVPAGYLGDPMRRRRPPSELVYGERTVLEFRAYVFMARNLIGSDESGLSDAFARVVIGDQVVSTHVIPESLSPVWDRTLSVTPLIIYLNEVDVLNHPPVVVVEVFDDDTIGKSEFLGRCFCRPQVTLLSSQQDEYRPPQLDWWEVYRGQLNAGELLASFELVQLDANGR---TPDFVESLEQIRIASANIPRGSSGRGDDSDATVQSHHLPVPQSVRPQLAPYRIEVLFWGVRDLARVQLQS----------------VDSPRIEVEFGGRRVWSETIESCRLKPNFPRNLKCLDLMLPVNRWYWPPLMFQCEDSRQFGRTVLVGNHVVPSVLKYIRKDKSERRDKSGTVSSVAASNNIGNRKHWKDQLTAAKTAKTPTAASSAAGVDNPSFIPEPETEPEVLAGHPAGTADPPGTSQAAQAALPAITAEAAGSEVGQSSEARTLDLAAENGQGTIPGTAMDLKLPQK--KLPPSREDLLEMDWWGRFYAAIDNLDDEIVDQTDPESDSDTDEDILRDIDVEIRSEGDPAAEDNIVDIPVEEVKVDKKKQKKAEKKAKKLRKKRQKLLKKKKRKERRFRLPFGERKDARAAYLAEKHED---DDEQQGGRPHGEDNGWVSQMKLYHQPLEAVRDFGGFSHAFHTFPLYRGKQE--DDDAPPESRAVGIFKGNLCVYQISQAEF--------EAPEPTLPSL------------------FTLHKDLPSNNPVSVLVRVYIVRCVDLHPADPNGKSDPYLILRLGNTTINEKENYIPKQLNPVFGKCFELEAKFPQDSGLQLLVMDWDLLSGDDLIGETRIDLENRLYSRHRATCGLPIEYSTFGYNRWRDQQLPSTILARLCRENELDPPKYEPAYSRVTVDGRTFYEHSEVEDEAGNKTQSNEPLALKVLNNW-DQVTGVALVPEHVESRPLFSPEKPGIEQGRVEMWVDLFPTELGSPPPQVDISPRQPVAYELRVIIWDTAEVKLDETD-LSGASCSDIFVKGWMKGLGIDEQVTDVHYRSLTGEGNFNWRFIFQFEYLKAEDKIVYKVKDSPFAIDEEERKAPCQLHLQVWDADIVSADDFLGGLDLRLSRLPRGAKSAKACGAFQLERDSGVRAISIFRNRRCRGWWPFIGESEDEPGEQ----ELGGKVDAELQLLTAAEAEANPAGLGRSEPQPLPEPNRPETSFNFLLSPLKALKFLI 2114          
BLAST of Otoferlin vs. TrEMBL
Match: gnl|BL_ORD_ID|18309683 (tr|A0A267FMI5|A0A267FMI5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025810g1 PE=4 SV=1)

HSP 1 Score: 1287.32 bits (3330), Expect = 0.000e+0
Identity = 801/2177 (36.79%), Postives = 1175/2177 (53.97%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDH-QFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVP------------SYNLTKLERHEGHIR----LPSDTSSVESDSDNGDNEPS-----DDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPK-RPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-------TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG------------------------------------------ICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKS-CRGT--AKKTLLDVKYQKLIRMGLEKMKMSWSVTIECL--------------SVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIR---------------VAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKM-GLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFI---RGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGF-PSLENLMEMTAQVNDNSKGEKDE-------EKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDK--------------INEDLDHESDHLQSLTAQFDMK-----ANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN-------------------------------------PVPGE------PEKLIRFVP-KEEMESADWWTRYYATLGDLDD---PNLYKPEDE-----ILVESESE-DEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLF-----QHKSTKELFLKEVQEHLILEDEKLS------DNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPP-IDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            M+LIV+L+SL G++   +  +KV FR + Q  +P   ++     G +F WP+ R +D+ DSL I+    ++   ++  GV+ I L  L     ++L E  +D     T++ L+ E+ Y SP S   +  + DF  P             +N  +     GH       P+D  ++ ++S   D+  S     D+      D  S L     +  ++   +DP   +++DFQ+SVTI EAR LSG NINP  EV  G Q + T+ +M TN+P+YN+YF+F+FR ++ +LM+Q+I I+A++K S +++R +F G +IGEF +D +TVYS     FF KWA LIDPK   SG KG+VK D++VL  G+K K +P KT   ++ +IEAN+L+P I    +R + ++SV +Y+AE LP MNT +M++IKQA+ GD K LADPYV+VSFAG++  TK I  SY+P WN+ IIFTE FPP  +R+RI++ D D + +E I+T FIDL +IMN++   E G LP +GPSW+NLYGTPR Y+Y  M    +  N+ + EGVA+RGRLL+AIKT              K G  V S   V   V G++E YLL   +F+A  I   IGKK K LTFELSIGT G                                          +     +   +K      Q+  S + P         Y+H+P+  +KPCLY+    EDHR R+ I NILD+L  E    + +   L SR K+    R +  ++     +I    + +++ C GT    +T LD + +  +R+ LEK ++        L              S  ++   ++D  +  + + +   +PQH LPDVF++++  +                 +A+ R+ AR ++ +A   E G+ CG V T++L+K       Q + + +Q QL++ LWLG  ++        +P G+  D    + PP  + Y E +  + R Y++M RNLIGSD+SGLSD F +V+IG+ +  + V  E+ SP+WD T+ +  ++   N   V   PP VV+E+FD D+    EF+GR FCRP V +   + D+Y   +L WW VYRG + AG++L SF+L+++D   +    P F  SLE +   +A +   S G  D          L +P  VRP +  +R+E+L WGVR L R+++ S                V+ PRI +E GG R+ S+ IE     PNF  NL  + L LPVN  +WPP+   C +   FG   +VGNHV+  +++Y  +DK               + ++ +       LTA    K     +++ GV N +F  + E  PE         A P  T+                                      +PG       P+K  +  P +E++   DWW R+YA + +LDD   P      DE     I VE  SE D    D  +   VE    D++ +     +    +KK++K  KKKK+K+R F     + K  +  +L E  E    +DE+        DN W+ ++K+Y   LE ++D+GGF   F +F LYRGKQE  DD    + R  G+FKGN+C+Y + +           +  E  L S                     L+K L   + V  +VRVY+V+ ++LHPAD NGK+DPY+++R+GN  I ++ENYIPK LNP+FG+CFE+E  FPQ+S L + V DWD L+ DDLIGET IDLENR  S HR TCGL   Y+  GY +W+D QLP+ IL  LC +N + PPKY+     V + G+TF   S +ED+ G++ +S EPLAL VL+NW D V    LV EH+E+RPL+  EKPGIEQG +EMWVD+FP+    PPP +DISPR+P +YELR++I  T  V+L +T+  +     DI++K WMK   ID Q TD H+RSL+G+G FNWRF+FQF+YLKAED IVYK K+  + IDE E K PC L++QV D+D++ +D  +G L  RLS+ P+ AK  K+C  FQ          ++F+N++ RGWWP +   +DE  E     E+GG V+ E+ L+   EAE+NPAGLGR EP PL +PNRP+ SF   L+P   +K+ I
Sbjct:    1 MALIVSLRSLDGLEGKSDRILKVTFRGNTQTTSPVASSRFQCYFGQQFQWPVGRPIDEADSLEIRAYNYSKILNNRQIGVLRISLQHLAETGSLDLREHLIDANNAPTNVILDCELRYYSPDSRIGDWQQDDFLYPVDGGVLKDGDGSDFNDDEALEAGGHAEDEADWPADARALLANS--ADDRLSSLQFEDEAASMLSDGASSLGNEMRKTLEVAAVLDPTLHRMEDFQVSVTIVEARQLSGANINPCVEVRIGDQLKRTDTQMSTNSPYYNQYFAFEFRTTKADLMDQVIHIRAVNKGSMMISR-LFAGDLIGEFRLDVRTVYSAPDRMFFQKWACLIDPKDALSGPKGYVKCDINVLGKGEKLKVQPKKTKSSDEEDIEANLLLP-IGVPIKRQMADISVIIYRAEGLPKMNTDLMASIKQALAGDSKPLADPYVQVSFAGHSAKTKSIKNSYNPHWNEAIIFTELFPPLCNRIRISLFDWDAVYNECIATHFIDLGQIMNNS---ENGHLPIFGPSWVNLYGTPRNYNYENMFHPKEELNRGMGEGVAYRGRLLMAIKTEIKQAGGVGGGGGSKAGARVVSAAQVPEAVTGRKEDYLLAGILFDAGAIDANIGKKGKLLTFELSIGTHGNHVDGSFDDASDEDSADEASDFSDSAAGEDSDAELEGAQNRRLLAGGTAVAKEKLRGQRHQWCRSQSRPLMPLPAHEDYYHVPFMERKPCLYIRFGHEDHRQRMLIANILDRLCSEFESGIEEAQELVSREKRGAPSR-LHDALRRLSGAIPTASTTVRAVCHGTRAGPRTRLDQRRELAVRLALEKARVKSGALARQLRRHCAKAATNSSGGSASSLRGHLRDCRALARRIRELAEEPQHALPDVFVWLLAQDGGGGGGGQRQRRRQQQRLAFARLPARQVLQAAGEHETGRDCGRVITLFLRKPGRKGAGQ-SGWTLQCQLKLLLWLGPFREAATSLWPAVPAGYLGDPMRRRRPPSELVYGERTVLEFRAYVFMARNLIGSDESGLSDAFARVVIGDQVVSTHVIPESLSPVWDRTLSVTPLIIYLNEVDVLNHPPVVVVEVFDDDTIGKSEFLGRCFCRPQVTLLSSQQDDYRPPQLDWWEVYRGQLNAGELLASFELVQLDANGR---TPDFVESLEQIRVASANIPRGSSGRGDHSDATVQSHHLPVPPSVRPQLAPYRIEVLFWGVRDLARVQLQS----------------VDSPRIEVEFGGRRVWSETIESCRLKPNFPRNLKCLDLMLPVNRWYWPPLMFQCEDSRQFGRTVLVGNHVVPSVLKYIRKDKSERRDKSGTVSSVAASNNIGNRKHWKDQLTAAKTAKTPTAVSSAAGVDNPSFIPEPETEPEVLAGHPAGTADPPGTSQAAQAALPAITAEAAGSEVGQSSEARTLDLAAENGQGTIPGTAMDLKLPQK--KLPPSREDLLEMDWWGRFYAAIDNLDDETDPESDSDTDEDILRDIDVEIRSEGDPAVEDNIVDIPVEEVKVDKKKQKKAEKKAKKLRKKRQKLLKKKKRKERRFRLPFGERKDARAAYLAEKHED---DDEQQGGRPHGEDNGWVSQMKLYHQPLEAVRDFGGFSHAFHTFPLYRGKQE--DDDAPPESRAVGIFKGNLCVYQISQAEF--------EAPEPTLPSL------------------FTLHKDLPSNNPVSVLVRVYIVRCVDLHPADPNGKSDPYLILRLGNTTINEKENYIPKQLNPVFGKCFELEAKFPQDSGLQLLVMDWDLLSGDDLIGETRIDLENRLYSRHRATCGLPIEYSTFGYNRWRDQQLPSTILARLCRENELDPPKYEPAYSRVTVDGRTFYEHSEVEDEAGNKTQSNEPLALKVLNNW-DQVTGVALVPEHVESRPLFSPEKPGIEQGRVEMWVDLFPTELGSPPPQVDISPRQPVAYELRVIIWDTAEVKLDETD-LSGASCSDIFVKGWMKGLGIDEQVTDVHYRSLTGEGNFNWRFIFQFEYLKAEDKIVYKVKDSPFAIDEEERKAPCQLHLQVWDADIVSADDFLGGLDLRLSRLPRGAKSAKACGAFQLERDSGVRAISIFRNRRCRGWWPFIGESEDEPGEP----ELGGKVDAELQLLTAAEAEANPAGLGRSEPQPLPEPNRPETSFNFLLSPLKALKFLI 2110          
BLAST of Otoferlin vs. TrEMBL
Match: gnl|BL_ORD_ID|16176668 (tr|A0A4V3SFZ3|A0A4V3SFZ3_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003257 PE=4 SV=1)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 789/2163 (36.48%), Postives = 1203/2163 (55.62%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLT-KLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGD--NYSELSLLPE-RDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQIL-CQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSI-KIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG-----------ICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKM-SWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTA-------------------------QVNDNSKGEKDEEKLRIPFDV------RPP----------IGLFRLELLIWGVRQLQRI-EIISPKRH---------AVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYY---------------------VEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNK----AFDNKDEKGPEK------------------------TKAGVKSDAKPDVTNPVPGEPEKLIRFVPK-EEMESADWWTRYYAT---------------LGDLDDPNLYKPEDEILVESESEDEIRRDIF-------LGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQHKST---KELFLKEVQEHLIL-EDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPP-IDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVDKITGG 6105
            MSL V ++ + G+    E  +K  FR    +T     + S     +  WP++R LD  D LV+    + +  P  L G + + L +L  +  + L E  VDE  R T + + FEI + SP      + + + + P   L   L+ + G  R      + ES  D  D     +    DGD  N S+    PE RD ++   I     K + +Q+ V + EAR L G NINP+  V  GK+ Q T  K  TN PFY+ YFSFD + +R +L+ + I+I+  + + H + R + PGKVIGEF  D +TVY  + H+ F KWAV++DPK P +G KG+VKVD+SV+  G +  R NK + ++D NIEAN+++P+ L  Q Q ++  +++ VYQAEDLP M+T I + ++QA +G+G A  DP VEV +AG+   TK      SP WNQ++IF   FPP    +R+ V+++  IK+E I+T  IDL  IM+       G+LP++GP+WINLYGTPR Y+YA+M++ +   N  L EGVA+RGRLL+AI T  + D+I ++G  +    PVS  VAGK+ +Y LFASIF+AT+I Q +G K KP++FE+S+G  G             P E++   +  E  +  +  S TEP    T D +Y+ + +  +KPC+YMI+  EDHR R+ IPNIL++L + L   + +  +   R +  +A ++ +  M      I  V+  ++ CRGTA +T LD+ + + IR  L+++ + +W ++   +    I   ++++N+ +K +   M  P   LPD+F+ MIQD  RV + R+ ARD+ +S +  EKG+  G + T++++K     + +K  + IQ QL +YLWLGLLKD   YK+G+P G    CF+   PP  + Y++ S F+LR Y+++ RNLI SD+SGLSDP  +V+I E++ ++   ++T SP+WD  ++   ++F ++PK +K     +V+E+FD D   + EF+GR FC  +V+I GD+Y    LQWW +YRG   AG++L +FDLI++D    R+   G P+   +   T                            +++ + + DEE   +  D       +PP          +GL   +L +    +  RI + I P            ++  + R  + PV +P++ IEIGG +I+S+I+ D      F ++     + LPV+ ++WPP+ +NC +   FG K +VG +  +++ +Y                      +  ++N  LD   D   +++ +   K  SD  +++      ++ +E  P +                        ++ G + D  PD  +   G PE ++   P  E++ SAD+WTRY+AT               L D D  +L +  D+I V  E  +E+  +I           +     + ++  +    +   + +K+++K+ +KKK ++ F  K T   K+++ KE  + LIL E  +  D SW+E+I IY   LE I+D+ GF  PFR+F LY+GKQ E++   E   R AG  KGN+ IY V +D        +    +++L  F                      K L     V   VRVYVV+ I LHPAD NG ADPY+++ +G   I ++++Y PKTLNP FG+ +E     P +S L +QV D+DR+  +DLIGET ID+ENR+ SPHR TCGLM+ YN HGY+KWKDS LPT IL+  C+K  I  P Y+ + + V + G+  ++ + I ++ G  +KS+EPLAL VL  +  +    +LV EH+ETR L   ++PG+ QG L++WVD+F     +PPP IDISPR+P  YELR++I  T +V L DT+ F+ E S DIY++ W+K   +D QKTD H+RSLSG+G FNWRF+F FDY+KAED I +K+K  ++++    K+ C L +Q+ D+D+  SD  +G +   LS  P+ AK  KSC   Q +  C +F+LFKN +VRGWWP         +E    LE+ G VE EM+L+   +AE++PAG  REEP  L KPNRPD SF   L P NT++YF KY+LKWILIKILI+ +F+LII LFIY FPG     IV KI G 
Sbjct:    1 MSLTVRVKYIDGLVGKGERVVKGNFRGSVQKTKRVLGRDSVYFDYQLTWPVSRPLDDRDKLVLSVYTVRKVPPWSLLGTVTVNLYSLNREPRLQLRENLVDENNRATSMIVAFEIAHQSPDGRVSGIDQQELSFPVTPLDYGLQAYPGDERSDPQIEAGESALDFEDEYTVLERMQGDGDVENLSDAFSGPEPRDPRITDRIGETIFKAQPYQLVVNVIEARRLFGTNINPVVTVTVGKEVQKTPAKFATNHPFYDSYFSFDLQRARQQLLTETIKIQVFNIRQHPMLR-LLPGKVIGEFVTDVRTVYDYKQHTIFNKWAVIVDPKDPWAGPKGYVKVDMSVVEQGQQMVR-NKREIDQDENIEANLILPRYLRGQKQDTMVSLAIQVYQAEDLPPMHTDISNKMRQAFVGEGAANVDPLVEVCYAGFKCQTKTKRYDASPIWNQELIFNNYFPPLTHAIRVNVKNAG-IKNEIIATHLIDLTTIMDLRTG---GYLPSFGPAWINLYGTPRIYTYAQMLRPEDELNLGLGEGVAYRGRLLMAI-TAKKDDTIERVGTAIEVATPVSETVAGKKNVYFLFASIFDATVIDQNLGSKNKPISFEISMGLFGNQLDGKRGGVDEIPIEFAKSAEGRERVD--WRKSTTEPMLPRTDDKEYYFLDFGPRKPCIYMISYFEDHRCRMCIPNILERLYEYLNYGLERFRFFTLRRQPHKARQWFRTLMRRLSKRITSVIQDVEGCRGTAMRTKLDIYHARRIRRDLKRIAVQAWKLS--SVQKHEIGEKVREVNAMLKRIVKLMQHPLDALPDIFISMIQDGRRVGFARVPARDIYYSVVESEKGKWNGQLATIFIRKQGREGVGEK-GWKIQCQLSVYLWLGLLKDFTAYKLGIPGGVDPMCFSRTKPPDELVYLQRSRFELRCYIFIARNLIASDESGLSDPLARVLIKEYVLQTQPLYQTMSPMWD-VLLHKQLLFYHDPKSMKENLQQLVVEVFDVDPGNELEFLGRCFCGINVWIEGDKYKPPGLQWWPLYRGQTDAGELLAAFDLIQLD---TRVPFEGIPTFAEIAAYTKDFDQRVILKSIPGMVLDDEDDLNRESTDEDYESDVDEEDELLDADSIIVAQHKPPRQKDRRRTVKLGLAPPQLAVRRREEDYRIPDSIRPPLQRFRFEVLFWSMFGMVRQQLLPVRRPKVTIEIGGTKIESEIMHDLRKRRLFENHFKVADVYLPVDERYWPPVVMNCHDNRTFGTKVIVGTYTFSNVRDYLDVSSLGLPEDDEDSMYDEGPNLAPRLNIRLDSLFDKEDAMSGRDQSKKRSDASASRRSEVTIEDSEESEPTEINLDDINPNFVAPKLEGSMDKRSLSETGEQRDP-PDYMDITAGGPEAVVHMGPTPEQLASADFWTRYFATINAADTYKEEEHHDELTDSDASSLSEKLDQIKVAEEPAEEVPMEILDPSATAQQKRKWWKKKKKQKRILTGREKRQLEIEKRRRKRVQKKKLRQKFAEKFTGDSKKMYYKEHYDDLILNEGTQGEDLSWVEKIMIYPTGLEEIEDFKGFVDPFRNFPLYKGKQTEDEASPE--SRLAGFLKGNLLIYAVNDDA-------EMPTQQTELKLF----------------------KTLPLKARVKLTVRVYVVRAIGLHPADRNGLADPYLILSLGKVVIDEKDDYKPKTLNPYFGKYYEFTAMLPVDSMLTIQVMDYDRVGSNDLIGETRIDIENRYHSPHRATCGLMNVYNTHGYVKWKDSLLPTEILERQCQKRGIEQPVYNLLENKVTVGGQDLHAITEITNESGGTVKSVEPLALEVLKRFSTLPSGIELVPEHVETRALVHPDRPGMSQGRLQLWVDIFDRSLGVPPPAIDISPRQPIQYELRVIIWNTADVILNDTSLFSSEMSSDIYVRGWVKGVGVDDQKTDIHYRSLSGEGNFNWRFIFPFDYIKAEDRIEFKDKGPFDVEPITIKSNCELTLQIWDADVFSSDNFLGGITMHLSAIPRCAKTPKSCGLHQLAPDCPRFSLFKNSQVRGWWPCA-------DEVFEKLEVQGKVECEMNLLTAVDAENSPAGRAREEPNALPKPNRPDSSFQRILGPLNTLRYFCKYKLKWILIKILIIFLFLLIIALFIYTFPG----AIVHKIVGA 2104          
BLAST of Otoferlin vs. TrEMBL
Match: gnl|BL_ORD_ID|18215499 (tr|A0A1I8H3R8|A0A1I8H3R8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 775/2183 (35.50%), Postives = 1136/2183 (52.04%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDH-QFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVP------------SYNLTKLERHEGHIR----LPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKD----FQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIK-----------ALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPK-RPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-------TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG------------------------------------------ICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGT--AKKTLLDVKYQKLIRMGLEKMKMSWSVTIECL--------------SVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIR---------------VAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKM-GLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGF-PSLENLMEMTAQVNDNSKGEKDE-------EKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDK--------------INEDLDHESDHLQSLTAQFDMK-----ANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN-------------------------------------PVPGE------PEKLIRFVP-KEEMESADWWTRYYATLGDLDD---PNLYKPEDE-----ILVESESE-DEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLF-----QHKSTKELFLKEVQEHLILEDEKLS------DNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPP-IDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            M+LIV+L+SL G++   +  +KV FR + Q  +P   ++     G +F WP+ R +D+ DSL I+    ++   ++  GV+ I L  L     ++L E  +D     T++ L+ E+ Y SP S   +  + DF  P             +N  +     GH       P+D  ++ ++S +              D  S L    E    L      L  +++       +SVTI EAR LSG NINP  EV  G Q + T+ +M TN+P+YN+YF+F+FR ++ +LM+Q+I I+           A++K S +++R +F G +IGEF +D +TVYS     FF KWA LIDPK   SG KG+VK D++VL  G+K K +P KT   ++ +IEAN+L+P I    +R + ++SV +Y+AE LP MNT +M++IKQA+ GD K LADPYV+VSFAG++  TK I  SY+P WN+ IIFTE FPP  +R+RI++ D D + +E I+T FIDL +IMN++   E G LP +GPSW+NLYGTPR Y+Y  M    +  N+ + EGVA+RGRLL+AIKT              K G  V S   V   V G++E YLL   +F+A  I   IGKK K LTFELSIGT G                                          +     +   +K      Q+  S + P         Y+H+P+  +KPCLY+    EDHR R+ I NILD+L+                     A+R +  ++ T   ++  V      C GT    +T LD + +  +R+ LEK ++        L              S  ++   ++D  +  + + +   +PQH LPDVF++++  +                 +A+ R+ AR ++ +A   E G+ CG V T++L+K       Q + + +Q QL++ LWLG  ++        +P G+  D    + PP  + Y E +  + R Y++M RNLIGSD+SGLSD F +V+IG+ +  + V  E+ SP+WD T+ +  ++   N   V   PP VV+E+FD D+                                     + AG++L SF+L+++D   +    P F  SLE +   +A +   S G  D          L +P  VRP +  +R+E+L WGVR L R+++ S                V+ PRI +E GG R+ S+ IE     PNF  NL  + L LPVN  +WPP+   C +   FG   +VGNHV+  +++Y  +DK               + ++ +       LTA    K     +++ GV N +F  + E  PE         A P  T+                                      +PG       P+K  +  P +E++   DWW R+YA + +LDD   P      DE     I VE  SE D    D  +   VE    D++ +     +    +KK++K  KKKK+K+R F     + K  +  +L E  E    +DE+        DN W+ ++K+Y   LE ++D+GGF   F +F LYRGKQE  DD    + R  G+FKGN+C+Y + +           +  E  L S                     L+K L   + V  +VRVY+V+ ++LHPAD NGK+DPY+++R+GN  I ++ENYIPK LNP+FG+CFE+E  FPQ+S L + V DWD L+ DDLIGET IDLENR  S HR TCGL   Y+  GY +W+D QLP+ IL  LC +N + PPKY+     V + G+TF   S +ED+ G++ +S EPLAL VL+NW D V    LV EH+E+RPL+  EKPGIEQG +EMWVD+FP+    PPP +DISPR+P +YELR++I  T  V+L +T+  +     DI++K WMK   ID Q TD H+RSL+G+G FNWRF+FQF+YLKAED IVYK K+  + IDE E K PC L++QV D+D++ +D  +G L  RLS+ P+ AK  K+C  FQ          ++F+N++ RGWWP +   +DE  E+    E+GG V+ E+ L+   EAE+NPAGLGR EP PL +PNRP+ SF   L+P   +K+ I
Sbjct:    1 MALIVSLRSLDGLEGKSDRILKVTFRGNTQTTSPVASSRFQCYFGQQFQWPVGRPIDEADSLEIRAYNYSKILNNRQIGVLRISLQHLAETGSLDLREHLIDANNAPTNVILDCELRYYSPDSRIGDWQQDDFLYPVDGGVLKDGDGSDFNDDEALEAGGHAEDEADWPADARALLANSAD--------------DRLSSLQFEDEAASMLSDGASSLGNEMRKTLEVAAVSVTIVEARQLSGANINPCVEVRIGDQLKRTDTQMSTNSPYYNQYFAFEFRTTKADLMDQVIHIRSTRPTCCTESQAVNKGSMMISR-LFAGDLIGEFRLDVRTVYSAPDRMFFQKWACLIDPKDALSGPKGYVKCDINVLGKGEKLKVQPKKTKSSDEEDIEANLLLP-IGVPIKRQMADISVIIYRAEGLPKMNTDLMASIKQALAGDSKPLADPYVQVSFAGHSAKTKSIKNSYNPHWNEAIIFTELFPPLCNRIRISLFDWDAVYNECIATHFIDLGQIMNNS---ENGHLPIFGPSWVNLYGTPRNYNYENMFHPKEELNRGMGEGVAYRGRLLMAIKTEIKQAGGVGGGGGSKAGARVVSAAQVPEAVTGRKEDYLLAGILFDAGAIDANIGKKGKLLTFELSIGTHGNHVDGSFDDASDEDSADEASDFSDSAAGEDSDAELEGAQNRRLLAGGTAVAKEKLRGQRHQWCRSQSRPLMPLPAHEDYYHVPFMERKPCLYIRFGHEDHRQRMLIANILDRLRLH------------------DALRRLSGAIPTASTTVRAV------CHGTRAGPRTRLDQRRELAVRLALEKARVKSGALARQLRRHCAKAATNSSGGSASSLRGHLRDCRALARRIRELAEEPQHALPDVFVWLLAQDGGGGGGGQRQRRRQQQRLAFARLPARQVLQAAGEHETGRDCGRVITLFLRKPGRKGAGQ-SGWTLQCQLKLLLWLGPFREAATSLWPAVPAGYLGDPMRRRRPPSELVYGERTVLEFRAYVFMARNLIGSDESGLSDAFARVVIGDQVVSTHVIPESLSPVWDRTLSVTPLIIYLNEVDVLNHPPVVVVEVFDDDT------------------------------------ILNAGELLASFELVQLDANGR---TPDFVESLEQIRVASANIPRGSSGRGDHSDATVQSHHLPVPPSVRPQLAPYRIEVLFWGVRDLARVQLQS----------------VDSPRIEVEFGGRRVWSETIESCRLKPNFPRNLKCLDLMLPVNRWYWPPLMFQCEDSRQFGRTVLVGNHVVPSVLKYIRKDKSERRDKSGTVSSVAASNNIGNRKHWKDQLTAAKTAKTPTAVSSAAGVDNPSFIPEPETEPEVLAGHPAGTADPPGTSQAAQAALPAITAEAAGSEVGQSSEARTLDLAAENGQGTIPGTAMDLKLPQK--KLPPSREDLLEMDWWGRFYAAIDNLDDETDPESDSDTDEDILRDIDVEIRSEGDPAVEDNIVDIPVEEVKVDKKKQKKAEKKAKKLRKKRQKLLKKKKRKERRFRLPFGERKDARAAYLAEKHED---DDEQQGGRPHGEDNGWVSQMKLYHQPLEAVRDFGGFSHAFHTFPLYRGKQE--DDDAPPESRAVGIFKGNLCVYQISQAEF--------EAPEPTLPSL------------------FTLHKDLPSNNPVSVLVRVYIVRCVDLHPADPNGKSDPYLILRLGNTTINEKENYIPKQLNPVFGKCFELEAKFPQDSGLQLLVMDWDLLSGDDLIGETRIDLENRLYSRHRATCGLPIEYSTFGYNRWRDQQLPSTILARLCRENELDPPKYEPAYSRVTVDGRTFYEHSEVEDEAGNKTQSNEPLALKVLNNW-DQVTGVALVPEHVESRPLFSPEKPGIEQGRVEMWVDLFPTELGSPPPQVDISPRQPVAYELRVIIWDTAEVKLDETD-LSGASCSDIFVKGWMKGLGIDEQVTDVHYRSLTGEGNFNWRFIFQFEYLKAEDKIVYKVKDSPFAIDEEERKAPCQLHLQVWDADIVSADDFLGGLDLRLSRLPRGAKSAKACGAFQLERDSGVRAISIFRNRRCRGWWPFIGESEDEPGEQ----ELGGKVDAELQLLTAAEAEANPAGLGRSEPQPLPEPNRPETSFNFLLSPLKALKFLI 2045          
BLAST of Otoferlin vs. TrEMBL
Match: gnl|BL_ORD_ID|17685862 (tr|A0A5N4AHX3|A0A5N4AHX3_PHOPY Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_11016 PE=4 SV=1)

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 709/2014 (35.20%), Postives = 1050/2014 (52.14%), Query Frame = 1
Query:  190 RFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMV--QQCIN--LDET------FVDEQMRITDIALNFE-IEYNSPVSGNENLGKSDFNVPSYNLTK----LERHEGHIRLPSDTSSVESDSDN----GDNEPSDDIDVKD------------------------------------GDNYSELSLLPERDFKLPKHIDPL-----SLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT--TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPD-----EYSHLPKKEENFES-----QYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAK--KTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGF------HKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEI-DPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK--LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKG---PEKTKAGVKSDAKPDVTNPVP-GEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLG--YRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQ---EEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKF-NLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKP 5913
            R+ WPI R LD  + L I+ +  NR  PDK+ G   + L  ++   + CI+  L+++        D+Q  + DI  N   +E +   S  E++G     VP  +L +    L     H RL    SS  ++  N    G   P       +                                    GD     S+  E D K    +D       ++K  DFQIS+TI EAR L+G N++P+  +  G QK+ T +K  TN P+YNEYF FDF +  + L E+II +          +R +   K +G F +D  TV+    H F++KWA+L+DP   T+G KG++K D+SV+  GD  K P  ++K+ED NIEAN+L+P  +    R      + +Y+A+ LP MN+ IM+N+K+A  G+   L DPYV+VSFAG TG T V    Y+P WN+Q++FTE FPP   R++I +RD+D +  + I T FIDL  I N     E+GFLPT+GPS+++LYG+ R YS   +I      N  L EGV++RGR+L+AI+T  T   D I   V++    P+S    GK E + LFA+I +A +I +++G K  P+ FE+S+G  G   D     +  H+  ++++ E+     +   S T P    T +  Y+ +PY   KPC+++ +   D+R R++I N ++K+ ++L + +++VN+L    +    +R +K+ +E   I   K ++  K  +  A   KT LD +  KL +  +E +          ++  ++    K  +S++  L   + DPQH +PD+FL+++    R AY RI+ARD++++ +  E+G+ CG V T++LK      LP K     T + IQA+LQI LWLGLLK  + +  G+P G+              +PP  I Y E+  FQLR ++Y  R+LIGSD SGLSDPF  VI GE  + + V  ET SP WDE +I D I+     + ++  PP V++EIFD D     EFIGR   +P V +RGD Y   K    L+W++V R    AG++L +F+L+E  D  SK   +P  P        T Q +D+   +  +    L +P  +RP +  +R+E+L WG+R L+R+ +++                V++PR+ I+  G+ + S II +   +PNF+  +  + L LP    + PP++I  ++   FG   +VG H I   I+ Y+            +  +S+ A          ++    D   EK    P++    +   ++     P P  + +K      + E E  DWWT+YY++ GD+        +D     S+++  +R DI       VE  S    D                            F+   T   F+ ++      + ++ S  S I     +  ELE I ++ GFK    +F LYRGK+   E EDD     +R  G FKG I IY     N         D ++  L  F                 N  L + L     +  +VRVYVVK + LHP D+NGKADPYI++++G K + D+ENY+ K LNP+FG+CFE E TFPQ+S L VQ++DWD ++ DD+IGET IDLENR+ S HR TCG+   Y   GY  W+D   PT IL  LC++  I PP Y   +  V  +    N D   E DD   ++  E +AL +LH W +    C L  EHIETR LY  EKPG+EQG +EMWVDMFP    +P PP +ISPRKP  YELR++I  T+ V L D  FFT EK  DIY+K W+K T+ D Q TD H+RSL+G+G FNWRFV+ FDYL AE  IV  K ++++  DE+E K P  L++QV D+D   +D  +G L   L+KFP+ AK  K C  +    +D      N+FK K+++GWWP      +E       LE+ G VE E+ L+  EEAE NP GLGR EP PL+KP
Sbjct:   33 RYDWPIGRPLDHNELLQIELVSQNRVLPDKIIGYYGLFLQRVISDGRLCISDYLNDSNHKTLPVNDDQQMLIDIEQNIANLERSLSTSQAESVGGGSIKVPRKSLLQRAISLNVSSSHERLDKRKSSALANVKNLIKIGKQRPPKSRTTSEESLLIYADEPGRVSRLSGADSAPISRAGSQASVTSMGDTLEYASIPVELDKKPRVKVDMATTVHSAMKALDFQISITIIEARQLTGLNMDPVVCIQIGDQKKFTSVKESTNCPYYNEYFVFDFHMPPIMLFEKIITLTVWQ------SRKLRSNKFVGSFKLDVATVWCQTDHQFYHKWALLMDPDDITAGPKGYLKCDISVIGKGDSIKVPQISEKDED-NIEANLLLPDGV-PVDRQHARFIIKIYRADGLPKMNSSIMANVKKAFTGELNDLVDPYVQVSFAGLTGQTSVKKNCYAPVWNEQLVFTEMFPPLCQRIKIQLRDNDPVNPKVIGTHFIDLKAISNDG---EKGFLPTFGPSFVHLYGSTRDYS---LIDEHSNLNIGLGEGVSYRGRILLAIRTELTENIDLIPSDVELDQIPPISETSYGKNEEFFLFATILDANMIEKKLGDK--PMYFEISVGNAGNAMDGQNLSKKEHVEIEKDDLEAVVTDLESWQSTTPPTKPMTHNKLYYFLPYWDNKPCMHIKSVWPDYRRRMYISNQIEKIAEKLDDGLQEVNHLIEMERSGSDLR-LKQVLEELMIGCQKYVTLAKDAQSGAGTGKTKLDKERMKLCQREIENIGTLARNLRAIVTKSSLKERYKTAHSYLATLQSLVDDPQHAVPDIFLWLVSGGKRQAYHRIIARDILYAIVDEERGKSCGKVQTIFLK------LPGKKAVGPTGWAIQAKLQISLWLGLLKQKKNFLNGVPNGYEITQEIRNADRPHALPPLTIHYTEKHVFQLRAHIYQARSLIGSDASGLSDPFATVIAGEFSKTTQVIDETVSPTWDELLIFDEILIYGTSEDIQQDPPFVIIEIFDQDKVGKSEFIGRTMAKPHVKLRGDAYWKPKFPPSLEWFDVKRSADRAGELLATFELLEYPDGDSKEEALPPTPE-------TKQASDSKDTDMKDLGPILPVPKGIRPTLCTYRIEVLFWGLRDLKRVHLMT----------------VDKPRVDIDCAGHTLYSPIIPNAKKNPNFSSPIKFLDLELPEQELYRPPLTIRAVDCRSFGRYTLVGTHTINS-IQKYIYVPRTRREREAEERKRSINAANQTNETHATLNTSTDDENKEKSPLLPKEPNGAISYGSRETTKKPKPETQKKKSEEDELEHEEEDRDWWTKYYSS-GDV-------VKDTRTPASKNQSLLRHDISPSDLEDVEVISSKSTDRKKFG-----------------------FKAVGTATRFVTKLSPKATGKPKRKSAFSRI-----FDMELEKIPEFNGFKDWLHTFELYRGKKSADESEDD-----NRIVGSFKGAITIYKWPLPN---------DFEDFHLTGF---------------DLNYGLLQGLPSNEQIRVLVRVYVVKALELHPMDLNGKADPYIVLQLGAKRVTDKENYVSKQLNPVFGKCFEFEATFPQDSLLTVQIFDWDLVSADDMIGETKIDLENRFYSRHRATCGIALKYEEDGYNAWRDPMKPTQILAKLCKEAKIDPPVYTPGHVKVGRITVPVNVD---EVDDLKIME--ERMALTILHKWHEFPIGCYLTPEHIETRSLYNPEKPGMEQGKIEMWVDMFPMDMPLPGPPTNISPRKPKGYELRVIIWNTDEVVLEDDAFFTGEKMSDIYVKGWVKGTE-DNQSTDIHYRSLTGEGNFNWRFVYNFDYLSAERRIVITKKESVFSWDESETKIPARLDLQVWDADHFSADDFLGALTLDLNKFPRGAKSAKLCTLEMITRNDGSVPMVNIFKQKRIKGWWPFYIKKDNEV------LELTGKVEAELHLLTQEEAEKNPVGLGRNEPEPLDKP 1922          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 394/1268 (31.07%), Postives = 648/1268 (51.10%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKT-KPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLG-----------KSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVK--------DGDNYSELSL------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIK-----TTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH---------------------LPKKEENFESQ-----YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            M+L+V L+++T ++   +   KV FR   F +   +  +        F WP+A K+D  + L I     ++   ++L G   +VL  ++ +  + + +T +D+       +++ EI Y  P+ G+  +            +  F   + +L     H   +   S  S + S  D+      +D+D K        D D  S  S+      +  +  K    ++P + +  D+QISVT+ EAR L G N++P+  V  G+ K+ T +K  TN P+YNEYF FDF +    + ++I+++  +  K+ + +     G ++G F +D  TVYS   H F++KWA+L DP   T+G KG++K D++V+  GD  K P+K ++ ++ +IE N+L+P+ +  ++R      V +Y+AE LP MNT IM+N+K+A +G+ + L DPYV+V FAG  G T V   SY P WN+QIIFTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ L EGV+FR RLLI++      TTS        V +   + +S +  GK E + LF S  EAT++ ++IG K  P+ FE++IG  G   D  S                      L +   + E++        S T P      D  YFH+PY  KKPC+Y+ +  +D R RL+  NI+DK+  +L E +  V  +  + +K    R ++  +E       + ++     +  A +T LD +  K     +E M          +   T+   +K   +F++ L     +PQH +PDVF++M+ +N R+AY RI  +D++ S +  E G+ CG V  V+L+      LP K       + +QA+L++YLWLGL K  + +  GLP GF      K      +PP  + Y  +  FQLR ++Y  R+L  +D SGLSDPF +V    H + + V  ET  P WD+ ++ DN+        ++  PP +V+EI+D D+    E+IGR F +P   +  + Y   +    L+++ +YRG   AG++L +F+L++I P + R  +P                    G  D ++   L +P  +RP +  +R+E+L WG+R L+RI +                  V++PR+ IE  G  I+S + +++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L ++
Sbjct:    1 MALVVYLKTVTELRGKGDRIAKVSFRGLSFYSRVLENCEDEARFEEAFRWPVASKVDGNEMLEIHIYNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTSISIEIRYQ-PMDGSVRVWSDGEFLDVPEEREMFQFETESLLSSHSHICSVCATSVFSLIFSFLDDAAILEMEDLDRKAMRLGGGLDPDTISLASVTAVTTNVSNKRSKPDIKMEPSAGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKLSVIHSKNLLRS-----GTLVGTFKLDVGTVYSQPEHQFYHKWAMLSDPDDITAGCKGYIKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGV-PSERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISVAVEILDTTSPEIMSSTEVQMEPVSNISESATGKLEEFFLFGSFLEATMVDRKIGDK--PINFEVTIGNYGNQLDGVSKPVSGKKKKREGGGESDEEESELIQNSSDEETEDDGDLVSVSSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEII-KTEKAYPERRLRGVLEELSTGCSRFVTLANKDQNQAGRTKLDRERLKSCMREMESMGQQAKTIRSQVKRNTVRDKLKLALNFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPTKDILFSIVDEEMGKDCGKVKAVFLR------LPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLSGLPNGFEENKAVKGTGLQAVPPISLTYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEATELRDDPPIIVIEIYDQDTVGKAEYIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCTAGELLAAFELLQIGP-AGRTELPPI-----------------DGPTDVDRGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQ----------------VDRPRVDIECAGKGIQSALNQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKF 1212          

HSP 2 Score: 498.434 bits (1282), Expect = 4.564e-145
Identity = 268/589 (45.50%), Postives = 365/589 (61.97%), Query Frame = 1
Query: 4240 IYSCELENIKDYGGFKQPFRSFSLYRGKQ-EEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +Y+ ELE   ++  F+    +F+LYRGK  +++D      DR  G FKG++C+Y +   D I     FD +                             +  F S PH+  ++ +VRVYV++  +LHPADINGKADPY+++++G  EI+D+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S HR TCG+ S Y+ HGY  W+D Q PT IL  LC++  +  P Y      V++  + F   + IED++G + ++ E LAL  L +WE+I P   CKL+ EH+ETRPL   +KPGIEQG LEMWVDMFP     P P IDISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRFVF FDYL AE+ IV  K ++++  DE EYK P  L MQV D+D   +D  +G ++  L++FP+ AK  K C  D   +       ++FK K+V+GWWP V   +       + LE+ G VE E+ L+  EEAE +P GLGR EP PLEKPNRPD S + F+NP  +++YFI
Sbjct: 1285 VYNKELET--EFDHFEDWLHTFNLYRGKAIDDDDQNIVDDDRIVGRFKGSLCMYKLPLSDEITRDVGFDPN-----------------------------MGMFQSIPHNDPINVLVRVYVIRATDLHPADINGKADPYVVIKLGKSEIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSLHGYNVWRDPQKPTQILAKLCKEGKLDGPHYGP-GGKVKVANRIFLGPTDIEDENGLKKQTEEHLALTALKHWEEI-PRVGCKLIPEHVETRPLLNPDKPGIEQGRLEMWVDMFPMDVPSPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESLFSWDETEYKIPARLTMQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIDMVLNEQELPTISIFKQKRVKGWWPFVARDE------NDDLELTGKVEAELHLMTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFMNPLKSLRYFI 1834          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 595.504 bits (1534), Expect = 3.935e-179
Identity = 349/1039 (33.59%), Postives = 560/1039 (53.90%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPDSI-KIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG------------------ICPDEYSHLPKKEENFE----SQYVH-SLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH-----KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            I+P + +  DFQISVT+ E R L G N++P+  V  G +K+ T +K  TN P+YNEYF FDF +    + ++I+++  +  K+ + +     G V+G F +D  TVYS   H F++KWA+L DP   T+G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      + +Y+AE LP MNT IM+N+K+A +G+ K L DPYV+V FAG  G T V    Y P WN+QI+FTE+FPP   R+++ +RDSD + D  + T FIDL KI N  +K   GFLPT GP+W+N+YG+ R+Y+   ++   Q  N+ L EGV+FR RLL+++      TS P+ +    V V     +S+N AGK E + LF +  EAT+I ++IG   KP+ FE++IG  G                     DE S L +   + E     + V  S T P      D  YFH+PY  +KPC+Y+ +  +D R RL+  NI+D +  +L E +  V  +  + +K    R ++  +E         L      +  + KT LD +  K     LE M          +   T+    K    F++ L     +PQH +PD++++MI +  R+AY R+ ++D+++S +  E G+ CG V T++ K      LP K       + +QA+ ++YLWLGL +  + +  GLP GF      K       PP  + Y  +  FQLRV+LY  R+L  +D +GLSDPF +V    H + + + +ET  P WD+ ++ DN+        ++  PP +V+EI+D D+    +F+GR F +P   +  + Y   +    L+++ VYRG   AG++L +F+L++I P  K       P ++   +M        +G      L +P  +RP +  +R+E+L WG+R L+R+ +                  V++PR+ IE  G  I+S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG+H +T L ++
Sbjct:  162 IEPGAGRPMDFQISVTVIECRQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFDFHLPPDVIFDKILKLSVIHSKNLLRS-----GTVVGTFKMDVGTVYSQADHQFYHKWAILCDPDDITAGCKGYVKCDIAVVAKGDNIKTPHKANETDEDDIEGNLLLPEGV-PAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLIDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIVFTEQFPPLCKRMKVQIRDSDKVNDVALGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLVSLAVEILDTSSPEVMCSTEVQVEGVPNISDNAAGKIEEFFLFGAFLEATMIDRKIGD--KPINFEVTIGNYGSEVDDTPTKPKSKKSKKGDGDDEESELIQGSSDEEVTDDGELVSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDNIADKLEEGLNDVQEIF-KTEKAFPERRLRGVLEDLSHGCSNFLELANKDQNQSGKTKLDRERLKSCMRELENMSQQAKTMRTQVKKKTVKDKFKQAQIFLQKLRFLADEPQHSVPDIYIWMISNGKRIAYARVPSKDILYSNVEEETGKDCGKVKTIFFK------LPGKKGFGPAGWTVQAKTEMYLWLGLNRQRKDFLSGLPNGFEENKAVKGPGMQSAPPISLIYTMKQIFQLRVHLYQARSLFAADSTGLSDPFARVFFSTHSQVTEILNETLCPTWDQLLVFDNVELYGEACELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGK----ADLPPIDGPTDM-------DRG----PILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGIQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKF 1148          

HSP 2 Score: 496.123 bits (1276), Expect = 1.490e-144
Identity = 261/589 (44.31%), Postives = 367/589 (62.31%), Query Frame = 1
Query: 4237 KIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDD-GYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            ++++ ELEN  ++  F+    +F+LYRGK  ++D+     +DR  G FKG++C+Y V   +    D+  E   +S +                          F + PH+  ++ +VRVYV++  +LHPADINGKADPYI +++G  EI+D+ENYI K LNP+FG+ F++E TFP +S L V VYDWD +  DDLIGET IDLENR+ + HR TCG+ ++Y  HGY  W+D   PT IL  LC+   + PP+Y      V++  + +   + IED++G + ++ E LAL VL++WED+ P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFP     P P +DISPRKP  +ELR++I  T+ V L D + FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRF++ FDYL AE+ IV  K ++++  DE EYK P  LN+QV D+D   +D  +G ++  L++FP+ AK  K C  D   +       N+FK K+++GWWP V   +       + LEI G VE E+ L+ GEEAE +P G GR EP PLEKPNRPD + L FL P   IK+ +
Sbjct: 1231 QVFNRELEN--EFEHFEDWLHTFNLYRGKSGDDDEQNASDEDRLIGKFKGSLCMYKVPMTD----DMGREMGIDSNMG------------------------MFQNIPHNDPINILVRVYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPVFGKSFDIEATFPMDSSLTVSVYDWDLVGTDDLIGETKIDLENRYYTKHRATCGITASYAIHGYNVWRDPMKPTHILAKLCKDGKLDPPQYGP-GGRVKVANRVYTGPTEIEDENGLKKQTDEHLALAVLNHWEDM-PRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPALDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNIQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTIDMVLNEQEMPMVNIFKQKRIKGWWPFVARDE------NDELEITGKVEAELHLMTGEEAEKSPVGEGRNEPEPLEKPNRPDTTLLWFLMPLKAIKHLV 1781          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 495.352 bits (1274), Expect = 8.769e-145
Identity = 321/1044 (30.75%), Postives = 525/1044 (50.29%), Query Frame = 1
Query:  682 ISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNK-TDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIA----IKTTSQPDSIKIGVDVRSCNPVSNNVAGK---------------------------RELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVH---------------------SLTEPKYAYTFDNQ--YFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCE--YVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKM-KMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSK---MPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLI 3630
            IS+ I EAR L G+NI+P   +  G +K+ + +K  TN PFYNEYF FDF   +    +++I++  +  K       I     IG F ID  TVY+   H F  KWA LIDP   ++G KG +K D+ V   GD   R  K +D EE   IE N L+P+    + R      V VY+AE LP MN+ IM+N+ +A + D  AL DPYV VSF    G T     +  P WN+Q++F E FPP   RL+I V D   + D  I T +IDL +I N  + ++ GFLPT+GP+WIN+YG+ R    + ++  +Q  N+ + EGV++RGRL I     I T          + + S +      AGK                            E ++LF ++FEAT+I + IG K  P++FE +IG  G   D  +  P  ++  E  + H                     S T P+  +T      Y+++P  ++KPC+++    ED   RL   N+LD++        Y     ++AS  KKV+                D  L            T+LD K   L +  LE M +++ ++T     V TI   +++     + +   + +PQH LPD+F++M+ +N R+AY RI AR+L++S    EKG+ CG ++T++LK        +   + +QA++ +YLWLG   +       LPEGF     +S+     P+I+ Y +  +FQLR ++Y  R LI +D++GLSDPF +V    H   + + ++T +P W++ +++D +  +     +   PP + +E++D D+    E++G     P V +  + YT+  L +  ++ G++  GDIL +F+LIE+ P S +  +P +   E  +                    +P  +RP +  +R+E+L WG+R+L+++++++                V++P++ IE  G  + S +I+ + ++PNF+  + +  + LP +    PP++I  +++  FG   +VGNHVI +LI
Sbjct:   38 ISINITEARQLVGENIDPSVVIEIGDEKKQSSVKEGTNAPFYNEYFVFDFFAHQEIFFDKVIKLSVMHSK-------IMKSYCIGTFKIDVGTVYNQPGHQFTNKWAALIDPNDISTGVKGHLKCDICVTGKGDVSPRSQKFSDAEE--QIEKNPLVPEGF-PSMRPWARYYVKVYRAEGLPRMNSSIMANVTKAFVSDNTALIDPYVVVSFFSQVGRTSTQKSTADPVWNEQVVFKEMFPPLCRRLKIQVLDEGSMNDVAIGTHYIDLCRISNDQDGDK-GFLPTFGPAWINIYGSARN---STLVDDNQEMNEGIGEGVSYRGRLYIQLAVEILTGGAESKSMFSLKLPSKDAKGGKTAGKDPKAGTGGADTSFIVGNLVFVKVSEENMENFILFGAMFEATMIDRRIGDK--PISFEFTIGNCGNFIDGAAP-PAAKKRGERGFDHPGQEGAMTTPLLEGQAALSCKSTTRPEKPHTGHGNRVYYYLPISTQKPCIHVQCSWEDRTYRLHHSNMLDRIAFLFVSTAYYCGQEFIASVEKKVK----------------DNCL------------TMLDKKRLTLCKQELESMIEVAGTITEPKRKVLTIKEMLQESRKLTQKIRFLVEEPQHTLPDIFVWMLSNNKRLAYARIPARNLLYSENVVEKGKDCGKISTLFLKPPG----KRGATWAVQAKVDVYLWLGKCTESSNMLKNLPEGFEIHGVSSEESGGAPEIVLYKDHHEFQLRAHMYQARGLIAADNTGLSDPFARVSFQSHTHVTAIINQTLTPTWNQMLMMDKLSLHGMLTELAQEPPLITIEVYDDDALGKPEYLGSTVAVPVVKLAEEPYTAPSLHYSPLFCGSLSGGDILGAFELIEV-PKSGKHSLPPYDDPEGSI------------------YPVPSYIRPVLRKYRIEVLFWGLRELKKVQLLT----------------VDRPQVFIECAGKGVSSSVIQSYKSNPNFSMIVDAFEVELPEDEYLHPPLTITVVDWRAFGRSTLVGNHVINNLI 997          

HSP 2 Score: 467.618 bits (1202), Expect = 2.536e-135
Identity = 266/621 (42.83%), Postives = 366/621 (58.94%), Query Frame = 1
Query: 4234 IKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVP-ECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAED-SIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            +KIY  ELE   ++G F    ++F LYRGK  EE+      +RF G FKG  C+Y +             D +E      G+   N+                 +    +V+ ++RVY+V   NLHPAD +GKADPYI++++G   I+DR+NYIPK LNP+FGR FE++ +FP+ES L + +YD+D +  DDLIGET IDLENR+ S HR  CG+ S Y   GY  W+D   PT +L  LC+ N +  P++      + I  K +   ++  D+D   ++S E LAL VLH WE++    CKLV EHIETR LY+++KPG++QG ++MWVD+FP     P PP+DISPRKP  YELRI+I  TE+V L DTNF T ++S DIY+K W+K  + D Q+TD H+ SL+G+G FNWRFVF F YL AE   +V K +NI+ +D+ E K P  L MQV D + L SD  +G ++  L  FP+ AK  K C      ++    ++F+ K+ +GWWP + +            E+ G VE E  LV  EEAE NP G  R+EP PLEKPNRPD +F  F+NP+    + I    K  +I  L++LI  L + L  Y  PG  S  IV
Sbjct: 1147 LKIYDKELE--AEFGPFDDWVKTFELYRGKANEEESSS--AERFVGNFKGRFCLYKL------------PDSEEYDCVDSGDYKINQG----------------IPPNTAVNVLIRVYIVSASNLHPADPDGKADPYIVLKLGKTVIKDRDNYIPKQLNPVFGRSFEIQASFPKESLLKILIYDYDVIGGDDLIGETQIDLENRFYSRHRAMCGIPSEYAIDGYNAWRDCIKPTDLLIKLCKDNRLDSPRFTP--GRITIGEKVYTGKTVFADED-QMVESYEHLALKVLHRWEEMPGVGCKLVPEHIETRALYIKDKPGLDQGQVQMWVDIFPMDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFHYLPAEKLVVVSKRENIFSLDKTEQKLPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKTAKDCKMEMLKESNDNISIFQQKRSKGWWPFIKSE-----------ELTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTTFSWFVNPFKCFFHLIWKNYKKYIIIALLLLILALFLALLFYTLPGALSNKIV 1721          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 404.445 bits (1038), Expect = 4.928e-114
Identity = 261/697 (37.45%), Postives = 379/697 (54.38%), Query Frame = 1
Query: 4153 KELFLKEVQEHLILEDEKLS-DNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFN------SDSMIEDDDGSQ---IKSLEPLALVVLHNWEDI----VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNK-NIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSD-ACAKFNLFKNKKVRGWWPLV----------------------------------YNPKXXXXXXXNG--LEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIV 6087
            KE+  KE  + +++E E  +     I  +K+Y  ELEN  ++  F     +F +Y+GK   ED+  +  DR  G +KG+  IY +  +   E++  D                                   +     +  + RVYVVK  NL PAD NGKADPY++V+IG +++  +E YIPK L+P+FG  FE+ V+FP E+ L + ++D D +  DD+IGET IDLENR+ S HR  CGL   Y+  GY KW+DS+ P+AIL  LC KN IP P+Y   +  V+++ K F        + +++ +  ++    +  E  AL VL  W ++    V  C LV EH+E R L   EKPG+ QG L MW+DMFP     PPP++I PR P SYELR++I  T++V L D N FT E S DIY+K W+K  D + Q+TD HF SL+G+G FNWRFVF FDYL  E  IVYK K +I+ ++E+E++    L +QV D D + S+  +G ++ RL+   + AK  + C      D A  +F++F++K+++GWWPL+                                    P+D    +  G    + G VE E  LV  EEAE NP G  R+EP PL+KPNRP  SF  F+NP  T  +FI  + K  +I ++I+ I  L + L +Y  P + S++IV
Sbjct: 1228 KEVKYKEEDDAVVVEIEPPAPKRKKISTLKLYKSELEN--EFSQFMDWLHTFPIYKGKANLEDEDDDDSDRIMGKYKGSFLIYPISSEEQEEEEDIDFQITRG-----------------------------IPKNSPIKVLTRVYVVKATNLAPADPNGKADPYVVVKIGQQQLDSKERYIPKQLHPVFGEVFELTVSFPLETELNIIIFDHDLVGSDDMIGETRIDLENRFYSRHRAGCGLALYYDKDGYNKWRDSRKPSAILADLCRKNGIPSPEY--RDTEVKVLNKIFKIPNEAFPEELLKKNKKTEEDYAEMDEHRALSVLQRWAEMREFTVGACPLVPEHVEVRSLLNPEKPGLPQGYLHMWIDMFPVDVPPPPPVNIKPRLPVSYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLDDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEIVYKKKESIFSLEESEFRQHAVLVLQVWDYDRIGSNDFLGSIELRLNDMVRAAKSSELCSVKMAKDKASPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREREMEKKNKKKKKKKQSKRGKMKPEDLQFVDSTGNTFLLMGKVEAEFQLVTAEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYKKYIIVLVILAILALFLFLILYTLPTHISQLIV 1891          

HSP 2 Score: 392.119 bits (1006), Expect = 4.260e-110
Identity = 304/1059 (28.71%), Postives = 483/1059 (45.61%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSD-DIDVK-----------------------DGDNYSELSL-------LPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKK--SHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDK---PKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGR--LLIAIKTTSQPD----------SIK-------------------------------------------IGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPD----------------------EYSHLPKKEENFESQYVHSLTEPKYAY--TFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFH--------KDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTV 2862
            MS+ V L+++  +    +  +++ FRD   +T   + +        F WP   K+ K + L I     +R   ++L G + + L  ++    + L E   D    +TDI +  ++ Y+            DF       TK+E  +    +  +T  +E     G+  P   D D +                       D  ++S+L +       +  R   L KH    + K+K FQ++V + EA+ L G NINP   +  G +K+ T  +  TN PFYNE F F+F+ ++  L +++I I  + KK  + ++TR       IG F ID  TVY    H F+ KWA + DPK   SG KG+VK  LSV+  GD       P  T + ED  IE N+L+P+ +   +R   +  + +Y+AEDLP MN   + +  + ++GD K   DPYV+V+FAG  G T V+S + +P+WN+QI F E+FPP   R+++ + D   + D  ++T F+DL +I   +N    GF PT+GPSW+NLYG+P+  +  ++    Q  N+ L++G+ +RGR  L ++++  S P           SIK                                           + V+V   +P+  N  G++E +LLFAS FE T+I   IG K   +TFELSIG  G   D                      E     ++EE        S+T P+ A    +D  +  I    +KPC+Y+    EDH  R    N L K+   L   + +V  L  R +     R ++  +E  F+S  K  S+    +  A+   LD      I+  +  +          ++  T+   + D+   +K +     +PQ  LPDVFL+M+    RVAY RI A  ++ S +  E+G+ CG V+T+Y+K       P      I A+L++Y+WLG+ K  +     LP  F                MPP  +   +   FQLR ++Y  R +I +DD+GLSDPF KV+     + + V
Sbjct:    1 MSITVYLKTIYNLPGKYDRKVELSFRDFTHKTKILQCENVAIFKENFRWPHYGKIQKDEVLTISVYNSSRMFSNRLLGKLVVSLQHVVTAGRLVLREPLTDSNYSLTDIYVELDVRYHPLQGAAGEWSGEDF-------TKVEDRDESGLVIKNTGFLEP----GNLRPQQLDRDARMLGRSLMKIDNEDGEDDDDDDYDDDYDFSDLEISSMTFTPILSRCRALSKHELAAAPKVKSFQVNVNVIEAQNLVGVNINPAVYITVGHEKKRTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHKKTLAFLMTR-------IGTFKIDISTVYQQPDHRFYQKWAPITDPKDTRSGVKGYVKCTLSVMMKGDSMNMASLPPATSQNED--IERNLLLPKRMA-AERPWAKFLLKIYRAEDLPSMNAGFLGSFSK-MMGDKKVFIDPYVQVTFAGQQGETSVVSNTNAPEWNEQISFIEQFPPLARRIKVQILDDSNMGDVAVATHFLDLQQI---SNPNRNGFNPTFGPSWVNLYGSPQNSTLRDI---HQDLNEGLSDGIFYRGRVQLSLSVEIYSSPTTAVIENKSSLSIKSPLSKLTFKRKSRKSREKSKESAGAQAASGPAEESEASEVPEAVTVEVEEIHPLPENFVGEKEEFLLFASFFEVTMIDPSIGSKF--VTFELSIGNYGKTADVVVKSKKSGSREDLSEDRQGLLESDDELEREEPAAGPLDKSVTAPRRAQPTEYDGSFSCISLLREKPCIYVWNYFEDHTFRYHNCNWLSKMADRLEYGIDEVEMLLKRPRSNAKERLMEVLLE--FVSTCKQYSSSLDRKRQARPNPLDKHRSTFIKRNIIILAKQALRVRRRVTRRTVRDKLADVRRILKRIHFLTKEPQSTLPDVFLWMMSGGKRVAYARIPAHTVLFSLVEEERGKDCGKVSTIYMK------TPGGPLGEIFAKLEVYMWLGVTKYSKNCVTSLPAEFRPVYEGATFGTPLPPNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFTKVVFSTQCQVTQV 1021          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 373.629 bits (958), Expect = 3.079e-104
Identity = 226/602 (37.54%), Postives = 321/602 (53.32%), Query Frame = 1
Query: 4228 ERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQI--KSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAED-SIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC-----DPFQHSDACAKFN----LFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEP---LPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            + +K++  ELEN+ +Y G      +F LYRGK E+++D   +     G FKG+  +Y           L D+    S    F E                      L D    + +VR+YVV+GI+L P D NG  DPYI + +G K + DR+NYIP TLNP+FGR FE+    PQ+  L + VYD+D LT D+ +GET IDLENR LS     CGL  TY   G  +W+D   P+ IL+++     + PP+ +   +T+   G+ +       + +  Q    + E ++L VL           L+ EH+ETR LY   +P + QG L+MWVD+FP    +P PP DISPRK   Y LR+++  T NV L +T+  T E+  DIY+K WM   + D QKTD H+RSL G G FNWRF+++FDYL AE   +V K ++ + +D+ E+K P  L +Q+ D+D    D  +G ++  L     PAK  + C     +  + S +  KF+    LF  K VRGWWP       +        E+GG VEM +++V  +EAE  PAG GREEP     L  PNRP+ SF  F NP  T+K+ +  R
Sbjct: 1364 DTLKVFENELENVTEYKGLTDFCNTFKLYRGKTEDDEDDPTV----VGEFKGSFKVY----------PLSDDPAIPSPPRQFRE----------------------LPDSGPQECVVRIYVVRGIDLQPKDNNGLCDPYIKISLGKKIVDDRDNYIPNTLNPVFGRMFEVSCFLPQDKDLKISVYDFDLLTHDEKVGETVIDLENRLLSRFGSYCGLPQTYCTSGLNQWRDQLKPSQILQNVARLKGVSPPRSEDNGNTLAFNGQEYRLSDFEANKELHQHLGPATERISLHVLRT-------QGLIPEHVETRTLYSTFQPTLSQGCLQMWVDVFPKSLGLPGPPFDISPRKAKKYVLRVIVWNTTNVILDETS-ITGERMSDIYVKGWMPGKEEDKQKTDVHYRSLDGDGNFNWRFIYEFDYLPAEQLCLVSKKEHFWSLDKTEFKIPPQLIIQIWDNDKFSLDDYLGTVELDLHHLISPAKMPEKCNLKMLEQAKASKSPLKFDSSKSLFAQKSVRGWWPCYIEKDGKK-------ELGGKVEMTLEIVHEKEAEERPAGKGREEPNMNPKLNPPNRPETSFFWFTNPCKTMKFIVWRR 1914          

HSP 2 Score: 229.565 bits (584), Expect = 8.309e-60
Identity = 190/674 (28.19%), Postives = 315/674 (46.74%), Query Frame = 1
Query:  676 FQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHI-----VTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPN-IEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAI--LGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSD-MIKDETISTVFIDLHKIMNSANKEEE-------GFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGK---RELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEK-GQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGL 2637
            F+I V + E R L G NI P+ +V    +   T +K + N PF+NE  SF        LM  I     +  K  I      T  IFP        ID   +Y   +H    KW +L DP   + G KG++KV   ++  GD P    KTD++ D + +E+N+L+P  +     +   + + V++AED+P M+  I  ++K A    GD K L DP++E  FAG    TK+I  + +P+WNQ +    +FP    R+++ V D D + +++ + T +++L KI +S  + E        GFLP +GPS+INLYG+PR ++   +    +  N    EG A+RGR+LI + T       K   DV + +     VA K   R  Y L A    AT+I +      +P+ FE+SIG  G            + +   + + S T+   A    N Y+++P+   KP + +++  ED   RL   NI+  +   L   + ++         VQA     +  E +   + +VL  I  C         ++    ++     K+ +  S  I C++  T+ M                  PQ+ +PDV ++M++   RVAY+R+ A  +++S +  +  GQ CG   T+ L+      + +     + AQ+++ +WLGL
Sbjct:  138 FKIRVRVIEGRQLPGNNIKPVVKVNVCGETHRTRIK-RGNNPFFNEVISFYTIFLIPGLMYLIRNYAVIVNKVKIYIFICFTSFIFP-------QIDIGYIYDEPAHCVMRKWLLLNDPDDSSCGAKGYLKVSAFIVGTGDDPPV-EKTDRDTDSDDVESNLLLPAGIALRWVT---LQLKVFRAEDIPQMDDSISQSLKAAFGGTGDKKNLVDPFLEAWFAGKKICTKIIESNANPEWNQLVNLHVKFPSMCERIKLTVYDWDRLTRNDAVGTTYLNLTKIASSGGEVEAETGEPDVGFLPAFGPSYINLYGSPREFT--GLPDPYEDLNFGKGEGAAYRGRVLIELSTKLDG---KADTDVEAISNDDILVAQKYQRRRKYCLCAVFHSATMILE----PGEPIQFEVSIGNYG-----------NKLDSTCKPLASTTQYSCAVFDGNHYYYLPWADTKPVVAIMSFWEDISHRLDAVNIILNIANRLECNITELK------TAVQAKAPDLRLAEIWQKLVSQVLEDISRCFYFPTIHHTNLFLLNILNETALKLFLYVSYCIFCIT-WTLHM---------------FPQPQNSMPDVIIWMLRGEKRVAYSRVPAHQVLYSVLGEQACGQYCGKTQTIVLQYP----MDKNKGSKLPAQVRVNMWLGL 753          

HSP 3 Score: 149.058 bits (375), Expect = 3.286e-35
Identity = 90/298 (30.20%), Postives = 148/298 (49.66%), Query Frame = 1
Query: 2743 DFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            ++ LRVY+Y  RNL+  D    SDP+V V      + + +   + +P+WD+T+I + +    +P+ +   PP VVLEIFD D    +E +GR  C P V +     T  KL W  V     PAG++LVS +LI +   +    +P  P                  ++ +E   +P  VRP + L  +E+L WG+R ++  ++                 PV+ P +++E GG R++S +I++    PNF+ N++ + + LP    + PP+ +  I++  FG K VVG   I  L EY
Sbjct: 1042 EYHLRVYVYQARNLMALDKDSFSDPYVHVSFLHMSQTTEIIKASLNPMWDQTLIFNRVEIYGDPQTIARDPPQVVLEIFDSDQVGKDELLGRSTCPPLVKLDPGMDTPPKLLWRPVIHKGTPAGEVLVSAELI-LRNKTGETDLPLVPP-----------------KRGDELYMVPQGVRPVVQLTAIEILAWGLRNMKMYQLA----------------PVSSPSLVVECGGERVQSAVIKNIKKSPNFSGNVLQLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTINSLEEY 1305          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008905.1 (pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 gene:ENSPMAG00000008043.1 transcript:ENSPMAT00000008905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 595.119 bits (1533), Expect = 3.724e-180
Identity = 352/1042 (33.78%), Postives = 559/1042 (53.65%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-----TSQPDSIKIGVDVRSCNPVSN-NVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHL--------------------------PKKEENFESQYVHSLTEPKYA-YTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKD-LNSFVKFLDDKMLDPQHGLPDVFLYMIQDNI-RVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGF-HKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            +DP + K + +Q+SV I EAR L G N++P+  V  G++K+ T  K  TN P+YNEYF FDF      + ++II++  +  K+ I +     G ++G F +D  TVYS   H F++KWAVL DP   T+G KG+V  D++V+  GD  K P+K+   +  +IE N+L+P+ +    R      V +Y+AE LP MNT I++N+K+A++G  + L DPYV+VSFAG  G T V   SY P WN+Q++FTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT+GP+W+N+YG+ R Y+   ++   Q  N  L EGV+FR RLL+ I       TS   S    + V S   V++ + +GK E + LF +  EAT+I ++I  K   ++FE+SIG  G   D  +                               +   +     S T P Y   T D QYFH+PY  +KPC+Y+ +   D R RL+  NI+DK+  +L E +  V     + ++    R ++ ++E   +   + L+          +T LD    K+    LE+M     +      + T   + +   +S ++     M  PQ  +PD+F++M+ +   RVAY RI A+D+++S +  E G+ CG V T++L+      LP K       + +QA+L+ YLWLGL K  + +  GLP GF  K    + +PP +++Y + S F+LR ++Y  R+L  +D +GLSDPF +VI   H + + VF ET  P WD+ +   ++     P+ ++  PP VV+E+FD D+    EFIGR   +P V I  + Y   +    L ++ +YRG + AG++L SF+L+++ P     + P            + +ND  +G      + +P  +RP +  +R+E+L WG+R L+R+++ S                V++PR+ IE  G  I+S +I D+  +PNF+  +    + LP N  F PP++I  ++   FG   +VG+  +T L ++
Sbjct:    8 VDPTAGKPQSYQVSVMIIEARQLVGLNMDPVVIVEVGEEKKQTSQKESTNCPYYNEYFVFDFHTPPNMMFDKIIKLSVIHSKNLIRS-----GTLVGTFKLDVGTVYSQPDHRFYHKWAVLTDPDDITAGIKGYVNCDIAVVGKGDNIKTPHKSVDNDADSIEGNLLLPEGI-PADRQWARFFVRIYKAEGLPKMNTAIVANVKKALMGQERDLVDPYVQVSFAGQKGKTSVQRSSYEPVWNEQVVFTELFPPLCRRMKLQIRDSDKVNDTAIGTHFIDLKKICNDGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQELNDGLGEGVSFRARLLLGISMEILDITSPELSTNTEISVESIPHVADESCSGKMEEFFLFGAFLEATMIDRKISDKL--ISFEISIGNYGNSLDGLNKSNILDRSDDEDEYDEGDEDDETELLNDETDDAEMDDDTSGSSTTPSYKPETNDRQYFHMPYYEQKPCVYVRSAWHDQRRRLYNSNIIDKIADKLEEGISDV-LETMKMERPHPERRLRGALEEMSVGCSRFLTLANKDPSAFGRTRLDRDRLKICMRELEQMGPQAKLGRARTRIHTAPHSTRHTTSSTLRSTAALMAAPQDSIPDIFIWMLVNKTKRVAYARIPAKDILYSIVEEETGKDCGKVKTLFLR------LPGKRVFGSGGWTMQAKLEAYLWLGLNKQRKDFLTGLPSGFEEKKIGVTGVPPSVLNYHKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLQFQDVYMYGEPRELRDDPPMVVIEVFDQDTVGKAEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPVTAGELLASFELLQVPPADNCKFPP-----------VSGLNDTDRG----PIIPVPKGIRPVLAKYRIEVLFWGLRDLKRVQLQS----------------VDRPRVDIECAGKGIQSVVIADFNKNPNFSHLVKFFEVDLPENELFHPPLNIRVVDCRAFGRYILVGSQTVTSLRKF 997          

HSP 2 Score: 515.383 bits (1326), Expect = 4.503e-152
Identity = 291/633 (45.97%), Postives = 399/633 (63.03%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQ-EDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVP-ECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVDKITGG 6105
            +E +K+Y  ELE   ++  F+    +F+LYRGK  +EDD  + ++R  G FKG+ C+Y     DN+ ++  +D        A FG                 +      +DP  ++ +VRVY+V+  +LHPADINGKADPYI++++G  E++D ENYI K LNPIFG+ F++E TFP ES L VQV DWD +  DDLIGET IDLE+R+ S HR TCG+   Y  HGY  W+D   PT IL  LC+ N +  P Y      V++  + FN  + +EDD G + ++ E LAL VLH+WE+I    CKLV EH+ETRPL   +K GIEQG LEMWVDMFP     P PP+DISPRKP SYELRI+I  T+ V L D  F T EK  DIY++ W+K    D Q TD H+ SL+G+G FNWRF++ FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C  +  +   +    ++FK K+V+GWWP V   +++++      E+ G VE E+ L+  EEAE NPAGLGR EP PLEKPNRPD SF+ FLNP  +IKY I +R KWI+IK+++ L+ ++++ LFIYN PG     +V K+ G 
Sbjct: 1178 VEELKVYDKELE--AEFDNFEDWLHTFNLYRGKTSDEDDILD-EERVVGRFKGSTCVYKWPLADNVLKEVGYD--------AQFG-----------------MFQGIPTNDP--INVLVRVYIVRATDLHPADINGKADPYIVIKLGKTEVKDNENYISKQLNPIFGKSFDIEATFPMESMLTVQVMDWDLVGMDDLIGETKIDLESRYYSRHRATCGIAQQYAVHGYNTWRDPMKPTQILAKLCKDNKVDGPHYGP-GGRVKVANRIFNGPTEMEDDSGHKKQTEEHLALKVLHSWEEIARVGCKLVPEHVETRPLLHPDKTGIEQGRLEMWVDMFPKDMPHPGPPVDISPRKPKSYELRIIIWNTDEVILEDDAFMTGEKMSDIYVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLVAEEKIVISKKESLFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKSSKQCTLNMLKMDGSVPMISIFKLKRVKGWWPFVSRDENDEQ------ELTGKVEAELHLLTAEEAEKNPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIKYVICHRYKWIIIKLVVALLMLVLLGLFIYNMPG----YMVKKLLGA 1769          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004363.1 (pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 gene:ENSPMAG00000003981.1 transcript:ENSPMAT00000004363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 521.161 bits (1341), Expect = 1.185e-159
Identity = 313/922 (33.95%), Postives = 504/922 (54.66%), Query Frame = 1
Query:  511 SDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT-----TSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGIC--------PDEYSH------------------LPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKL-IRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNI-RVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYN-----IQAQLQIYLWLGLLKDMRLYKMGLPEGF-HKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEI 3147
            SD S   S S  GDN   D I +  G    E S +  +  K  + +DP + K + +Q+SV I  A+ L G NI+P+  +  G  K+ T ++  TN P YNEYF FDF  +   + + +I++  +  K  I +     G  IG F +D  TVYS   H F++KWA LIDP   T+  +G+V+ D++V+  GD  K+ +K+ + +D ++E N+++P   C+ +R      V +Y+A  LP MNT I++N+K+A++G  K L DPYV+VSFAG  G T V + SY P WN+Q++ T+ FPP   R+++ +RDSD + D  I + FIDL KI N+ +K   GF+PT+GP+W+N+YG+ R Y+   ++   Q  N  L EGV+FR RLL+ + T     TS   +    V V     ++++V GK E + LF +  EAT+I + I +K   ++FE+SIG  G          P E S                     K +   E   + S T P    T D QYFH+PY  +KPC+Y+ +   D R RL+  NI+DK+  +L E +  V   A +  K    R ++ ++E      ++  S       +   T LD K  K+ ++  +  ++ S+   +  L +  I+  ++ + + +  L   + DPQH +PDVF++M+ +   R+A+ RI A+D++++    E G+ CG V T++LK      LP K ++      +QA+L++YLWLG  K    +  G+P GF  K      +PP+++ Y + S F+LR ++Y  R+L  +D +GLSDPF +VI   H + + VF ET  P WD+ +   ++     P+ ++  PP VV+E++D ++    EFIGR   +P V I  + Y   +    L ++ +YRG + AG++L SF+L+++
Sbjct:  216 SDGSGGMSVSGKGDN--LDTISIASGK--VETSDVSNKRSKPEQRVDPTAGKPQSYQVSVMIIRAQKLVGLNIDPMVILEVGDAKKKTRIEKSTNCPNYNEYFVFDFNTAPNTMFDTMIKLTVVHNKDAIRS-----GTPIGTFKLDVGTVYSQPDHRFYHKWATLIDPDDITADVRGYVQCDITVVGKGDNIKKSHKSIESDDDSLEGNLILPD-GCKGERQWARFYVNIYKAVGLPKMNTAIVANVKKALMGQEKDLVDPYVQVSFAGQKGKTSVQNNSYEPVWNEQVVLTDIFPPLCRRMKLQIRDSDKVNDVAIGSHFIDLTKICNNGDK---GFMPTFGPAWVNMYGSTRNYT---LVDEHQELNDGLGEGVSFRARLLLQLTTELLDKTSPELNNTTEVMVEDIPRINDSVLGKMEEFFLFGAFMEATMIDRSISEKL--ISFEISIGNYGNSIDGLNKSNPQERSDDEDEDDDEDDEEETVLLTAQKAKGTDELSSMFSTTPPMKPETNDRQYFHMPYYEQKPCVYVESTWHDQRRRLYNSNIIDKIADKLDEGISDVKE-AMKTDKPHPERRLRGALEEMSSGCERFCSLANKDSSSIDCTDLDRKRLKMRLKELIYNIQHSFKTMLCMLFIQIINDMMRVMRNLLSALIACIKDPQHSIPDVFIWMLVNKTKRIAFARIPAKDILYANADEELGKDCGKVKTLFLK------LPGKRSFGPGGWAMQAKLEVYLWLGTNKQRNNFLNGMPTGFVEKKSIDPTVPPRVLTYSKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLEYQDVYMYGEPRELRDDPPMVVIEVYDQNTMGKSEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPLTAGELLASFELLQV 1112          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001654.1 (pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 gene:ENSPMAG00000001492.1 transcript:ENSPMAT00000001654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 506.523 bits (1303), Expect = 1.142e-155
Identity = 275/614 (44.79%), Postives = 389/614 (63.36%), Query Frame = 1
Query: 4237 KIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPG 6066
            K++  ELE   ++  F+    +FSLYRGK E++D   E +DR  G FKG++C+Y         ++L  E   + +   F                         +DP  +  +VRVYVV+  +LHPAD+NGKADPYI+V++G  E++D+ENYI K LNP+FG+ F++E  FP +S L V +YDWD +  DDLIGET IDLENR  S HR TCG+   Y+ HGY  W+D   P+ IL  LC++  + PP+Y      V++  +TF + + +ED++G +  + E +AL VLH+WE+I   CKL+ EHIETRPL   EKPGIEQG +EMWVDMFP+    P PPIDI+PRKP S E+R++I  T++V L D +  T EKS DI++++W+K    D Q TD H+ S++G+G FNWRFVF FDYL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C  D  +   +    ++FK K+++GWWP           E + LE+ G VE E+ L+  EEAE +PAGLGR EP PLEKPNRPD SF+ FL P  +IKY I +R KW+++KI++ L+ + ++ LF+YN PG
Sbjct:  407 KMFDKELEG--EFDNFEDWLHTFSLYRGKIEDDDSSME-EDRLVGRFKGSLCVYKYP----LPEELAREVGYDPQFGMFQGIPS--------------------NDP--IGVLVRVYVVRANDLHPADVNGKADPYIVVKLGKHEVKDKENYISKQLNPVFGKSFDIEAVFPMDSMLTVSIYDWDLVGTDDLIGETKIDLENRLYSKHRATCGISQRYSIHGYNMWRDPLKPSQILARLCKEVKVDPPQYSP-EGRVKVANRTFTAATEVEDENGQKKPTDEHMALTVLHHWEEIPGACKLIPEHIETRPLLHPEKPGIEQGRIEMWVDMFPADVPRPGPPIDIAPRKPKSLEMRVIIWNTDDVILEDDSLLTGEKSSDIFVRSWLKGQQEDKQDTDVHYNSVTGEGNFNWRFVFPFDYLVAEEKIVMSKKESVFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTSKLCSLDMLKTDGSVPMISIFKQKRIKGWWPFAAR------NENDELELTGKVEAEIHLLTSEEAEKSPAGLGRNEPDPLEKPNRPDTSFMWFLTPLRSIKYLICHRYKWLIVKIVLALLLLAMLALFLYNMPG 984          

HSP 2 Score: 176.022 bits (445), Expect = 1.294e-44
Identity = 117/438 (26.71%), Postives = 205/438 (46.80%), Query Frame = 1
Query: 2668 LPEGFHK------DCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVP--GFPSLENLMEMTAQVN-DNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAG-VKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLD 3930
            LP G+ +            +PP  + Y E+  FQLRV++Y  R+L  +D +GLSDPF ++I   H + + V  ET  P WD+ ++ D+I      + ++  PP +V+E+FD D+    +FIGR   +P V +  ++Y + +    L ++ +YRG   AG++L +F+L+++       + P    P    L+  + + +     G  D E    L +P  +RP +  +R+E+L WG+R L+RI++++                V++PR+ +E  G  ++S +I  +  +PNF+       + LP N    PP++I  ++   FG   +VG H +T L                         +F ++A S   +       D   P    +G V     P VT   P      I   P EE+   DWW++Y+ ++  L+
Sbjct:    1 LPNGYEQKKAKNSSPIAQALPPISLIYKEKQMFQLRVHMYQARSLFAADSTGLSDPFGRIIFSTHSQATEVIPETLCPTWDQMLVFDSIELYGEAQELRDDPPIIVIEVFDQDTVGKADFIGRALAKPVVKMSNEKYDAPRFPPQLDYYQIYRGNSTAGELLAAFELLQVATSPTHHHAPRTTAPRPATLIPPSGKGDLPPISGPTDTEHGTILPVPRGIRPILSKYRIEVLFWGLRDLKRIQLVT----------------VDRPRVDVECSGKSVQSVVIPSYKQNPNFSTLFKHFEVDLPDNELLHPPLNIRVVDCRAFGRYTLVGTHTVTSL------------------------RKFILRAPSKTKAANIRTIGDPNDPRLPASGSVCQSVCPQVTAHQP------IIHQPDEEL--LDWWSKYFVSIETLN 390          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001770.1 (pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 gene:ENSPMAG00000001575.1 transcript:ENSPMAT00000001770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.626 bits (688), Expect = 8.631e-74
Identity = 227/763 (29.75%), Postives = 367/763 (48.10%), Query Frame = 1
Query:  655 LSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILG---DGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSD-MIKDETISTVFIDLHKIMNSANKEEE---------------------GFLPTYGPSWINLYGTPRTYS-----YAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVD-VRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG-----ICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDN-QYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVL----SAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEK-GQMCGMVNTVYLKKMNFSILPQKTN-YNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSD 2814
            +S K +DFQ+ + + EAR L G NI P+ +V    Q + T ++ + N PF++E F F+F +S  EL +++I  K L   S      +     IG F +D  TVY    H+F  KW +L DP+  +SG KG++KV L VL AGD+P        EE  +IE N+L P            +++  Y+AED+P M+  ++  +KQ I G   + K L DPY+EVSFAG T  TK+I ++ +P+WNQ I    RFP    RLRI + D D +  ++ + T F+ + +I      E E                     GFLPT+GP +INLYG+PR ++     Y E+       N    EGVA+RGR+L+ + TT   D I   V+ + S + +      +R  Y L A+ + AT++ +E+    +P+ FE+SIG  G      CP   S          +QY  ++        FD    +++P+ + KP + + +  ED   RL   NIL   ++ L     +VN    R   +QA   ++    ++  +ID ++     A+         T LD +  +     L  +  S     E      ++  + +L+ +++ L +   +PQ+ +PDV ++M++ + RVA+ RI A +++HS++ P   G+ CG+  T+ LK       PQ T+ + I  Q+++ +WL L  D +              F      K+  + E  + Q R+ L  G    G      SD
Sbjct:  204 VSRKPRDFQVRIRVIEARQLPGNNIKPVVKVTVAGQSKRTRIR-KGNNPFFDETFFFNFHLSSAELFDELIYFKVLHSHS------LRADSEIGTFKLDVGTVYDEPRHTFQRKWLLLCDPEDLSSGAKGYLKVTLLVLGAGDEPPEDRSEAVEEREDIENNLLRP---AGVSLRGAFLTLRAYRAEDVPQMDDAVLDTVKQ-IFGFDSNKKNLVDPYLEVSFAGKTLCTKIIEKNANPEWNQAISLPIRFPSMCERLRITLYDWDRLTHNDAVGTAFLSMSQISCPGGDEPEAFITMRCLRLNLLRLIEDEGTGFLPTFGPCFINLYGSPREFTGFPDPYEEL-------NFGKGEGVAYRGRILVEL-TTKLEDHINNKVEPIPSDDLLRVEKYLRRRRYNLCATFYSATML-REVN---EPIQFEVSIGNYGNKYDVTCPPLAS---------TTQYSRAV--------FDGCSSYYLPWGNIKPVVTLTSYWEDVGHRLEALNILMHTQRRL-----EVNIGRVRA-TLQAREPVEAVAVSWLHAIDTLIEDCSQALPEITERPNVTPLDREVWRARSATLALILRSAQRLRE--EATRVEETLSELDDWLERLTELTREPQNSIPDVVVWMLRGDRRVAFARIPAHEVMHSSLGPHACGKNCGITQTIVLK------YPQDTHGFKIPGQVRVRIWLSLAADSK-------------SFNETSEGKLAVFAETYENQTRLALVGGWGTTGLTRHKFSD 899          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002265.1 (pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gene:ENSPMAG00000002063.1 transcript:ENSPMAT00000002265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 5.737e-62
Identity = 139/376 (36.97%), Postives = 202/376 (53.72%), Query Frame = 1
Query: 4900 GYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTF-NSDSMIEDDDGSQIKSL-EPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQ-GLLEMWVDMFPSGTAIP-PPIDISPRKPAS-YELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAED-SIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAK-----FNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEP---LPLEKPNRPDGSFLNFLNPWNTIKYFIKYR 5985
            G  +W+D   P+ IL+ +    + P P Y+   D + + G+ +  SD   +      +  + E LAL +L +         L+ EH+ETR L    +PG+EQ G L MWVD+FP     P PP DI+PRK    Y+LR +I  T++V L +T+  T EK  DIY+K W+   D   QKTD H+RSL G+G FNWR++F F+Y+ AE+  +V + ++ + +D+ E + P    +Q+ D+D    D  +G L   LS  P PAK  + C          K      +LF+ K V+GWWP +     +         I G VEM ++++  +EAE  PAGLGREEP     L+ PNRP+ SFL F +P  T KY I  R
Sbjct:    2 GQNQWRDQMTPSMILEGVARAKSWPQPIYE--GDRLTLKGRDYLMSDFEAKAPTNPHLGPVKERLALHLLRS-------MGLIPEHVETRTLEHSIQPGLEQQGKLMMWVDVFPKNMGPPGPPFDITPRKAKKRYQLRCIIWNTKDVILDETSI-TGEKMSDIYVKGWIDGRDDAKQKTDVHYRSLGGEGNFNWRYIFPFEYVPAENICVVSRKEHFWSLDKTELRLPPKFTIQIWDNDKFSPDDYLGYLDLNLSHMPVPAKSAEKCSLEMVETPTGKKKHKTTSLFEQKNVKGWWPCIAEEDGKKI-------IAGKVEMTLEILADKEAEERPAGLGREEPNMNPKLDPPNRPETSFLWFTSPLKTFKYIIWRR 360          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO47415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ1])

HSP 1 Score: 568.926 bits (1465), Expect = 3.949e-169
Identity = 369/1152 (32.03%), Postives = 588/1152 (51.04%), Query Frame = 1
Query:  682 ISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPK----APTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIG---VDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGIC-----PDEYSHLPKKEENFESQ------------------YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNIL----DKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAK--KTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKD----LNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKM---PPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTS----SKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYY-VEDKINEDLDHESDHL---QSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKL---------------IRFVPKEEMESADWWTRYYATLGD 3924
            I + I+EAR L+G  I+P+  V  G QK+ T +K QTN PFY+E+F FDF++  + L ++I+  +  + ++ +       G +IG F +D  TVY+   H F  +WAVL DP+    A  +G KG+ +VD++VL  GD P +     K+ D +IE N+L+P  +   +R    + + +Y+AE LP MN+ +M+N+K+A  G+ + L +PYVEV FAG+   T V   +Y P WN+Q++F+E FPP   R++I ++DSD + DE I T FIDL +I N       GF+PT+GP W NLYG+ R YS   +       N  L EGVAFRGRLLIA+       + + G   V+V    P+S+  AGK E + LFA  +EA++I +++G K   ++FE+SIG  G        DE SH    +    +Q                  +++SLT P    T D QY+HIP+   KPC ++    +DHR RL+  N+L    ++L+  L + + +V             R++ + +       ++ L+ IKS    +   +T LD +  KL +  +E +  S     E  +    D  +KD     N+ ++ L +  ++PQ  +PDVF++M+    RVAY+RI ++ +++S +  E+G+  G + TV+L+      LP K       + IQA+L I +WLGL K  + Y    P+G+       K+   PP  + Y E+  F LR ++Y  R+LIGSD SGLSD F +VI    +  + V  ETRSP WD+T+I   +V   +   +   PP +V+EIFD D   D EFIGR   RP V +  + Y        L+W+ V RG   AG++L +F+L+++   S   ++P              VN       D     +P  +RP +   R+E+L WGVR+++RI + +                V++P++ I++ G+ I+S +I +   +PNF + +    + LP N ++ PP++I   +   FG   +VG HV+  L  Y    +K  E ++         + L A    +  S G    A +  D    E  +  +++    D   P+      +                +    ++ +S DWW+RYY TL D
Sbjct:  262 IQIRIHEARQLAGTQIDPVCTVSVGNQKKSTTIKEQTNCPFYDEFFVFDFKMPPMVLFDKIVMFQFYTGRNLVSQ-----GALIGSFKLDVGTVYAQPDHRFCRRWAVLTDPEETLGASGAGVKGYARVDITVLGKGD-PAKEQPGIKDNDDDIEGNLLLPDGV-PAERPKARVIIKIYRAEGLPKMNSGLMANVKKAFTGEVRDLVNPYVEVQFAGHRARTTVKKNTYEPKWNEQVVFSELFPPLCRRIKIQLKDSDSVTDEVIGTHFIDLSRISNDG---ANGFMPTFGPCWANLYGSTRDYS---LFDEHNDLNNGLGEGVAFRGRLLIAVHAEFGESASESGIRQVEVEPTAPISDTAAGKDEQFQLFACFYEASMIDRKVGDKM--VSFEMSIGNWGNSIDGQPIDEVSHATHIQHTSNTQHTQSTMGGDEDRRDGDNPFLYSLTPPVKPVTNDRQYYHIPWEDSKPCTHIKFMWQDHRRRLYNSNVLLKICERLEDGLTDCIERVKM-----DLPNTFRWLSRVLSELINGCNQYLNLIKSMPTASHVGRTKLDKERLKLCQYEVESVCTS---AQELKTSTKDDTHMKDNLKAANALLQRLLNIAVEPQDTIPDVFIWMLCGGKRVAYSRIPSQHIMYSLVEEERGKDSGRMQTVFLR------LPGKRGDGPKGWAIQAKLNIMIWLGLHKHKKDYLKDAPKGYQTPKNAHKLMAPPPNHLIYTEKQKFVLRAHVYQARSLIGSDASGLSDAFARVIFTHLVSDTRVIWETRSPTWDQTLIFQEVVLWGDVNEIAVNPPTIVVEIFDKDIGGDSEFIGRALARPIVKMACEPYEKPFFPPALEWFQVCRGEENAGEMLAAFELLQVT--SGTCFLP---------SEVEPVN-----TPDGPITPVPVGIRPVMKKHRIEVLFWGVREMKRINLTT----------------VDRPQVDIDLAGHVIQSTVITNAKKNPNFQNPVCYFDVELPENERYCPPLTIRVRDCRTFGRFTLVGTHVLNSLHRYLQTGEKEKERIEKAGKSCLDRKRLLANGPSRPTSPGGGEVALEMDDAPPIEMEQMELQARLITDTETPIAVVATDMHASTDHEKKKEKGDKDKKEDDDDEDSLDWWSRYYETLKD 1352          

HSP 2 Score: 440.654 bits (1132), Expect = 7.855e-126
Identity = 249/587 (42.42%), Postives = 340/587 (57.92%), Query Frame = 1
Query: 4234 IKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNK-NIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +KI+  ELE + D+ GF     SF L+RGK+  EDD  +   R  G FKG++ ++                     L    E D                   FL  P +  V+ +VRVYVVK +NLHP+D+NGKADPY++V +G   +RDR+NY+ K LNP FGRCFE E   P +S L V +YDWD +  DDLIGET +DLENR+ S HR TCGL   Y   G+ KW+D   PT IL  LC++  +  P Y      V +  K F +   I ++ G   +S EP AL  L  ++ +     LV EH+ETR L+  EKPG+EQG LEMWVDMFP     P  P+DI+PRKP SYELR++I  TE+V L + N  T EK  DI++K W++    D Q+TD H+RSL+G+G FNWRF+F F Y KAE+ IV   K + +  DE+E K P  L++QV D+D   +D  IG L   L++ P+ AK  KSC  D  +   +  + + FK K ++G+WP   N ++E+      +E+ G VE E++L+  EEAE  PAG  RE+P  LEKPNRPD +++  +NP   +K  I
Sbjct: 1402 MKIFKLELECMHDFNGFNDWLHSFPLFRGKKTSEDD--DDDHRIVGKFKGSLKVWKY------------------PLPEHVEMDPIVGT--------------FLKLPSNEPVNVLVRVYVVKALNLHPSDVNGKADPYLVVNLGKHRVRDRDNYVSKQLNPTFGRCFEFEAIIPMDSMLTVGIYDWDLVGSDDLIGETKVDLENRFYSRHRATCGLQDQYATFGFNKWRDPLRPTQILAKLCKEEGLDGPHYS--TGRVRVDNKVFVAAPQILEESGHWKQSDEPSALRCLKQFQTLKRGFTLVPEHVETRALFNPEKPGVEQGKLEMWVDMFPMDMPSPGAPVDITPRKPTSYELRVIIWNTEDVLLEEANMLTGEKCSDIFIKGWLEGLKDDKQQTDVHYRSLTGEGNFNWRFIFPFQYQKAEERIVITRKASFFSWDESEEKVPARLHLQVWDADAFSADDFIGDLCLDLTRMPRGAKTSKSCTLDLLKQDGSVPQVSFFKMKHMKGFWPFFVNTEEEE------IELAGKVEAELELLTQEEAEKKPAGRAREDPQALEKPNRPDVAWMMMMNPLRGLKAMI 1946          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO43088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG6])

HSP 1 Score: 336.265 bits (861), Expect = 4.207e-93
Identity = 204/593 (34.40%), Postives = 311/593 (52.45%), Query Frame = 1
Query: 4237 KIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKY----DKMNDTVEIMGKTFNSD--SMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAI-PPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNK-NIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKF-NLFKNKKVRGWWPLVYNPKXXXXXXXNGL-EIGGTVEMEMDLVLGEEAESNPAGLGREEP---LPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +  S ELE I+++GG +    SFSLYRGK ++ DD  E   +  G FKG   IY      + E +  D D  E+   +                         L     +D +VRVY++  I+L P D  G ADPY++V++G K++ +++ Y P TLNPIFG+ FE++   P    L + + D+D LT+DD+IGET IDLE R L+ +R  CG+  TY + G  +W+D + P  +L+  CE+       Y    D   D + +  + +  D      + +       + LAL VL+  E        + EH+ETR L    +P IEQG +++WVD+FP    +  P +DI+ R+P +YELR+++  T  V + +T+  T E+  DIY+K W++    D +KTD H+RSL G G FNWR VF F YL  E  +V + K + + +D  E +    LNMQ+ D+D    D  +G  +  L K PKP +  K C   +      ++ +LF+   ++GWW             + G+ E  G +EM ++++   EA   PAG GR+EP     L++PNRP  SFL F +P+ T+KY I
Sbjct: 1279 RTLSPELEKIEEFGGLEDMIASFSLYRGKAKKRDDDDEETQKVVGEFKGTFRIYP-----LPEAEGVDPDLPETVFTN-------------------------LPPNEPIDCVVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDNKDQYKPNTLNPIFGKMFELDAVIPVHKDLKITLMDYDLLTRDDMIGETVIDLEQRLLTRYRAKCGIPKTYCDSGPNQWRDHKRPMELLREWCEETEKNFKFYKGTKDGTPDRIVVGYRVYQLDEFGAFRNPNEHLGAKHQRLALHVLNQLE-------FIPEHVETRGLRSPMQPNIEQGKVQLWVDIFPKNEGVLKPSVDITAREPTNYELRVIVWNTSGVIMDETS-ITGEQMSDIYVKGWLEGMGDDKEKTDVHYRSLDGDGNFNWRMVFNFLYLPIEKKMVIREKEHFWSLDAKEVRLAPRLNMQIWDNDTFSYDDFLGSCQLDLIKLPKPCQTAKRCGTSRDPGKNGEYVDLFQQHSIQGWWACY----------QEGIEEPTGKIEMTIEVLNSNEAAVKPAGKGRDEPNQNPHLDEPNRPATSFLWFTSPFKTLKYII 1823          

HSP 2 Score: 246.128 bits (627), Expect = 2.927e-65
Identity = 194/683 (28.40%), Postives = 330/683 (48.32%), Query Frame = 1
Query:  658 SLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKP----KRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIK---QAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMI-KDETISTVFIDLHKIMNSANKEEE----------GFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVD-VRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECL-----SVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLG 2634
            S K++DFQI V I E R LSG NI+P+  V    QK+ T++   TN P YNE F+F+F  S  EL + +    A+S  S+     I P K + +     K  Y +   SF +   V +         +G++KV   VL  GD+P    K P K + E+D  IE+N L+P  +    R     ++ ++QAED+P M++ +  +IK   + I G  K L DPYV+V+F G    T +  +  +P++ +Q+     FP    R++I + D D +  D+ I T F+ L  I    ++  E           F PT+GP ++N YG+PR +S  E+   D   N+ + EGVA+RGR+LI ++TT   + I+  V  + + + V      +RE Y LFA  +EAT+I    G    P+ FE+SIG  G   DE                 + T P         Y ++P+ ++KP + + +  ED   RL   N++ +L  +L   V++V          +   ++        + I   +  +     ++K    D+  +K++ +      ++ +  ++       +   ++  + +LN +++ L D  ++PQ+ +PDV ++MI  + R+AY RI A++++ S  P   G++CG    + LK         K +  I A +++ LW G
Sbjct:    5 SDKVQDFQIRVKILEGRQLSGNNIHPVVRVAMSNQKRETKIVRSTNKPVYNESFTFNFHTSEAELFDDLFS-PAVSAHSYW-RWGIRPKKQLFQGLPRPKCAYIS---SFAFLNVVFL--------FQGYLKVTAMVLGPGDEPPIKAKLPPKEEDEDD--IESNCLMPMGVA---RQPALFNLRIFQAEDIPQMDSGMGRSIKKFFKGIFGGAKGLVDPYVKVNFCGKKIETSIKYQDDNPEFKEQVKIPLMFPSMCERIKIQLYDWDRVGNDDCIGTAFLSLSSISGQGDEGNELLVILHPSLLCFPPTFGPCFVNFYGSPREFS--ELPDQDDALNKGIGEGVAYRGRVLIELETTLGSNEIEQEVSQIETEDIVRVQPFLRREKYKLFACFYEATMIKDVDG----PVEFEVSIGNYGNKMDE-------------SVAPANTAPSNPLFDGCHYNYLPWGNEKPVVVVESFWEDIAFRLEPLNLISRLCDKLEVNVKRVRSALDAPTPPKEDAFVPMVTSILEVLISDCIPHVGVLSKSSKHCSYDILGRKVLPLNHRDHDLNLTTELKSALDFPGAEINMEQTVGELNGYLQRLRDVAIEPQNCIPDVIVWMISGSERIAYYRIPAQEVLFSTTPDACGKICGKTVELRLKYPGKKGQDLKDHPEIPALVRVELWFG 650          

HSP 3 Score: 137.117 bits (344), Expect = 5.322e-32
Identity = 118/461 (25.60%), Postives = 192/461 (41.65%), Query Frame = 1
Query: 2629 LGLLKDMRLYKMGLPEGFHK-DCFTSKMPP--------------------KIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENL-MEMTAQVN-DNSKGEKDEEKLRIPF--DVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLI-SVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDD 3933
            +  ++  R+ +  +PEG  K D   SK+PP                    K +       FQ+  Y+Y  R+L+  D+SG++DP+V+V      + + V  +T  P WD+T+I    +F+    I +  PP VV+E+FD D    ++F+GR   +P   I G+E  + KL W+ +  G    G+IL + +L  +     +        L N  ++    VN  +    +D E   +P    +RP +    +E+L WGVR +++ ++ S                +  P +  EIGG  I+SDI+ D    PNF   ++   I+ LPV   + PPM+I   +   FG K  V  H I  L  +                                           +    T AG      P      PG+P + +  VP+ E    DWW++YYA+L   +D
Sbjct:  872 MDFVRRRRMMRKLIPEGGGKIDPKKSKLPPILRNKAKGITFFRTPSLSISKSVISCTPHKFQMWAYVYQARDLLAKDESGMNDPYVRVAFANQSQMTEVKQKTLCPTWDQTLIFHVDLFDSLENIQRN-PPTVVMELFDKDQVGKDDFLGRTEFKPYPRIHGNEGPACKLLWYPISHGDEDGGEILAACELFLVSFIFFQCTTKLETGLLNFHLQDDGVVNIPHPPTPRDAEGEILPVRDRIRPVLQKTVVEVLCWGVRNMKKYQLAS----------------IKSPSVQFEIGGEIIQSDILTDAKKFPNFGRPILPRKIINLPVEEMYTPPMNIRIHDNRTFGRKPTVAVHSIKSLTRF-------------------------------------------RCAAPTPAGQIQVEGP----AAPGQPAEGV--VPEAESHKFDWWSKYYASLNQTED 1266          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO34141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ91])

HSP 1 Score: 291.582 bits (745), Expect = 5.249e-82
Identity = 182/458 (39.74%), Postives = 250/458 (54.59%), Query Frame = 1
Query: 4573 IVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMND---TVEIMGKTFNSDSMIEDDDGSQIKSLE------PLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFP-SGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC----DPFQHSDACAKF-NLF--KNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEP 5895
            IVRVY++ G++L   D +G  DPY++V IG KE   R++Y  KTLNP+FG  FE   + P    L + V D+DRL++DDLIGETTIDLE R LS +  TCGL  TY   G   W+DS+ P  IL+ +C    +  P +    D   TV +    FN    IED D  Q++S E       L+L  LH          +V EH+ETRPLY   +P IEQG L++WVD+FP +  +I PPI+I PRKP  + LR++I  T +V L +T+  T EK  DIYLK W++  D  L KTD H+RSLSG G FNWR  F F +L  E  +    K ++   E E K    L +Q+ ++D    D  +G     L + PKP    + C    DP    +    F +LF      +RGWW    +     + +       G V+M ++++  EEA++ P GLGR EP
Sbjct:  487 IVRVYIICGMDLQSQDTDGFGDPYLVVSIGKKEFSTRKDYKKKTLNPVFGEMFEFHASIPSSKDLKITVMDYDRLSRDDLIGETTIDLEQRLLSGYHATCGLPKTYFKSGPYAWRDSKTPKEILREVCLDRGLNRPDFYHKGDQAVTVVVGEDQFN----IEDLDDYQLESNELGSSEQRLSLHALH-------AMGMVPEHVETRPLYSPLQPRIEQGKLQLWVDIFPCTEGSIKPPIEIEPRKPKDFVLRVIIWDTTDVELQETS-ITGEKMSDIYLKGWLEEIDEKL-KTDVHYRSLSGDGNFNWRMEFPFSFLTIEKKLHLSKKKLWGKCE-EVKVDAKLKIQIWENDKFSPDDFLGTRSLPLHRLPKPCSNSRWCGTKYDPGVRQNPDDDFVDLFTLHTHSIRGWWACWQHDSPSGKPK-------GKVDMSLEILTAEEAKARPVGLGRSEP 923          

HSP 2 Score: 119.013 bits (297), Expect = 8.005e-27
Identity = 84/288 (29.17%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  658 SLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPN-IEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMI-KDETISTVFIDLHKIMNSANKE 1515
            S K + +Q+ V I+E R + G NI+PL  V  G +KQ T +K  TN+P YN+   F+F  S  EL ++++ ++  +      +R      ++G F  D  T+Y    H+F  KW +L       S ++G++KV   VL  GD+P          + N   +N+L+P  + + Q+++ ++ VY   AEDLP   + I+  +K A   + K   DPY+  SF G    TK      +P +NQ +      P     +++ + D D   K + I+T ++ L +I   +  E
Sbjct:   15 SSKPQHYQVRVKIHEGRQIPGTNIHPLVRVSVGNKKQSTSVKRSTNSPTYNQTLFFNFHASEAELFDELMTLEVFN------SRTFLSDSLLGFFESDIGTLYELPDHAFLRKWVLLTGAGVQESEDEGYLKVTAMVLGPGDEPPLSVFVAIVNNYNFFGSNLLLPAGV-RRQQAVFQLRVYF--AEDLP-QKSAILFFLKSA--EERKKSVDPYLTFSFCGKQIQTKTQHHENNPVFNQMLQLPVMLPSMCENIKLQLWDWDSFSKHDCIATAYLPLSEISGKSYGE 290          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC0])

HSP 1 Score: 275.404 bits (703), Expect = 2.128e-75
Identity = 207/688 (30.09%), Postives = 348/688 (50.58%), Query Frame = 1
Query:  655 LSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAI-LG-DGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSD-MIKDETISTVFIDLHKIMNSANKEEE------GFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNL--AEGVAFRGRLLIAIKTTSQPDSIKIGV-------DVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNY-LASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQ------AQLQIYLWLGLLK 2643
            LS K +DFQ+ V I E R LSG+NI+P+  V    Q + T++K+ TN PFY+E F F+F +S +EL ++II  +  +      +R +    +IG F  D    Y    H+   KW +L DP    +G KG++KV + VL  GD+   P K+ ++++ +IE N+L P  +     +    S+ VY+AED+P M++  +  IK+ + +G + K L DPY+  SFAG    T++   S  P++NQ++    +FP    RL++ + D D +  D+ I T  + +  I       E        FLP +GP +IN+YG+ R YS       D+  + NL   EGVA+RGR+L+ ++T       K+GV       D++S   +S     +R  Y LFA   EA++++   G    P+ FE+SIG  G   D    L     +  +   +++ +  Y       Y+ +P+   KPC+ + +  ED   RL   NIL ++ + L   + +VN  L +  +  +    +   ++     + K L  I +   T     LD+K Q+ +R+ +EK+ +S        S   +  A+ ++  F++ L D  ++PQ+ +PDV ++M+    R+AY RI A D+++       G+ CG V  +++K       P K   NI+      A +++ +WLGL K
Sbjct:   10 LSNKPQDFQVRVRIIEGRQLSGQNISPVARVTVANQTRQTKVKISTNKPFYDETFFFNFNMSPMELFDEIISFEVFN------SRKLRANAMIGYFKCDIGFFYEEPGHAAIRKWVLLTDPDDKMAGVKGYLKVTVMVLGPGDEA--PVKSAQDDNDDIETNLLQPSGVMLRPATF---SLKVYRAEDIPQMDSGFIEGIKRVLRVGEEQKELVDPYLLFSFAGMKARTRIHYNSDHPEFNQELNVQFKFPSMCERLKLQMFDWDRLTADDCIGTAHLPMSAISGQGEDGESWVERNISFLPMFGPCFINVYGSTREYSDLP----DEYDDLNLGNGEGVAYRGRVLVELET-------KLGVTPQSPTDDLQSHEIISVQPYLRRRKYKLFACFLEASMVSCSDG----PVEFEVSIGNYGNKLD----LSVPPSSSTTPPTNAVYDGCY-------YYFLPWGDTKPCVCVESHWEDIGFRLGTKNILTRMCERLEVNMDKVNLSLEANAQPAETATLLISLLDQLINDVRKPLPKIDN--NTPGVNDLDLKLQE-VRL-MEKLSISEEAIKLRESATDVREALGEIEGFLQRLRDLTVEPQNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPYSEACGENCGQVQNIFMK------YPGKKQQNIEDYPEVPAHVRMMIWLGLEK 650          

HSP 2 Score: 145.591 bits (366), Expect = 9.018e-35
Identity = 90/320 (28.12%), Postives = 149/320 (46.56%), Query Frame = 1
Query: 2710 PPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKL-----------RIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            P   I Y +   +QLR YL+  R+L+ SD  G+SDP+ +V+ G     +     T  P WD+T+I D +    + + V   PP V++E++D D    +EF+GR   +P V + G    + +L W++V RG    G+IL +F+L                    L+ +T   N + +G  +   L            +P  +RP +    +E+L WGVR +++ ++ S                V+ P I  E GG+ + S II++   +PNF+  L    + LP    + PPM+I   +   FG K +VG H +  L  +
Sbjct:  901 PRMFITYEKPHRYQLRAYLFQARDLLASDPDGVSDPYARVVFGTRSSVTETLARTLCPTWDQTLIFDEVNIYGSIEQVAENPPAVIIELYDKDPVGKDEFMGRCVVKPLVKLNGQGPPAPRLLWYDVERGDEYGGEILAAFELF-------------------LVSITKVQNASKRGNDEGTDLPFAPPMKGNLFLVPNGIRPVMQRTAIEVLCWGVRNMKKFQLAS----------------VSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRKPMVGLHALKSLQRF 1185          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC3])

HSP 1 Score: 238.81 bits (608), Expect = 3.791e-70
Identity = 133/321 (41.43%), Postives = 186/321 (57.94%), Query Frame = 1
Query: 4729 FEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNK-NIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD 5685
            FEM  T P    L + + D+D +++DDLIGET +DLENR+L+ +R  CGL  TY   G  +W+DSQ P  IL   CE      P+Y  + +   ++     +    E+          P   + LH    ++    +V EH+ETR LY   +P IEQG L+MWVD+FP     P  P +ISPRKPA YELR++I  T +V L +T+  T EK  DIY+K W+   D D QKTD H+RSL G+G FNWRF+F F YL AE  +V K K + + +DE E + P  L +Q+ D+D    D  +G+L+  L++ PKPAK  + C+
Sbjct:    2 FEMNATIPIIKDLKISLMDYDLVSRDDLIGETVVDLENRFLTRYRACCGLPQTYCTSGINQWRDSQTPRQILDLFCESQGKGRPQY--LGNMKLVLDNRVYTLQEFEEGMIHHPHLGAPEQRLALH----VLNSMPVVPEHVETRSLYNSLQPNIEQGKLQMWVDIFPKHLGTPGAPFNISPRKPAEYELRVIIWNTSDVILEETS-ITGEKMSDIYVKGWLAGAD-DPQKTDVHYRSLDGEGNFNWRFIFPFMYLPAEKIMVVKKKVHFWSLDETEERVPLRLIIQIWDNDQFSPDDFLGQLELTLNRMPKPAKSARKCN 314          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofa (otoferlin [Source:NCBI gene;Acc:101155482])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 379/1172 (32.34%), Postives = 613/1172 (52.30%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPDSIKIG-VDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYS-----------------------HLPKKEENFESQYVHSLTEPKYAYTF-DNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQK-----TNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHK-------DCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEK---LRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIE--YYVEDKINEDLDHESDHLQSLTAQ-----FDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIR 3996
            ++P S +  D+QIS+T+ EAR L G N++P+  V  G  K+ T +K  TN P+YNEYF FDF +    L ++II++  +  K+ + +     G ++G F +D  TVY    H F++KWA+L DP   T+G KG+VK D++V+  GD  K P+K ++ ++ +IE N+L+P+ +   +R      V +Y+AE LP MNT IM+N+K+A +G+ + L DPYV+V FAG  G T V   SY P WN+QI+FTE FPP   R+++ +RDSD + D  I T FIDL KI N  +K   GFLPT GP+W+N+YG+ R Y+   ++   Q  N+ + EGV+FR RLL+++      T+ P+ I    V V   + +S +  GK E + LF S  EAT++ ++IG   KP+TFE++IG  G   D  S                       +  + E   E   V   T P       D  YFH+PY  KKPC+Y+ +  +D R RL+  NI+DK+  +L E +  V  +  + +K    R ++  +E   +   + ++        A +T LD +  K     L+ M          +   T+   +K   SF++ L     +PQH +PDVF++M+ +N R+AY RI ++D+++S +  E G+ CG V   +LK      LP K       + +QA+L++YLWLG+ +  + +  GLP GF +         F S +PP  + Y  +  FQLR ++Y  R+L  +D SGLSDPF +V    H + + V  ET  P WD+ ++ D++        ++  PP +V+EI+D D+    EFIGR F +P++ +  + Y   +    L+++ +YRG   AG++L +F+L++I    K       P +E              G  D E+   L +P  +RP +  +R+E+L WG+R L+RI +                  V++PR+ IE  G  ++S +I+++  +PNF+  +    + LP N    PP++I  ++   FG   +VG H ++ L    Y   DK + +     D + +L  +      D     D V  K  D + +K  +K K G+  + + D         E+++           DWW++Y+A++  L +    KP D +L  S+ +++ R
Sbjct:  246 MEPGSGRPVDYQISITVVEARQLIGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVLFDKIIKLSVIHSKNLLRS-----GTLVGTFKMDVGTVYFQPEHQFYHKWAILSDPDDITAGCKGYVKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGI-PAERQWARFYVKIYRAEGLPKMNTTIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIVFTELFPPLCKRIKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRQYT---LMDEHQDLNEGIGEGVSFRARLLVSVAVEILDTTSPEIISSSDVQVEGVSNISESATGKMEEFFLFGSFLEATMVDRKIGD--KPITFEITIGNYGNQIDGVSKSPAAKKKKKDGENEEDENELILNSSEDEAEEEGDLVSVSTTPLMKPVITDRNYFHLPYFEKKPCVYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEII-KTEKAFPERRLRGVLEELSVGCSRFVALANKDVNLAGRTKLDRERLKSCMRELDSMGQQAKQLRTQVKKNTVKDRLKLAQSFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPSKDILYSTVEEETGKDCGKVKAAFLK------LPGKKSFGPAGWTVQAKLELYLWLGVNRQRKDFLSGLPNGFEEVKAVEGGPGFLS-LPPLSLVYSMKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDDVELFGEASELREDPPIIVVEIYDQDTVGKAEFIGRTFAKPTIKMCDEHYGPPRFPPQLEYFQIYRGNCTAGELLAAFELLQIGQGGK----ADLPPIE--------------GSTDSERGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGTHAVSSLRRFIYSPPDKTSNNWASAGDVIVNLDTEPQIRKMDTVVKLDAV--KESDKEKKKKKKKKKGGLDEEEETD---------ERVL-----------DWWSKYFASIETLKEVIYVKPNDLLLKGSKIKEKSR 1339          

HSP 2 Score: 503.056 bits (1294), Expect = 3.638e-146
Identity = 266/592 (44.93%), Postives = 374/592 (63.18%), Query Frame = 1
Query: 4225 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHS--VDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            ++ + +++ ELE+  ++G F+    +F+LYRGK  ++D+     DR  G FKG++C+Y +    + E+   +  +D +                         +  F S PH+  ++ +VR+YVV+  +LHPADINGKADPYI++R+G  E++D+ENYI K LNP+FG+ F++E TFP ES L V VYDWD +  DDLIGET IDLENR+ S  R TCG+ S+Y+ HGY  W+D   PT IL  LC++  I  P Y      V++  + F   + IED++G + ++ E LAL VL++WE+I P   CKLV EH+ETRPL   +KPGIEQG +EMWVDMFPS    P P +DISPRKP  YELR++I  T+ V L D ++FT EKS DI+++ W+K    D Q TD H+ SL+G+G FNWRFVF F+YL AE+ IV  K ++++  DE EYK P  L +QV D+D   +D  +G ++  L++FP+ AK  K C  D  ++       ++FK K+V+GWWP V   +       + +E+ G VE E+ LV  EEAE +P GLGR EP PLEKPNRPD S + FL P  +I+YFI
Sbjct: 1365 VDELVVFNKELES--EFGNFEDWLHTFNLYRGKAGDDDEHALDDDRIVGRFKGSLCMYKLP---LSEEITREAGYDPN-------------------------MGMFQSIPHNDPINVLVRIYVVRATDLHPADINGKADPYIVIRLGKTEVKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRFYSKFRATCGISSSYSVHGYNIWRDPMKPTQILTRLCKEGKIDGPHYGP-GGKVKVANRIFTGPTEIEDENGLKKQTEEHLALTVLNHWEEI-PRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPSDMPAPGPALDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFEYLVAEEKIVISKKESMFSWDETEYKIPPRLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSLDMIRNEHELPTISIFKQKRVKGWWPFVARDE------NDEMELTGKVEAELHLVTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFLGPLKSIRYFI 1918          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofb (otoferlin-like [Source:NCBI gene;Acc:101160130])

HSP 1 Score: 575.474 bits (1482), Expect = 1.444e-173
Identity = 341/1038 (32.85%), Postives = 568/1038 (54.72%), Query Frame = 1
Query:  646 IDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKT----TSQPD-SIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENF----ESQYVHSLTE---------------PKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSF---VKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLK---KMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTS-----KMPPKIIDYME-ESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSK----LQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLE-LLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEY 3636
            ++P S +  D+Q+SVT+ EAR L G N++P+  V  G+ K+ T +K  TN P+YNEYF FDF +    + ++I+++  +  K+ + +     G ++G F +D  T+YS + H F++KWA+L DP   T+G KG+VK D++V+  GD  K P+K ++ ++ +IE+N+L+P+ +   +R      + +Y+AE LP MNT IM+N+K+A +G+ K L DPYV+V FAG  G T V    Y P WN+QI FTE FPP   R++I +RDSD + D  I T F+DL  I N  +K    FLPT GP+W+N+YG+ RT+S   ++   Q  N  L EGV+FR RLLI++      TS P+ S    V V     +S +  GK E + LF S  EAT+I ++IG   KP+ FE++I             PK E+      E++ +H+ +E               P       + YFH+PY  +KPC+Y+ +  +D + RL+  NI+D +  +L + +  VN +  + +K    R ++  +E       + L+     +  + +T LD +  KL    +E + +        +   T+   +K   +F   ++FL D   +PQH +PDVF++MI +  R+AY RI ++D+++S+I  EKG+ CG V T++L+   K  F        + +Q++++IYLWLGL +  + Y  GLP GF ++  +        PP  + YM  +  FQLRV++Y  R+L  +D +GLSDPF +V      + + V  ET  P WD+ ++ +N+        ++  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ +YRG   AG++L +F+L++I P  K       P ++   +M        +G      L +P  +RP +  +R+E +L WG+R L+R+ +                  V++PR+ IE  G  ++S +I ++  +PNF+  +    + LP N    PP++I  ++   FG   +VG++ ++ L ++
Sbjct:   47 MEPSSGRPVDYQVSVTVIEARQLVGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRS-----GTLVGTFKLDVGTIYS-QPHQFYHKWALLSDPDDITAGGKGYVKCDIAVVAKGDTIKTPHKANESDEDDIESNLLLPEGV-PAERQWARYYLKIYKAEGLPRMNTSIMANVKKAFIGENKDLVDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIAFTEMFPPLCRRMKIQLRDSDKVNDVAIGTHFLDLRNISNDGDK----FLPTLGPAWVNMYGSTRTFS---LLDEYQELNDGLGEGVSFRARLLISLGVEILDTSSPEISCSTEVQVEGVPNISESATGKVEEFFLFGSFLEATMIDRKIGD--KPINFEVTIYYGNEIDGALQPKPKGEKGKGDEEETELIHNSSEEEMEDDGDLTSVATTPPMKPVITDNYFHLPYFERKPCIYIKSLWQDQKRRLYNSNIIDNIADKLEDGLNDVNEII-KTEKAYPERRLRGVLEELSQGC-QFLALANKDQNQSGRTKLDKERLKLCLSEVEAIGLQAKAMRSQVKKSTVRDKLKLSQNFLSKLRFLAD---EPQHSVPDVFIWMISNGKRIAYARIPSKDILYSSIDEEKGKDCGKVKTIFLRIPGKKGFG----PAGWTVQSKIEIYLWLGLTRQRKDYLNGLPNGFEENKLSKGPGLPSTPPISLTYMSVKQIFQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEVLAETLCPTWDQLLVFENVELFGEAVELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCAAGEMLAAFELLQIGPNGK----ADLPPIDGPTDM-------DRG----PILPVPLGIRPVLSKYRIEQVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIPNFKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSNAVSSLRKF 1028          

HSP 2 Score: 431.795 bits (1109), Expect = 8.718e-124
Identity = 246/566 (43.46%), Postives = 343/566 (60.60%), Query Frame = 1
Query: 4237 KIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDD-GYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPE--CKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVY-KNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSC--DPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKP 5913
            ++Y  ELE+  ++  F+    +F L+RGK  ++DD     +DR  G FKG++C+Y V +D   +         +S +  F                        + +   V+ +VR+YVV+  +LHPADINGKADPYI +++G  EI+D+ENYI K LNP+FG  F++E TFP +S L V +YDWD +  DDLIGET IDLENR+ S HR TCG+     NHGY  W+D   PT IL  LC+   +  P Y      V++  + F + + IED++  + K+ E LAL VL +WE+I P   CKLV EH+ETRPL   +KPGIEQG +E+WVDMFP     P P +DISPRKP  +ELR++I  T+ V L D + FT EKS DI+++ W+K    D Q TD H+ S++G+G FNWRFV+ FDYL AE+ IV  K ++++  DE EYK P  LN+QV D+D   +D  +  ++  L++FP+ AK  K C  +   +       ++FK K+++GWWP V         EE+  E+ G VE E+ L+ GEEAE +PAG GR EP PLEKP
Sbjct: 1111 EVYPKELES--EFDNFEDWLHTFYLFRGKAGDDDDQTVADEDRIVGKFKGSMCMYKVSDDAPRDMSF------DSNMGMFQN----------------------IPNNDPVNVLVRIYVVRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFG-SFDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVA----NHGYNVWRDPMKPTHILAKLCKDGKLDGPHYGP-GGRVKVENRVFMAPTEIEDENLKK-KTDEHLALCVLTHWEEI-PRVGCKLVPEHVETRPLLHPDKPGIEQGRIELWVDMFPKEMTAPGPALDISPRKP-KFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVR-WLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPPRLNLQVWDADHFSADDFLA-IELDLNRFPRGAKTAKQCTIEMVTNEAEMPMVSIFKQKRIKGWWPFV------ARNEEDEFELTGKVEAELHLLTGEEAEKSPAGEGRNEPEPLEKP 1629          
BLAST of Otoferlin vs. Ensembl Medaka
Match: ENSORLT00000022822.2 (pep primary_assembly:ASM223467v1:21:28315623:28320348:1 gene:ENSORLG00000018220.2 transcript:ENSORLT00000022822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 366.311 bits (939), Expect = 2.806e-111
Identity = 226/581 (38.90%), Postives = 311/581 (53.53%), Query Frame = 1
Query: 4240 IYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDI-VPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +Y+ ELE   D+G F     ++ L+RGK  EE+   +  +RF G FK   C+Y + E          E+  E     F                   ++ + +     V  ++RVYVV   NLHPAD +GKADPYI++R+G  EI+DR+NYIPK LNP+FG  FEM+ TFPQES L V +YD+D +  DDLIGET IDLENR+ S HR TCGL + Y+  GY  W+DS  P+ +L  +C +N +  P++      + +  K F+  ++   +    ++S E L+L +LH W +I    CKLV EHIETR LY + +PG++QG ++MWVDMFP     P PP+DISPRKP  YELRI+I  TE+V L D+NF T ++S DIY+K                                          +V K  NI+ +D+ E K P  L +QV D + L SD  +G L+  L  FP  AK  K+C     +    + ++F+ K+ RGWWP                E+ G VE E  LV  EEAE NP G  R+EP PL KP RPD SF  F+NP+    + +
Sbjct:    1 LYNRELE--ADFGQFDDWVNTYELFRGKANEEEGSSD--ERFVGKFKARFCLYKLAE----------EEWGEGSDPGF------------------FRVSRGIPANSPVQVLIRVYVVSASNLHPADPDGKADPYIVLRLGKNEIKDRDNYIPKQLNPVFG-SFEMQATFPQESLLSVVIYDFDLVGGDDLIGETRIDLENRFYSRHRATCGLPTEYS-EGYNAWRDSLKPSELLSKMCRENGLDAPRFSP--GKISVADKVFHGKTLYMHE--QPVESYEHLSLKILHRWSEIPAVGCKLVPEHIETRVLYNKARPGMDQGQVQMWVDMFPMDLPHPGPPVDISPRKP-KYELRIIIWNTEDVILDDSNFLTGQQSSDIYVKV----------------------------------------VVVRKRDNIFSLDKTEQKLPAILILQVWDFETLSSDDFLGTLELDLHGFPPGAKTAKACKAEMLTGRTERISIFQQKRARGWWPF-----------SKSGELTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLPKP-RPDTSFSWFMNPFKCFFHLV 490          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myof (myoferlin [Source:NCBI gene;Acc:101172285])

HSP 1 Score: 265.388 bits (677), Expect = 5.581e-71
Identity = 214/759 (28.19%), Postives = 372/759 (49.01%), Query Frame = 1
Query:  451 NVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFK----LPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILG---DGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSD-MIKDETISTVFIDLHKIMNSAN-------KEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKI--GVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIK-----SCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEK-GQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLY 2658
            ++PS N+  L  +  +I +    S+ E+  D  D E + D+  + G      S+    + +      +    L+ K +DFQI V + EAR L G NI P+ +V+   Q   T +K   N PF++E F ++  +   +L EQ I  +  +  S      +    ++GEF +D   VY   +H    KW +L DP   +SG KG++KV L V+  GD+P    +   ++  +IE+N+L+P  +  T R    +S+ V++AED+P M+   + +IK+ I G   + K L DP++E  FAG    T++I ++ +P+WNQ +    +FP    R+++ V D D +  ++ + T ++DL KI +S         + E GFLP +GP +INLYG+PR ++       D   N    EGVA+RGR+L+ + T     + K    + ++  + +S      R  Y L A    A++I QE G   +P+ FE+SIG  G            + +   + + S T+   A    NQY+++P+ + KP + + +  ED   RL   NI+      LC   R  + L +    + A     K  E +   +D+++  ++        G +  T LD++ +K   + L  +K   +V         I   + D+ ++V  L     +PQ+ +PDV ++M++   RVAY+RI A +++ S    +  G+ CG   TV+LK      + +     +  Q+++ +WLGL  D + +
Sbjct:   98 SLPSKNVPLLGENGQNIGVGFIFSACEAGGDENDGETATDLG-QSGSAGVPSSIKQSANVRQRLTRGQSRHRLATKPQDFQIRVRVVEARQLPGNNIKPVVKVHVCGQTHRTRIK-SGNNPFFDEMFFYNVHMLPSDLFEQSISFRVYNSYS------LRADSLMGEFKLDVGYVYDEPAHCVMRKWLLLNDPDDSSSGAKGYLKVSLFVIGTGDEPLVEKRDCDDDQDDIESNLLLPAGM--TLR-WATLSLKVFRAEDIPQMDDAFVQSIKE-IFGAEENKKNLVDPFLEARFAGKKLCTQIIEKNANPEWNQVLHLQVKFPSMCERVKLTVFDWDRLTGNDAVGTTYLDLAKIASSGGEIEGNPVESEVGFLPVFGPCYINLYGSPREFTGLPDPYDD--LNFGKGEGVAYRGRILVELSTKLDEKAEKTIDNIHIKRTSIISI----LRRKYCLCAVFHSASMI-QEPG---EPIQFEVSIGNYG-----------NKLDTTCKPLASTTQYSCAVFDGNQYYYLPWANTKPVVVLTSFWEDISHRLNAVNII------LCITHRLQSNLEAFKVAILAKVPDNKLAEVWLQLLDQLIEDLERFPTPELEGCSNLTSLDIQLKKRRDITLNSIKE--AVLRMRQEASEIRDTLSDIETWVDKLKQLAEEPQNSMPDVVIWMLRGEKRVAYSRIPAHEILFSTYSEQACGKNCGKTQTVFLKYP----MDKAKGLKVPVQIRVSMWLGLSADEKKF 811          

HSP 2 Score: 146.362 bits (368), Expect = 1.529e-34
Identity = 107/411 (26.03%), Postives = 183/411 (44.53%), Query Frame = 1
Query: 2746 FQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKST-VFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLD--DPNLYKPEDEILV 3969
            + LRVY+Y  RNL+  D    SDP+  V    H+ K+T     T +P WD+T+I +++    +P+ +   PPDVVLE +D D    +E +GR  C P V +  +   S +L W  + +    AG++LV+ +LI  D  S    +P  P +                 + E    +P  +RP + L  +E+L WG+R ++  ++ S                V+ P +++E GG R+++ II++    PNF  N++ + + LP +  + PP+ +  I++  FG K VVG   I  L ++  +  +       S  +  + A                       P K  A    ++ P                +  +E E+ DWW+++YA+ G+ D   P L K  D + V
Sbjct: 1088 YHLRVYVYQARNLMSMDKDSFSDPYAHVSF-LHVSKTTEKLKATLNPTWDQTLIFNSVEIYGDPQKIAHRPPDVVLEFYDEDQVGKDEMLGRSICTPLVKLSPEMDQSPRLFWHPIIQKGQRAGEVLVAAELILKDK-SGDSDLPLLPPM-----------------RAENLYMVPQGIRPVVQLTAVEILAWGLRNMKPYQLAS----------------VSSPSLVVECGGQRVETAIIKNMKKSPNFPGNILFIKVLLPKDEMYTPPIVLKVIDHRPFGRKPVVGQCTIASLEDFRCDPYVIVSEGARSSKMALMMAS----------------------PHKDVAITMEESSP---------------LLEAQEKETVDWWSKFYASTGEQDKCGPYLKKGYDTLKV 1426          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myofl (myoferlin [Source:NCBI gene;Acc:101156429])

HSP 1 Score: 245.358 bits (625), Expect = 1.117e-64
Identity = 190/604 (31.46%), Postives = 289/604 (47.85%), Query Frame = 1
Query: 4228 ERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFN----SDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIP-PPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCD----PFQHSDACAKF---NLFKNKKVRGWWPLVYNPKXXXXXXXNG--LEIGGTVEMEMDLVLGEEAESNPAGLGREEP--LPLEKPNRPDGSFLNFLNPWNTIKYF--IKYR 5985
            + +K+Y+CELE ++ + G     R+ +L++GK  ++D+   +  +F    +G+  IY           L D+    +    F E                      L +    + +VR+YVV+ I +   D NGK DPYI + +G K + DR+NY P TL+P FG  FE+  T PQ+  L + VYD+D+ ++D+ +GET IDLE+R LS  R  CGL  TY + G  +W+D   P+ IL+++ +   +PPP  ++   ++   GK ++    ++ +I    G +    E L+L VL N         LV EH+ETR L    K  + QG ++MWVD+FP    +P PP +ISPRK A Y LR++I  T +V L D +  T EK+ DIY+K                      +  +NW                         D+ EY+ P  L +Q+ D+D +  D  +  ++  L +   PAK  + C     P       +K    +LF  K VRGWWP            +NG  +   G VEM +++V  +EAE  PAG GR EP   P   P RP  SF  F N  + +K+   IK+R
Sbjct: 1307 DTLKVYNCELEKVEQFQGLTDFCRTINLHQGKTVDDDEDPSVVGQFK---QGSFKIY----------PLSDDPSVPAPPCQFKE----------------------LPESGPQECLVRIYVVRCIEVQSKDSNGKCDPYIKITLGKKTLDDRDNYKPNTLSPEFGM-FELSCTLPQDKDLKIAVYDFDKWSRDEEVGETVIDLEDRLLSYFRPCCGLPQTYCS-GVNQWRDQLKPSQILQNVAKMRGVPPPSIEEDGRSLLFSGKRYHLQDFANILIHSHLGPE---KERLSLHVLRN-------LGLVPEHVETRTLSSSYKSNLSQGRIQMWVDIFPKRLGLPGPPCEISPRK-AKYFLRVIIWNTSDVILDDAS-ITAEKTSDIYVKQ---------------------EQFWNW-------------------------DKTEYRNPPKLIVQIWDNDRISLDDYLS-VELDLLRLVPPAKTPEKCTLKMLPGMKGTVASKAKPTSLFSRKSVRGWWPCA--------NAQNGSCVLTQGKVEMTLEIVDEKEAEERPAGRGRNEPNMNPKLDPPRPATSFAWFTNVSSILKFMTRIKFR 1806          

HSP 2 Score: 223.402 bits (568), Expect = 6.792e-58
Identity = 181/676 (26.78%), Postives = 316/676 (46.75%), Query Frame = 1
Query:  640 KHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDG--KALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNIL----DKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLS--AIKSCRGTAKKTLLDVKYQKLIRMGLEK-MKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEK-GQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGL 2637
            K   PL+ + +DFQI V + E R L G +I P+  V    +   T ++   N PF++E F ++  +S  +L ++                                       H+   KW +L DP   T G +G++KV + ++  GD+    N+  + E  ++E+N+L+P  +     +   +S+ VY+AED+P  +   +  +KQ + G+G  K L DPY+EVSFAG    TK+I ++ +P+WNQ I                      +KD+ I T F++L +I +S    E GFLP +GP ++NLYG+PR   Y ++    +  N    EGVA+RGR+L+ + +T     ++  VD    + V      +R  Y L  S+F +  + QE G    P+ FE+++G  G           K ++     V   T P     FDN Y+++P+   KP + + +  ED   RL   NIL    D+L+  L       N L +    + A     +  E +   +D ++    + +       T+LD++ + L    +   M+M+  +  E   + +    I+D    +K L +   +PQ+ +PDV ++M +   RVAY R+ A  +++S+   +  G+ CG + T++++      + +     I A+L+  +WLGL
Sbjct:  139 KRNKPLASEAQDFQIRVRVIEGRHLPGIDIKPVVRVLFDGKTHRTNVR-GGNNPFFDEMFFYNVNMSLSDLSDE---------------------------------------HAIMRKWLLLKDPDDSTMGARGYLKVSIIIMGTGDEAPIENRLFRAEQDDLESNLLVPAGVSMRTAT---LSLKVYRAEDMP-QDDATVQTLKQFLGGEGDKKNLVDPYLEVSFAGKKVCTKIIQKNANPEWNQLISLN-------------------VKDDVIGTTFLNLSQISHSGGNVEVGFLPAFGPCFVNLYGSPR--EYGDLPDRFEELNFGNGEGVAYRGRVLVEL-STHLDKKVEKNVDDIPRDDVLVAQFQRRRRYSL-CSVFHSACMLQEPG---GPIRFEVTLGNYG----------NKLDSTCKPLVS--TTPNCFAVFDNHYYYLPWADTKPVVILTSYWEDISHRLDAINILLFTADQLESNL-------NLLKT---AISAKEPESRLTEIWLKLLDHIIEELVLPALEDRLNVTVLDLQKKNLREAAVYNIMQMACCMKEEARDIGSTVADIEDWLDRIKQLAE---EPQNSMPDVIIWMFRGEKRVAYARVPANQILYSSFSKQACGKHCGKIQTIFMQYP----MDKNKGVKIPAELRFNMWLGL 715          

HSP 3 Score: 122.479 bits (306), Expect = 3.790e-27
Identity = 102/413 (24.70%), Postives = 186/413 (45.04%), Query Frame = 1
Query: 2713 PKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLE-LLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSD-GVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLY 3945
            P +  +     + LRVY+Y GRNL   D +  S P+  V      + + V   T +PIWD+T+I ++I  + +P+ V +CPP+VVLE++D D    +E +G     P + ++ +     KLQW  + +    AG++L++ +L+          VP                      + E+   +P  ++P + L  +E +L WG+R ++  +                + PV+ P +I+E GG  +K+ II+++  +PNF  + + ++  LP    + PP+ +  I++  FG K VVG   I  L E+  +                       + NSD  +S++A               + +DA+ +V   V        R + +   E+ DWW+++Y++LG+    N Y
Sbjct:  969 PTVSCHFSSYIYHLRVYIYQGRNLCPMDHNSFS-PYAHVSFLHMSKTTHVIQNTLNPIWDQTLIFEDIEIHGDPQTVASCPPEVVLELYDSDQVGKDEPMGHCKYPPLINLQPNIGCRPKLQWLPITKKGHNAGELLLAAELLLKLDDDDLPIVP--------------------PRRSEKLYMVPQGIKPVVQLTAIEQVLTWGLRNMEAFQ----------------LSPVSSPSLIVECGGETVKTAIIKNFKKNPNFPGS-VLLLKLLPKEEMYAPPIVLKVIDHKPFGWKPVVGQCTIRSLGEFRCD---------------------PYRTNSDICMSSRA---------------MMADAQENVVIDVES------RAISETRDEAVDWWSKFYSSLGEQQKCNPY 1301          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010400.1 (SMESG000010400.1)

HSP 1 Score: 3975.25 bits (10308), Expect = 0.000e+0
Identity = 2017/2017 (100.00%), Postives = 2017/2017 (100.00%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVDKITGG 6105
            MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSEDEEDEVVEIPEDIPKKKKKKKKKKKKKKKKRLFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDENKTEEELLNEKSNLKLYKFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKDEDEEEENGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRLKWILIKILIVLIFVLIIVLFIYNFPGNFSRVIVDKITGG
Sbjct:    1 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSEDEEDEVVEIPEDIPKKKKKKKKKKKKKKKKRLFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDENKTEEELLNEKSNLKLYKFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKDEDEEEENGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRLKWILIKILIVLIFVLIIVLFIYNFPGNFSRVIVDKITGG 2017          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010367.1 (SMESG000010367.1)

HSP 1 Score: 1800.02 bits (4661), Expect = 0.000e+0
Identity = 895/1461 (61.26%), Postives = 1152/1461 (78.85%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVES----DSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKIN--EDLDHESDHLQSLTA--QFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPK-EEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRL--FQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNV 4404
            MSL V L+ L G  QG + +IK++FRD + ++   KT  +   G RF WPIARK+DK D L++K    NR G DKL GV+ I    L+ +  +N+ E  VDE+M+ITDI + FEIEY SP +G++N G   FN P YNL  L+R    + LPS+ SS E     DSD+GD     D +++D  + S++SLLP+RDFKLPKHIDP SLKI+DFQISVTI EARGL G NINP+FEVYCGKQKQ TE+KMQTN+PFYNE+F+FD  +SRLE+ME II+I+ LSK +++V + IF GKV+GEFSIDAK+VY+NE HSFF KWA LIDPK+PTSGEKG+VKVD+SVLCAGDKPKRP+  D EE+PNIEAN+LIP  +  T R +CEM+V +YQAEDLPCMNT I+SNIK AI G+GKAL D YVEVSFAGYTG TKV++R+YSPDWNQQIIFTERFPP+V+RLRIAVRD+DM+KDETIST+FIDL KIM + +KEEEGFLPTYGPSWINLYGTPRT++Y ++IKGDQGQNQNLAEGVA+RGRL+IAIKT+ QPDS KIGVDVR CNPVSN VAGKRE+YLLF  I+E TLI +++GK  KPLTFE+SIG TG   D+Y+     +   E+QYVHS+T+ ++AYT+DN+YFHIPY++KKPCL+MI  SEDHRPR+FIPNI++KLK+EL E +RQ ++L    K +QA RY+K S+     SI+KV+S +KSCRGTAKKT+LDVKYQ+LIR+ LEKMK+        L    +   +++ N+ VK L+DKM DPQ+GLPD+F+YMIQ+NIRVAY RI AR++IHS++ PEKG MCGM+NTVYLK+++ S+L   T+YNIQAQLQIYLWLGLL+DMR YKMGLPEG++++CF+ KMPPK IDY++ES FQLRVYL+M RN+IGSDDSGLSDPF ++IIGEH+ KST+F +TRSPIWDET+IIDNI+FNY P ++K+ PP+VV+EIFDWDSDTDEEF+GRVFC+P V+I+GD+YT++KLQWW++YRGT+ AG+IL +FDL+E+D  +K+I V G P+++++ +MT+++NDN  GE DE KLRIP  +RP +  FR E+L+WGVRQLQRIE++  K++  +  KR GIFPVNQP+I I+I GYRI+SD I DW   PNF DNL+ + LRLP +++FWPP+SINC N T+FGLKQ+VGN  IT+L++YY  D+++   ++D  +   +S+ +   F+   +++G+ N+ F+N+D     +     +    PDVT PVPG  EK+   +P+ EEMESADWWTRYYAT+GDL D  + K   E L ESES++E+   +     +  +S+++E++VV+IP+D PKKKKKKKKK+KKKK+K    FQ  STKELFLKE  ++L +E E ++DNSWIERI +Y CELEN+KD+GGF  PF+SFSLYRGKQEE+DD +E  DRF GVFKGNICIYN+
Sbjct:    1 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTLPSENSSDEDEEYYDSDDGDGR---DNNIRD--DISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYA-----KPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLRLE-KNIQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIIGEHVAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRFGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPISINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKKKKKKKKRKKKKRKFKNPFQ-PSTKELFLKEEPDNLRMESEYVTDNSWIERITMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNI 1449          

HSP 2 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 387/519 (74.57%), Postives = 460/519 (88.63%), Query Frame = 1
Query: 4546 LSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRXXXXXXXXXXXXXXXXXXXXXXYNFPGNFSRVIVDKITG 6102
            L D + VDF+VRVY++K INLHP+D+NGK+DPYILV++G+KE+RDRENYIPKTLNP+FG+C E+EVTFPQESFLLVQ+YDWDRLTKDDLIGETTIDLENRWLSPH+G+CG+M +Y+NHGY+KWKD +LPT ILKSLCE++N+P P YDK+ D V+I  ++F +++MIEDDDGSQIKSLEPLAL VLH+W +IVP  KLV E+IETRPLY+ EKPGI+QGLLEMWVDM+P+GTAIP PIDI+PRK   YELR  ++QTE VRL + NFFT EK+VDI++K+WMKSTDIDLQKTD H++SLSGQGLFNWRFV+ FDYLKAED IVY  K++YEIDE EYKTPCFLNMQVLDS ++MSDTIIG+ K RLSKFP+PAK+Y+SCDPFQ S+ACAKFNLF+NKKVRGWWPL+YNPKDED +EE+G EIGG VE+EM+LV  EEAESNP GLGR EP+PLE P RPDGSFL+FLNPWNTIKYFIKYRLKWILIKI ++ + +LII LFIYNFPG+ S  IV K+ G
Sbjct: 1506 LRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTVILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKIFVIFMALLIIALFIYNFPGSISNAIVTKMFG 2024          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 500/1334 (37.48%), Postives = 788/1334 (59.07%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP------------------SDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGD----KPKRPNKTDKE-EDPNIEANILIPQ-ILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTT--SQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH------LPKKEENFESQ---YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKK-MNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVN---DNSKGEKDEEKLR---------------------------IPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKI-----------NEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN 3825
            M+L++ L+ +  +    +  +K+ FRD +  T   + K S   G +F WP+ RKLD +D+L ++    +++  +KL G + I L  L+    I+  E  +D    I  I ++FE+ Y SP S   N  + +F  P  +           R  SD   +  DS    ++                   +D+  V+ G++    +    R   +P  + P   K +D+QIS+T+ EAR L+G NINPL EV  G++ + TE++M TN+P+YN+Y  F+F +S+ EL +Q+IR++ L+  +  ++R + PG +IGEF +D +TVY+   H F +KWA+L+DPK   SG KG+VKVDL+++  G+    KPK   K  K+ +D +IEAN+L+PQ I   T+R + E+ V +Y+AEDLP MNT IM+ IK AI GD K L DP+V+VSFAG+TG TKV   +Y+P+WN++I+FTE FP   +R+R++V D D + +E I+T +IDL +IMN  +    GFLPT+GPSW+NLYGTPR Y+Y +M++  +  N+ L EGVA+RGRLLIAIKT   S+   +  G  V S  P+S+   GK+E +LL  + +EA++I  EIGKK++P+ FELS+GTTG   D  ++      +P   +    +   + HS TEP    T D +YFH+ +  KKPCLYMI+  EDH+ R FIPNIL+KLK E    V  ++ L    ++   +R +K +++TF  +I+  L++IK  R  + KTLLD +  KL ++ LEKM++      +  +   + + +K+  + +K L++ + +PQ+GLPD+F+++IQD  R+A+ RI AR++++SAIP EKG     V TV+L+K   F + P  + + +Q QL++YLWLGLL+DM+ ++ GLP G+  DCF  + PP  I Y E+S FQLR +++M RNLIGSD+SGLSD F ++++ +H+  + V +ET SP WD+T+IID+++F Y+  ++ + PP +V+E+FD D     EF+GR FC+P+V +  +EY S +L WW +YRG M AG++L +F+LI++ P        G P +E ++  ++ +     NS   + E  L                            +P ++RP +  +R+E L WGVR++QR++++S                V++PRI IE G   + SD+I      PNF++ L  + + LP N  +WPP+ I C +   FG   ++GNHVI+++ +Y ++ KI           N    ++ ++L++   +  + A  +GV N A+ +      E T AG  S A+   TN
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITD-----------RKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISR-LLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDT---GFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLR-MKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGP--SGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDD-----ETTAAGNLSSARKSSTN 1295          

HSP 2 Score: 562.762 bits (1449), Expect = 7.511e-166
Identity = 317/721 (43.97%), Postives = 443/721 (61.44%), Query Frame = 1
Query: 3862 VPKEEMESADWWTRYYATLGDLDDPNLYKPEDEIL-VESESEDEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQH-------KSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPP-PIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVY----NPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +PK+E++  DWW+RYY ++ DLDD       D  L V  + E +++ D   G   E   ++E+    +  +   KKKKK KK KKK   K +F          + K L  K+  +    ++ K   ++ IER K+Y C LE +K++ GF    ++F L +G+Q+++++  +  +R  G FKGN+ IY V ++       F  + D  KL  +                        L +   V  +VR+YV++  +LHPAD NGK+DPY+L+R+GNK I ++ENYIPK LNPIFG+CFE++V FPQES LL+QV DWD ++ DD+IGET IDLENR+ S H+  CGL   + NHGY KW+D QLPT +L  LC++    PPKY+ + + V +    F +D+ IE+D+G + +S EPLAL V+ NW  +   C LV EH+ETRPL+  EKPGI+QG LEMW+DMFP     PP PIDI+PR+P SYELR++I  TE+V L+D    T EKS DI++K WMK   ID Q TD H+RSLSG+G FNWRF+F FDY+KAED IVYK K+  + IDE E K+PC L +QV D+DL+ +D  +G L+  LSK P+ AK  ++C   Q     + +  ++FKNK+ RGWWP       +PK+        L++ G ++ E  L+  EE E+ P GLGR EP  L  PNRPD SFLNF+NP  ++KY I
Sbjct: 1433 IPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD--NRIVGNFKGNLNIYKVDDEE------FGVEVDVHKLMLYKS----------------------LPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKE--------LDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 2115          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 501/1342 (37.33%), Postives = 789/1342 (58.79%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP------------------SDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGD----KPKRPNKTDKE-EDPNIEANILIPQ-ILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTT--SQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH------LPKKEENFESQ---YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKK-MNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTD--------EEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVN---DNSKGEKDEEKLR---------------------------IPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKI-----------NEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN 3825
            M+L++ L+ +  +    +  +K+ FRD +  T   + K S   G +F WP+ RKLD +D+L ++    +++  +KL G + I L  L+    I+  E  +D    I  I ++FE+ Y SP S   N  + +F  P  +           R  SD   +  DS    ++                   +D+  V+ G++    +    R   +P  + P   K +D+QIS+T+ EAR L+G NINPL EV  G++ + TE++M TN+P+YN+Y  F+F +S+ EL +Q+IR++ L+  +  ++R + PG +IGEF +D +TVY+   H F +KWA+L+DPK   SG KG+VKVDL+++  G+    KPK   K  K+ +D +IEAN+L+PQ I   T+R + E+ V +Y+AEDLP MNT IM+ IK AI GD K L DP+V+VSFAG+TG TKV   +Y+P+WN++I+FTE FP   +R+R++V D D + +E I+T +IDL +IMN     + GFLPT+GPSW+NLYGTPR Y+Y +M++  +  N+ L EGVA+RGRLLIAIKT   S+   +  G  V S  P+S+   GK+E +LL  + +EA++I  EIGKK++P+ FELS+GTTG   D  ++      +P   +    +   + HS TEP    T D +YFH+ +  KKPCLYMI+  EDH+ R FIPNIL+KLK E    V  ++ L    ++   +R +K +++TF  +I+  L++IK  R  + KTLLD +  KL ++ LEKM++      +  +   + + +K+  + +K L++ + +PQ+GLPD+F+++IQD  R+A+ RI AR++++SAIP EKG     V TV+L+K   F + P  + + +Q QL++YLWLGLL+DM+ ++ GLP G+  DCF  + PP  I Y E+S FQLR +++M RNLIGSD+SGLSD F ++++ +H+  + V +ET SP WD+T+IID+++F Y+  ++ + PP +V+E+FD D  T          EF+GR FC+P+V +  +EY S +L WW +YRG M AG++L +F+LI++ P        G P +E ++  ++ +     NS   + E  L                            +P ++RP +  +R+E L WGVR++QR++++S                V++PRI IE G   + SD+I      PNF++ L  + + LP N  +WPP+ I C +   FG   ++GNHVI+++ +Y ++ KI           N    ++ ++L++   +  + A  +GV N A+ +      E T AG  S A+   TN
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITD-----------RKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISR-LLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG---DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLR-MKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGP--SGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDD-----ETTAAGNLSSARKSSTN 1303          

HSP 2 Score: 563.148 bits (1450), Expect = 6.680e-166
Identity = 317/721 (43.97%), Postives = 443/721 (61.44%), Query Frame = 1
Query: 3862 VPKEEMESADWWTRYYATLGDLDDPNLYKPEDEIL-VESESEDEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQH-------KSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPP-PIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVY----NPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +PK+E++  DWW+RYY ++ DLDD       D  L V  + E +++ D   G   E   ++E+    +  +   KKKKK KK KKK   K +F          + K L  K+  +    ++ K   ++ IER K+Y C LE +K++ GF    ++F L +G+Q+++++  +  +R  G FKGN+ IY V ++       F  + D  KL  +                        L +   V  +VR+YV++  +LHPAD NGK+DPY+L+R+GNK I ++ENYIPK LNPIFG+CFE++V FPQES LL+QV DWD ++ DD+IGET IDLENR+ S H+  CGL   + NHGY KW+D QLPT +L  LC++    PPKY+ + + V +    F +D+ IE+D+G + +S EPLAL V+ NW  +   C LV EH+ETRPL+  EKPGI+QG LEMW+DMFP     PP PIDI+PR+P SYELR++I  TE+V L+D    T EKS DI++K WMK   ID Q TD H+RSLSG+G FNWRF+F FDY+KAED IVYK K+  + IDE E K+PC L +QV D+DL+ +D  +G L+  LSK P+ AK  ++C   Q     + +  ++FKNK+ RGWWP       +PK+        L++ G ++ E  L+  EE E+ P GLGR EP  L  PNRPD SFLNF+NP  ++KY I
Sbjct: 1441 IPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD--NRIVGNFKGNLNIYKVDDEE------FGVEVDVHKLMLYKS----------------------LPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKE--------LDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 2123          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 492/1308 (37.61%), Postives = 774/1308 (59.17%), Query Frame = 1
Query:   55 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEP------------------SDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGD----KPKRPNKTDKE-EDPNIEANILIPQ-ILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTT--SQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSH------LPKKEENFESQ---YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKK-MNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTD--------EEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVN---DNSKGEKDEEKLR---------------------------IPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKINEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDN 3756
            M+L++ L+ +  +    +  +K+ FRD +  T   + K S   G +F WP+ RKLD +D+L ++    +++  +KL G + I L  L+    I+  E  +D    I  I ++FE+ Y SP S   N  + +F  P  +           R  SD   +  DS    ++                   +D+  V+ G++    +    R   +P  + P   K +D+QIS+T+ EAR L+G NINPL EV  G++ + TE++M TN+P+YN+Y  F+F +S+ EL +Q+IR++ L+  +  ++R + PG +IGEF +D +TVY+   H F +KWA+L+DPK   SG KG+VKVDL+++  G+    KPK   K  K+ +D +IEAN+L+PQ I   T+R + E+ V +Y+AEDLP MNT IM+ IK AI GD K L DP+V+VSFAG+TG TKV   +Y+P+WN++I+FTE FP   +R+R++V D D + +E I+T +IDL +IMN     + GFLPT+GPSW+NLYGTPR Y+Y +M++  +  N+ L EGVA+RGRLLIAIKT   S+   +  G  V S  P+S+   GK+E +LL  + +EA++I  EIGKK++P+ FELS+GTTG   D  ++      +P   +    +   + HS TEP    T D +YFH+ +  KKPCLYMI+  EDH+ R FIPNIL+KLK E    V  ++ L    ++   +R +K +++TF  +I+  L++IK  R  + KTLLD +  KL ++ LEKM++      +  +   + + +K+  + +K L++ + +PQ+GLPD+F+++IQD  R+A+ RI AR++++SAIP EKG     V TV+L+K   F + P  + + +Q QL++YLWLGLL+DM+ ++ GLP G+  DCF  + PP  I Y E+S FQLR +++M RNLIGSD+SGLSD F ++++ +H+  + V +ET SP WD+T+IID+++F Y+  ++ + PP +V+E+FD D  T          EF+GR FC+P+V +  +EY S +L WW +YRG M AG++L +F+LI++ P        G P +E ++  ++ +     NS   + E  L                            +P ++RP +  +R+E L WGVR++QR++++S                V++PRI IE G   + SD+I      PNF++ L  + + LP N  +WPP+ I C +   FG   ++GNHVI+++ +Y ++ KI  + D E+    +L++      N +       DN
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITD-----------RKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISR-LLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG---DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLR-MKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGP--SGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTE-DDETTAAGNLSSARKSSTNFNSNVQALLDN 1273          

HSP 2 Score: 559.681 bits (1441), Expect = 5.653e-165
Identity = 315/721 (43.69%), Postives = 443/721 (61.44%), Query Frame = 1
Query: 3862 VPKEEMESADWWTRYYATLGDL-DDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFQH-------KSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDXXXXXXXXXXXXXXXXXXXFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPP-PIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVY----NPKXXXXXXXNGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFI 5976
            +PK+E++  DWW+RYY ++ DL DD      +  + V  + E +++ D   G   E   ++E+    +  +   KKKKK KK KKK   K +F          + K L  K+  +    ++ K   ++ IER K+Y C LE +K++ GF    ++F L +G+Q+++++  +  +R  G FKGN+ IY V ++       F  + D  KL  +                        L +   V  +VR+YV++  +LHPAD NGK+DPY+L+R+GNK I ++ENYIPK LNPIFG+CFE++V FPQES LL+QV DWD ++ DD+IGET IDLENR+ S H+  CGL   + NHGY KW+D QLPT +L  LC++    PPKY+ + + V +    F +D+ IE+D+G + +S EPLAL V+ NW  +   C LV EH+ETRPL+  EKPGI+QG LEMW+DMFP     PP PIDI+PR+P SYELR++I  TE+V L+D    T EKS DI++K WMK   ID Q TD H+RSLSG+G FNWRF+F FDY+KAED IVYK K+  + IDE E K+PC L +QV D+DL+ +D  +G L+  LSK P+ AK  ++C   Q     + +  ++FKNK+ RGWWP       +PK+        L++ G ++ E  L+  EE E+ P GLGR EP  L  PNRPD SFLNF+NP  ++KY I
Sbjct: 1400 IPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD--NRIVGNFKGNLNIYKVDDEE------FGVEVDVHKLMLYKS----------------------LPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKE--------LDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 2082          
The following BLAST results are available for this feature:
BLAST of Otoferlin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTOF5.471e-14530.71otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF4.174e-14530.71otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
FER1L69.417e-16430.27fer-1 like family member 6 [Source:HGNC Symbol;Acc... [more]
OTOF2.573e-14944.59otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF4.120e-14944.48otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
back to top
BLAST of Otoferlin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer-11.939e-2828.68Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-12.181e-2828.68Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-12.181e-2828.68Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
snt-58.502e-835.71SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
snt-59.012e-835.71SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
back to top
BLAST of Otoferlin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfr1.642e-9337.34gene:FBgn0266757 transcript:FBtr0273291[more]
mfr8.961e-8937.34gene:FBgn0266757 transcript:FBtr0273287[more]
mfr3.414e-8837.34gene:FBgn0266757 transcript:FBtr0273290[more]
mfr8.227e-8837.34gene:FBgn0266757 transcript:FBtr0273289[more]
mfr5.329e-8637.75gene:FBgn0266757 transcript:FBtr0273285[more]
back to top
BLAST of Otoferlin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa2.558e-14830.32otoferlin a [Source:NCBI gene;Acc:557476][more]
otofa1.152e-14830.32otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb1.478e-14733.12otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l64.951e-14543.80fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l62.921e-14431.20fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Otoferlin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2v24.781e-17529.59ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v24.705e-16432.62ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v22.725e-16331.84ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
FER1L62.235e-15830.90fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
FER1L61.429e-15330.22fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Otoferlin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otof1.760e-14330.47otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Otof6.759e-14433.43otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Fer1l67.460e-16131.46fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l67.460e-16131.46fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l42.142e-15027.70fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Otoferlin vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SPC5|OTOF_DANRE8.695e-14830.32Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1[more]
sp|Q9HC10|OTOF_HUMAN2.627e-14430.71Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=... [more]
sp|Q9ESF1|OTOF_MOUSE1.351e-14230.47Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV... [more]
sp|Q9ERC5|OTOF_RAT3.819e-17933.33Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE... [more]
sp|Q2WGJ9|FR1L6_HUMAN4.522e-16330.27Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FE... [more]
back to top
BLAST of Otoferlin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182199210.000e+036.91tr|A0A267FNI5|A0A267FNI5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183096830.000e+036.79tr|A0A267FMI5|A0A267FMI5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|161766680.000e+036.48tr|A0A4V3SFZ3|A0A4V3SFZ3_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|182154990.000e+035.50tr|A0A1I8H3R8|A0A1I8H3R8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|176858620.000e+035.20tr|A0A5N4AHX3|A0A5N4AHX3_PHOPY Uncharacterized pro... [more]
back to top
BLAST of Otoferlin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa4.564e-14531.07otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb3.935e-17933.59otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l68.769e-14530.75fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l44.928e-11437.45fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
myof3.079e-10437.54myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
back to top
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008905.13.724e-18033.78pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 ge... [more]
ENSPMAT00000004363.11.185e-15933.95pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 ge... [more]
ENSPMAT00000001654.11.142e-15544.79pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 ge... [more]
ENSPMAT00000001770.18.631e-7429.75pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 ge... [more]
ENSPMAT00000002265.15.737e-6236.97pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gen... [more]
back to top
BLAST of Otoferlin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otoferlin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474153.949e-16932.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430884.207e-9334.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341415.249e-8239.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368632.128e-7530.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368653.791e-7041.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otoferlin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa3.638e-14632.34otoferlin [Source:NCBI gene;Acc:101155482][more]
otofb1.444e-17332.85otoferlin-like [Source:NCBI gene;Acc:101160130][more]
ENSORLT00000022822.22.806e-11138.90pep primary_assembly:ASM223467v1:21:28315623:28320... [more]
myof5.581e-7128.19myoferlin [Source:NCBI gene;Acc:101172285][more]
myofl1.117e-6431.46myoferlin [Source:NCBI gene;Acc:101156429][more]
back to top
BLAST of Otoferlin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010400.10.000e+0100.00SMESG000010400.1[more]
SMESG000010367.10.000e+061.26SMESG000010367.1[more]
SMESG000037807.17.511e-16637.48SMESG000037807.1[more]
SMESG000037807.16.680e-16637.33SMESG000037807.1[more]
SMESG000037807.15.653e-16537.61SMESG000037807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007867 ID=SMED30007867|Name=Otoferlin|organism=Schmidtea mediterranea sexual|type=transcript|length=6169bp
CAGATCTAGTCGAAATTGAGCATTGTTTTAATTGATGGTTTTTGTTTTAT
AGAAATGTCTCTCATCGTGACTCTGCAAAGTTTGACTGGAGTCAAACAGG
GACAGGAAGGATTTATCAAAGTCATTTTCCGAGATCACCAATTTAGAACT
CCGAATTTCAAGACAAAACCGAGCACAAATCTTGGGAGCCGATTTGTCTG
GCCGATTGCGAGGAAACTTGACAAGGTAGATTCCCTGGTGATAAAGTTTA
TCCTGCTCAATAGATTCGGACCTGATAAGTTGACAGGAGTTATCAACATC
GTTTTGTCAACTTTGATGGTCCAGCAGTGTATTAATTTGGACGAAACCTT
TGTCGACGAGCAGATGAGGATAACAGATATCGCGCTCAATTTCGAAATTG
AATATAACTCGCCAGTTTCCGGTAACGAGAATCTCGGCAAATCAGATTTT
AATGTTCCATCGTATAACTTGACAAAATTGGAACGACACGAAGGCCATAT
TCGTTTACCATCCGACACTTCGAGTGTCGAAAGTGACTCTGACAATGGTG
ATAATGAGCCTTCTGATGATATAGATGTCAAAGATGGTGACAACTATTCC
GAACTCTCCCTTCTTCCTGAAAGGGATTTTAAGCTTCCTAAGCACATTGA
TCCTCTATCGTTAAAAATTAAAGACTTTCAGATTTCCGTAACAATCTACG
AAGCCCGCGGATTGAGCGGGAAAAATATCAATCCGCTATTCGAGGTATAT
TGCGGCAAACAGAAGCAGTGCACCGAGTTGAAAATGCAAACGAATACTCC
GTTTTATAATGAGTATTTCTCATTTGACTTTCGGATTTCGAGACTGGAGT
TAATGGAACAAATCATAAGGATAAAGGCCTTGAGTAAGAAATCTCACATA
GTCACTAGGCACATTTTCCCAGGAAAGGTTATTGGAGAATTTTCCATTGA
TGCCAAAACCGTTTACAGCAACGAAAGCCATTCCTTTTTTTATAAATGGG
CGGTGCTGATAGATCCTAAAGCTCCAACCTCAGGAGAAAAAGGATGGGTG
AAAGTTGATCTTTCAGTTCTTTGTGCTGGTGACAAGCCGAAACGACCTAA
TAAAACAGACAAAGAAGAAGATCCGAATATCGAAGCAAATATTCTCATTC
CACAAATCCTATGCCAGACTCAAAGAAGCATCTGTGAAATGTCAGTCTAT
GTCTATCAAGCAGAGGACTTGCCATGTATGAATACGAAAATCATGTCAAA
CATTAAGCAAGCTATTTTGGGCGATGGAAAGGCATTAGCTGATCCTTATG
TTGAAGTTTCCTTTGCTGGATATACTGGTAGTACAAAAGTGATTAGTCGA
TCATATTCTCCTGATTGGAATCAGCAGATAATATTTACTGAGAGATTCCC
TCCTTATGTCAGCAGGCTACGTATCGCCGTCCGTGATAGTGACATGATCA
AGGATGAGACCATTTCAACTGTTTTCATTGACTTGCATAAAATCATGAAC
TCCGCCAATAAAGAAGAAGAAGGATTTTTACCCACCTACGGGCCTAGTTG
GATTAATCTTTATGGGACACCGAGAACGTACAGTTATGCAGAAATGATAA
AAGGTGATCAAGGTCAGAATCAAAACCTAGCCGAAGGAGTGGCATTTAGA
GGTCGCCTTTTAATTGCCATTAAAACTACAAGTCAACCGGACAGCATCAA
AATTGGAGTCGATGTAAGGTCTTGCAATCCAGTTTCCAATAATGTCGCAG
GGAAGCGAGAACTGTATTTGCTGTTTGCGTCTATTTTCGAAGCAACTTTA
ATTACCCAAGAAATTGGAAAAAAGAGGAAACCTTTGACGTTTGAACTGTC
AATTGGTACAACTGGCATTTGTCCTGATGAATATTCCCATCTCCCAAAAA
AAGAAGAAAACTTCGAGAGCCAATATGTCCATAGCCTAACTGAGCCGAAG
TATGCGTATACATTTGATAACCAATATTTCCATATACCGTACCGGAGTAA
GAAACCCTGCCTCTATATGATTGCTCCAAGCGAAGACCACAGACCAAGAT
TATTCATTCCAAATATTCTCGATAAGCTAAAACAAGAATTATGTGAATAT
GTCCGTCAAGTCAACTATTTAGCTAGTCGAGGTAAAAAAGTCCAGGCTAT
GCGCTATATAAAAAAATCCATGGAAACGTTTTTCATCAGTATTGATAAGG
TCTTGTCTGCCATTAAATCTTGTCGAGGAACCGCAAAGAAAACTCTGCTC
GATGTCAAGTATCAAAAACTGATTCGTATGGGCTTGGAAAAGATGAAGAT
GTCGTGGTCAGTTACAATTGAATGCTTGTCTGTCTGTACCATCGATATGG
CCATTAAGGACCTTAATTCCTTTGTGAAATTCTTGGATGACAAAATGCTT
GATCCTCAGCACGGTCTCCCTGATGTATTTCTATATATGATCCAAGATAA
CATCCGAGTGGCCTATACTCGAATCCTTGCAAGGGATTTAATCCATTCGG
CAATACCTCCTGAAAAGGGACAAATGTGCGGAATGGTGAATACAGTATAC
CTAAAGAAAATGAACTTTTCCATTCTGCCACAGAAAACCAATTACAACAT
TCAAGCGCAACTGCAAATATATCTCTGGCTCGGACTTTTAAAAGACATGA
GACTGTATAAAATGGGTCTGCCAGAAGGATTTCATAAAGATTGTTTCACT
TCTAAAATGCCCCCGAAAATAATCGACTACATGGAAGAAAGTGATTTCCA
ACTGCGAGTCTACCTGTATATGGGGAGGAATTTGATCGGTTCCGACGATT
CCGGATTGTCAGATCCATTCGTAAAGGTTATCATTGGAGAGCACATTAGG
AAGTCAACGGTATTTCACGAGACTCGCAGTCCAATTTGGGACGAAACTAT
CATTATTGATAATATAGTTTTTAATTATAATCCGAAAATTGTCAAAACGT
GCCCCCCTGATGTGGTCCTGGAGATATTTGATTGGGATTCAGATACTGAT
GAAGAATTCATTGGGAGAGTTTTCTGTCGGCCGTCAGTTTTTATCAGAGG
CGATGAATATACATCCTCCAAATTGCAATGGTGGAATGTTTATAGGGGGA
CCATGCCAGCTGGGGATATCTTGGTGTCGTTCGATTTGATTGAGATTGAT
CCATTTTCCAAAAGGATTTACGTTCCTGGTTTCCCATCTTTAGAGAATTT
GATGGAAATGACTGCACAAGTCAATGATAACTCAAAGGGTGAAAAGGATG
AAGAAAAACTGAGGATTCCATTTGATGTTAGACCTCCGATTGGTCTATTT
AGGTTAGAACTTTTGATATGGGGAGTCCGGCAGTTACAAAGGATCGAGAT
AATTTCACCGAAGCGACACGCAGTTATCCCTATTAAACGTATGGGAATAT
TTCCGGTAAATCAGCCTCGAATCATCATTGAAATCGGTGGGTACCGAATA
AAGTCAGACATTATCGAGGACTGGTGGACTCATCCAAATTTCAATGACAA
TTTAATATCGGTGATTCTGAGGTTGCCTGTCAACTCGAAATTCTGGCCAC
CGATGTCCATTAATTGCATCAATTATACAATGTTCGGACTGAAACAGGTT
GTTGGAAATCACGTCATAACTGACCTAATTGAATACTACGTAGAGGATAA
AATAAATGAAGATCTGGATCATGAGTCTGACCATTTGCAAAGTTTAACTG
CACAATTTGATATGAAAGCTAATTCAGATGGTGTGTCAAATAAAGCTTTT
GACAATAAAGATGAGAAGGGTCCAGAAAAGACAAAAGCGGGTGTGAAATC
GGATGCAAAACCGGATGTAACTAATCCAGTTCCAGGAGAACCGGAAAAGC
TAATCCGTTTCGTACCAAAAGAAGAGATGGAATCGGCCGACTGGTGGACA
CGATACTATGCCACACTCGGAGACCTTGATGATCCCAATTTATATAAACC
AGAGGATGAAATACTTGTTGAAAGCGAAAGTGAAGATGAAATACGGAGGG
ACATTTTTCTAGGTTATCGAGTGGAAACGCATAGCGAAGACGAAGAAGAT
GAGGTTGTAGAAATTCCTGAAGACATTCCAAAAAAGAAGAAAAAAAAGAA
AAAGAAGAAAAAGAAAAAGAAAAAGAAACGCTTATTTCAACATAAAAGCA
CTAAAGAATTATTTTTGAAAGAAGTTCAAGAGCATTTAATCTTGGAAGAT
GAGAAACTTTCTGATAACTCTTGGATTGAACGAATAAAGATTTACAGTTG
CGAACTGGAAAATATTAAAGACTACGGAGGATTTAAGCAGCCTTTTAGGT
CGTTTTCTTTATATAGAGGAAAACAAGAAGAGGAAGATGATGGTTATGAA
ATTCAAGATAGATTTGCTGGAGTATTTAAAGGCAATATCTGCATATACAA
TGTGCAGGAAGACAATATACACGAAAAGGATTTATTCGACGAAGATCATG
ATGAAAGTAAACTGGCCAGTTTTGGAGAACAAGATGAAAATAAAACCGAA
GAAGAATTATTGAATGAAAAATCAAATTTGAAATTATATAAATTTCTTTC
TGATCCCCATTCCGTAGACTTTATAGTTAGAGTCTATGTAGTAAAGGGAA
TCAATCTCCATCCTGCAGATATCAACGGCAAAGCAGATCCGTATATTTTA
GTTCGGATTGGAAATAAAGAAATACGAGACCGAGAAAATTACATACCGAA
AACACTAAATCCAATATTTGGAAGGTGTTTCGAAATGGAAGTGACTTTTC
CTCAAGAAAGCTTCCTTCTAGTGCAGGTTTATGATTGGGATCGACTCACA
AAAGATGACTTAATTGGAGAGACGACAATAGACTTAGAAAATCGCTGGCT
AAGTCCACATCGTGGAACTTGTGGTTTGATGTCGACATATAATAACCACG
GATACATGAAATGGAAAGATTCCCAACTACCAACCGCCATATTGAAGTCG
TTATGTGAAAAGAATAATATCCCTCCACCGAAATACGACAAGATGAATGA
CACTGTGGAAATCATGGGTAAAACATTCAATTCCGATTCAATGATAGAAG
ATGATGACGGATCTCAAATCAAGTCTCTAGAGCCGTTAGCTCTTGTTGTT
CTCCACAACTGGGAAGACATTGTACCGGAATGTAAACTCGTAAAAGAACA
TATTGAAACTCGGCCTCTTTATCTACAAGAAAAACCGGGAATCGAGCAAG
GATTGCTGGAAATGTGGGTGGACATGTTTCCCAGCGGCACGGCCATTCCT
CCTCCCATTGATATTTCCCCAAGGAAGCCGGCCAGTTATGAACTCAGGAT
TGTGATACTACAAACAGAAAACGTCCGACTCACAGACACAAATTTCTTTA
CAAAAGAAAAAAGTGTCGACATCTATTTGAAGGCGTGGATGAAATCTACA
GACATCGACCTTCAGAAAACGGATACTCATTTTCGATCTCTTTCCGGTCA
AGGTCTTTTCAACTGGCGTTTTGTTTTCCAATTTGACTACCTGAAAGCAG
AAGACTCGATTGTATATAAAAACAAGAACATTTATGAGATCGACGAAAAC
GAGTATAAGACTCCTTGCTTTTTAAATATGCAAGTTCTGGATTCGGATCT
GTTAATGTCCGACACCATAATTGGAAGACTGAAATTCCGGCTCAGCAAAT
TCCCTAAGCCTGCAAAGTACTATAAATCCTGCGATCCTTTCCAACATTCG
GATGCCTGTGCTAAATTCAATTTGTTTAAGAACAAAAAAGTCAGAGGTTG
GTGGCCACTGGTTTACAATCCAAAGGATGAAGACGAAGAGGAAGAAAATG
GATTGGAAATCGGTGGAACAGTTGAAATGGAAATGGATCTCGTTTTAGGT
GAGGAAGCAGAATCAAATCCAGCCGGCCTTGGACGTGAGGAGCCGTTGCC
ACTTGAAAAGCCTAACCGACCAGATGGCTCCTTCCTAAACTTCCTGAACC
CTTGGAACACGATAAAATACTTTATCAAATACCGACTGAAATGGATTCTG
ATCAAAATCTTGATCGTATTAATATTTGTTTTAATAATTGTGCTTTTTAT
TTACAATTTCCCCGGAAACTTTTCTCGAGTGATTGTTGATAAAATTACAG
GGGGGTAACAATGGCAATAAAGCTCGAGGGGAAATTTCTTATTTCACCTT
TCAGAGCTGGTTTCAGAGA
back to top

protein sequence of SMED30007867-orf-1

>SMED30007867-orf-1 ID=SMED30007867-orf-1|Name=SMED30007867-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2018bp
MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWP
IARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFV
DEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIR
LPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDP
LSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPF
YNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDA
KTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNK
TDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNI
KQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPP
YVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWI
NLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKI
GVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSI
GTTGICPDEYSHLPKKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKK
PCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMR
YIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMS
WSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNI
RVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQ
AQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQL
RVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETII
IDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGD
EYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLM
EMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEII
SPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNL
ISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKI
NEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSD
AKPDVTNPVPGEPEKLIRFVPKEEMESADWWTRYYATLGDLDDPNLYKPE
DEILVESESEDEIRRDIFLGYRVETHSEDEEDEVVEIPEDIPKKKKKKKK
KKKKKKKKRLFQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCE
LENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNV
QEDNIHEKDLFDEDHDESKLASFGEQDENKTEEELLNEKSNLKLYKFLSD
PHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKT
LNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLS
PHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDT
VEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHI
ETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIV
ILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQG
LFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLL
MSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWW
PLVYNPKDEDEEEENGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPL
EKPNRPDGSFLNFLNPWNTIKYFIKYRLKWILIKILIVLIFVLIIVLFIY
NFPGNFSRVIVDKITGG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000096ventral epidermis
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR037721Ferlin
IPR037723C2D_Ferlin
IPR037725C2F_Ferlin
IPR037722C2C_Ferlin
IPR037724C2E_Ferlin
IPR012968FerIin_dom
IPR000008C2_dom
IPR012561Ferlin_B-domain
IPR032362Ferlin_C
IPR007526SWIRM
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 1746..1875
e-value: 1.6
score: 15.4
coord: 378..489
e-value: 1.9E-10
score: 50.7
coord: 209..312
e-value: 4.4E-6
score: 36.2
coord: 1507..1606
e-value: 3.3E-11
score: 53.2
coord: 899..1005
e-value: 7.2E-11
score: 52.1
IPR000008C2 domainPFAMPF00168C2coord: 209..310
e-value: 2.2E-7
score: 31.1
coord: 899..994
e-value: 2.4E-10
score: 40.6
coord: 1508..1596
e-value: 1.5E-17
score: 63.8
coord: 1747..1870
e-value: 0.38
score: 11.1
coord: 379..487
e-value: 3.4E-15
score: 56.2
IPR000008C2 domainPROSITEPS50004C2coord: 1508..1591
score: 14.082
IPR000008C2 domainPROSITEPS50004C2coord: 899..990
score: 12.78
IPR000008C2 domainPROSITEPS50004C2coord: 378..474
score: 12.114
IPR012968FerIin domainSMARTSM01202FerI_2coord: 298..369
e-value: 2.2E-19
score: 80.4
IPR012968FerIin domainPFAMPF08151FerIcoord: 320..367
e-value: 3.2E-10
score: 39.9
IPR012561Ferlin B-domainSMARTSM01201FerB_2coord: 784..861
e-value: 1.3E-23
score: 94.4
IPR012561Ferlin B-domainPFAMPF08150FerBcoord: 784..860
e-value: 7.8E-20
score: 71.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1738..1878
e-value: 8.5E-11
score: 43.6
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 367..502
e-value: 3.4E-17
score: 64.5
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 885..1028
e-value: 1.0E-18
score: 69.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1505..1622
e-value: 4.6E-24
score: 87.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1..122
e-value: 2.2E-11
score: 45.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 207..341
e-value: 4.0E-12
score: 48.3
IPR032362Ferlin, C-terminal domainPFAMPF16165Ferlin_Ccoord: 1921..2010
e-value: 1.6E-21
score: 76.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1228..1259
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1230..1249
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 150..175
NoneNo IPR availablePANTHERPTHR12546:SF33MISFIRE, ISOFORM Fcoord: 206..2013
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1716..1873
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1500..1623
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 375..504
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 896..1030
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 200..335
NoneNo IPR availableTMHMMTMhelixcoord: 1980..2002
IPR037721Ferlin familyPANTHERPTHR12546FER-1-LIKEcoord: 206..2013
IPR037723Ferlin, fourth C2 domainCDDcd04017C2D_Ferlincoord: 898..1032
e-value: 1.18836E-48
score: 167.72
IPR037725Ferlin, sixth C2 domainCDDcd08374C2F_Ferlincoord: 1746..1876
e-value: 1.13685E-44
score: 156.284
IPR037722Ferlin, third C2 domainCDDcd04018C2C_Ferlincoord: 379..533
e-value: 1.05974E-59
score: 200.167
IPR037724Ferlin, fifth C2 domainCDDcd04037C2E_Ferlincoord: 1507..1630
e-value: 2.77697E-62
score: 206.247