slc18a-2

Overview
Nameslc18a-2 (AKN21537.1)
Smed IDSMED30007849
Length (bp)1613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc18a-2 (SMED30007849) t-SNE clustered cells

Violin plots show distribution of expression levels for slc18a-2 (SMED30007849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc18a-2 (SMED30007849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc18a-2 (SMED30007849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30007849SMESG000076103.1 dd_Smed_v4_11708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007849SMESG000076103.1 dd_Smed_v6_11708_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007849SMESG000076103.1 dd_Smed_v4_11708_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc18a-2 vs. Ensembl Human
Match: SLC18A2 (solute carrier family 18 member A2 [Source:HGNC Symbol;Acc:HGNC:10935])

HSP 1 Score: 55.8398 bits (133), Expect = 1.244e-7
Identity = 44/184 (23.91%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LLKDP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G++I G   +CI F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  273 SRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR-WLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 448          
BLAST of slc18a-2 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 51.6026 bits (122), Expect = 2.597e-6
Identity = 44/184 (23.91%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            SK   E  K      LLKDP+++V    + F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +C+  +        P   +G+ +G       M +  ++P++  ++D++++  YGS   +  + F +   IG    G +V+  G
Sbjct:  281 SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGR-WLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIG-------MVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIG 456          
BLAST of slc18a-2 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 51.6026 bits (122), Expect = 2.597e-6
Identity = 44/184 (23.91%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            SK   E  K      LLKDP+++V    + F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +C+  +        P   +G+ +G       M +  ++P++  ++D++++  YGS   +  + F +   IG    G +V+  G
Sbjct:  281 SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGR-WLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIG-------MVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIG 456          
BLAST of slc18a-2 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 50.0618 bits (118), Expect = 8.005e-6
Identity = 41/172 (23.84%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIG 1474
            SK   E  K      LLKDP+++V    + F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +C+  +        P   +G+ +G       M +  ++P++  ++D++++  YGS   +  + F +   IG
Sbjct:  281 SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGR-WLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIG-------MVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIG 444          
BLAST of slc18a-2 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 50.0618 bits (118), Expect = 8.005e-6
Identity = 41/172 (23.84%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIG 1474
            SK   E  K      LLKDP+++V    + F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +C+  +        P   +G+ +G       M +  ++P++  ++D++++  YGS   +  + F +   IG
Sbjct:  281 SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGR-WLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIG-------MVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIG 444          
BLAST of slc18a-2 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710625:-1 gene:WBGene00000295.1 transcript:W01C8.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.352e-7
Identity = 34/152 (22.37%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  140 ITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASK 595
            + T  PA  ++  E  +  +AS         NV+V ++ GSK   +L++ P +G +T+R      +F G +I   + +++   D++++  LAR +  +G +  STSG+ ++   Y ++  R   +      + +     P   G +++ + K
Sbjct:  134 VETEEPAVRTISEEERHKLLAS--------ENVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGK 277          
BLAST of slc18a-2 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710585:-1 gene:WBGene00000295.1 transcript:W01C8.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 52.373 bits (124), Expect = 5.338e-7
Identity = 34/152 (22.37%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  140 ITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASK 595
            + T  PA  ++  E  +  +AS         NV+V ++ GSK   +L++ P +G +T+R      +F G +I   + +++   D++++  LAR +  +G +  STSG+ ++   Y ++  R   +      + +     P   G +++ + K
Sbjct:   71 VETEEPAVRTISEEERHKLLAS--------ENVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGK 214          
BLAST of slc18a-2 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 52.7582 bits (125), Expect = 7.064e-7
Identity = 42/162 (25.93%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  C+ + Q G  +L    S +       +   K    W+  MVG+ I G   +C+ F+K  + +    G + F   M +  +  ++  ++DI++   YGS   +  +   +   +G    G LV   G
Sbjct:  285 LLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGR-WLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIG 445          
BLAST of slc18a-2 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 52.7582 bits (125), Expect = 7.247e-7
Identity = 42/162 (25.93%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  C+ + Q G  +L    S +       +   K    W+  MVG+ I G   +C+ F+K  + +    G + F   M +  +  ++  ++DI++   YGS   +  +   +   +G    G LV   G
Sbjct:  301 LLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGR-WLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIG 461          
BLAST of slc18a-2 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 52.7582 bits (125), Expect = 7.696e-7
Identity = 42/162 (25.93%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  C+ + Q G  +L    S +       +   K    W+  MVG+ I G   +C+ F+K  + +    G + F   M +  +  ++  ++DI++   YGS   +  +   +   +G    G LV   G
Sbjct:  284 LLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGR-WLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIG 444          
BLAST of slc18a-2 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 52.7582 bits (125), Expect = 8.195e-7
Identity = 42/162 (25.93%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  C+ + Q G  +L    S +       +   K    W+  MVG+ I G   +C+ F+K  + +    G + F   M +  +  ++  ++DI++   YGS   +  +   +   +G    G LV   G
Sbjct:  278 LLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGR-WLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIG 438          
BLAST of slc18a-2 vs. Ensembl Zebrafish
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 50.447 bits (119), Expect = 4.526e-6
Identity = 39/178 (21.91%), Postives = 82/178 (46.07%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGP 1492
            SK   E +K  S   L+KDP++++    + F ++    LE  LPI+M++  C  + Q G  ++    S +       +   K    W+  ++G+++ G   +C+  +K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +      F +GP
Sbjct:  321 SKVEPESQKGTSLITLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCPRKWQLGIAFVPASISYLIGTNIFAVLAHKMGR-WLCSLIGMLLVGISILCVPLAKDIYGLIVPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMG-----FALGP 485          

HSP 2 Score: 49.2914 bits (116), Expect = 9.367e-6
Identity = 46/186 (24.73%), Postives = 81/186 (43.55%), Query Frame = 2
Query:  143 TTVFPAYSSVKTEIENVSIASTNCSNDNPS------------NVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAV 664
            TT    +S   +    +S+A T  S  N S            NV V +L  SK   +LI  P +G +T+R      +F G  I   + +++  S ++    LAR +  +G S  S +G+ ++ ++Y ++  R      ++I + + G    ++ G  F S          ++ FV     F+ILAV
Sbjct:  134 TTRVTGFSPQMSTAGPMSLAPTFVSPQNQSDCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFVSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERG-----NAIGIALGGLAMGVLVGPPFGSV---------MYEFVGKTAPFLILAV 305          
BLAST of slc18a-2 vs. Ensembl Xenopus
Match: gtf2e1.2 (general transcription factor IIE, polypeptide 1, alpha 56kDa, gene 2 [Source:Xenbase;Acc:XB-GENE-6001963])

HSP 1 Score: 53.9138 bits (128), Expect = 4.046e-7
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  233 NVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFES 586
            NV V +L  SK   +L++ P+VG IT+R      LF G +I   + +++  S ++    +AR I  IG S  S +GL ++ ++Y+++  R + +      + + G    ++AGA F S
Sbjct:  103 NVQVGLLFASKAIVQLLVNPLVGLITNRFGFDAPLFAGFVILFLSTLMFAFSGSYALLFVARSIQGIGSSFSSVAGLGLLASVYMDDFERGQAMG-----IALTGLAVGVLAGAPFGS 215          
BLAST of slc18a-2 vs. Ensembl Xenopus
Match: gtf2e1.2 (general transcription factor IIE, polypeptide 1, alpha 56kDa, gene 2 [Source:Xenbase;Acc:XB-GENE-6001963])

HSP 1 Score: 53.9138 bits (128), Expect = 4.107e-7
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  233 NVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFES 586
            NV V +L  SK   +L++ P+VG IT+R      LF G +I   + +++  S ++    +AR I  IG S  S +GL ++ ++Y+++  R + +      + + G    ++AGA F S
Sbjct:  102 NVQVGLLFASKAIVQLLVNPLVGLITNRFGFDAPLFAGFVILFLSTLMFAFSGSYALLFVARSIQGIGSSFSSVAGLGLLASVYMDDFERGQAMG-----IALTGLAVGVLAGAPFGS 214          
BLAST of slc18a-2 vs. Ensembl Xenopus
Match: gtf2e1.2 (general transcription factor IIE, polypeptide 1, alpha 56kDa, gene 2 [Source:Xenbase;Acc:XB-GENE-6001963])

HSP 1 Score: 53.9138 bits (128), Expect = 5.488e-7
Identity = 41/144 (28.47%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  155 PAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFES 586
            P  SS K E +  ++ S         NV V +L  SK   +L++ P+VG IT+R      LF G +I   + +++  S ++    +AR I  IG S  S +GL ++ ++Y+++  R + +      + + G    ++AGA F S
Sbjct:   85 PTNSSNKCEKKKHTLHS--------ENVQVGLLFASKAIVQLLVNPLVGLITNRFGFDAPLFAGFVILFLSTLMFAFSGSYALLFVARSIQGIGSSFSSVAGLGLLASVYMDDFERGQAMG-----IALTGLAVGVLAGAPFGS 215          

HSP 2 Score: 52.373 bits (124), Expect = 1.276e-6
Identity = 34/142 (23.94%), Postives = 69/142 (48.59%), Query Frame = 2
Query: 1022 KLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGS 1426
            +LL+DP+++V    L   ++    LE TLPI+M++  CS   Q G  +L    + +       +   K    W+  M+G+++ G   +C+  ++       P   IG+ LG       M +  ++P++  ++D++++  YG 
Sbjct:  262 ELLRDPYILVAAACLWIANMAVGMLEPTLPIWMMETMCSPDWQLGIAFLPASVAYLICTNLFGILSHKMGR-WLCSMLGMIVVGGGLLCVPLARNIYGLIGPNAAIGIALG-------MVDSSIMPIMGYLVDLRHTSVYGG 395          
BLAST of slc18a-2 vs. Ensembl Xenopus
Match: ENSXETT00000009730.1 (chromaffin granule amine transporter [Source:NCBI gene;Acc:100496053])

HSP 1 Score: 51.9878 bits (123), Expect = 2.062e-6
Identity = 38/144 (26.39%), Postives = 65/144 (45.14%), Query Frame = 2
Query:  164 SSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASK 595
            +S K  ++      TN   D   NV V +LI SK    +++ PIV   T+R      +F G LI   +  ++    ++   +LAR++  IG S    +GL ++ +IY ++  R K +      V +     P    A++E   K
Sbjct:  101 NSTKGLLKEPCRKDTNFLRDE--NVPVGLLIASKSMVHILVNPIVSLFTNRVGYGLPMFFGFLIMLMSIFMFAFGGSYVFLLLARMLQGIGSSFTVVAGLGMVASIYTDDYQRGKAMGIALGGVVLGVVAGPPFGSALYEFVGK 242          

HSP 2 Score: 50.0618 bits (118), Expect = 7.086e-6
Identity = 43/161 (26.71%), Postives = 75/161 (46.58%), Query Frame = 2
Query: 1013 SAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFS-------KPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIG 1474
            S   LLKDP+++V    L   S+    LE TLPI+M+   CS   Q G V+L    S +       +   K    W+  ++G+V+ G   +C+  +        P   IGV LG       + +  ++P++  ++D+++S  YG    ++ + F+    IG
Sbjct:  277 SFCSLLKDPYILVAAGCLCIASMGIGMLEPTLPIWMLGSMCSPDWQIGLVFLPASLSYLVCTNVFGILSHKFGR-WLCSLLGMVLLGICLLCMPLAFNILGLIAPIAGIGVSLG-------IVDSSIMPIMGYLVDLRHSSVYGGVYAISDIAFSFGYAIG 429          
BLAST of slc18a-2 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 51.6026 bits (122), Expect = 2.134e-6
Identity = 46/182 (25.27%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  959 IDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFS-KPWWVIG--VCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPL 1495
            +D+  T  KN            LL DP+++V    L   +L    LETTLPI M++  C+ + Q G  +L    +             K    W+  M+G++I G   IC+  +   +++IG    LG  F    M E  ++P++  ++D++++ +YG    ++ +   I      + +GPL
Sbjct:  218 VDVPATPYKN------------LLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAYFICLNVFAELAQKIGR-WLCIMLGMLILGISVICMPLALNIYYLIGPSAALGIGF---GMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIG-----YALGPL 378          
BLAST of slc18a-2 vs. Ensembl Mouse
Match: Slc18a2 (solute carrier family 18 (vesicular monoamine), member 2 [Source:MGI Symbol;Acc:MGI:106677])

HSP 1 Score: 54.6842 bits (130), Expect = 2.311e-7
Identity = 43/184 (23.37%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LLKDP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +CI F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  276 SRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR-WLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 451          
BLAST of slc18a-2 vs. Ensembl Mouse
Match: Slc18a1 (solute carrier family 18 (vesicular monoamine), member 1 [Source:MGI Symbol;Acc:MGI:106684])

HSP 1 Score: 49.6766 bits (117), Expect = 8.107e-6
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKP-WWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGP 1492
            LLKDP+++V    +   ++    LE TLPI+M++  CS + Q G  +L    + +       +   K    W+  +VG+V  G   +C+  +   + +IG   G  F    M +  L+P++  ++D++++  YGS   +  + F +      F IGP
Sbjct:  293 LLKDPYILVAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKMGR-WLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAI-GMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVG-----FAIGP 442          
BLAST of slc18a-2 vs. UniProt/SwissProt
Match: sp|Q05940|VMAT2_HUMAN (Synaptic vesicular amine transporter OS=Homo sapiens OX=9606 GN=SLC18A2 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 5.972e-7
Identity = 44/184 (23.91%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LLKDP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G++I G   +CI F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  273 SRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR-WLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 448          
BLAST of slc18a-2 vs. UniProt/SwissProt
Match: sp|Q01827|VMAT2_RAT (Synaptic vesicular amine transporter OS=Rattus norvegicus OX=10116 GN=Slc18a2 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 6.814e-7
Identity = 45/184 (24.46%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LLKDP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+VI G   +CI F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  274 SRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR-WLCALLGMVIVGISILCIPFAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 449          
BLAST of slc18a-2 vs. UniProt/SwissProt
Match: sp|Q8BRU6|VMAT2_MOUSE (Synaptic vesicular amine transporter OS=Mus musculus OX=10090 GN=Slc18a2 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.617e-6
Identity = 43/184 (23.37%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LLKDP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G+++ G   +CI F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  276 SRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR-WLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 451          
BLAST of slc18a-2 vs. UniProt/SwissProt
Match: sp|Q27963|VMAT2_BOVIN (Synaptic vesicular amine transporter OS=Bos taurus OX=9913 GN=SLC18A2 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 5.855e-6
Identity = 42/184 (22.83%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            S+   E +K      LL+DP++++    + F ++    LE  LPI+M++  CS + Q G  +L    S +       +   K    W+  ++G++I G   +CI  +K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +   IG    G + +  G
Sbjct:  276 SRVQPESQKGTPLTTLLRDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSHKWQLGVAFLPASVSYLIGTNVFGILAHKMGR-WLCALLGMIIVGMSILCIPLAKNIYGLIAPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIG 451          
BLAST of slc18a-2 vs. TrEMBL
Match: A0A0H3YFB7 (Slc18a-2 OS=Schmidtea mediterranea OX=79327 GN=slc18a-2 PE=2 SV=1)

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 513/513 (100.00%), Postives = 513/513 (100.00%), Query Frame = 2
Query:   53 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGXXXXXXXXXXXXXXXSPFMACLRKYFK 1591
            MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWLFGFFSLIGFFLSSMLFHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGFLTLCILLCCFTCLLSPFMACLRKYFK
Sbjct:    1 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWLFGFFSLIGFFLSSMLFHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGFLTLCILLCCFTCLLSPFMACLRKYFK 513          
BLAST of slc18a-2 vs. TrEMBL
Match: A0A267GQ21 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025894g2 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.650e-16
Identity = 106/478 (22.18%), Postives = 199/478 (41.63%), Query Frame = 2
Query:  125 FLSQMITTVF-PAYSS--VKTEIENVSIA---------STNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSV--CWILPMVGIVINGAICICIFF--SKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            F  QM+TTV  P       +  +++V  A         S+    ++   +  + L+G K   ++ M P++G + D   P  IL  G   +  + ++Y + D+++  +LAR ++  G + + TSGL  + T + + R RN+ I   + +++ A +  P   G I+E        + R   F+   P+F   A  + P   R   +                   Q G            +    +      QQD  +++  S   ++   ID        +  L +PD D  +  +  +K      K     +LL DPH+      L+  +L  N L  TL I+M  ++ +  TQ+G VWL          ++S+    +      W+    G+V+ G  C  + F   K W  + +  G +F   ++ +  L+P++  ++D +++  YGS S +   +F+I+   G F  GP+  + G
Sbjct:   23 FSDQMLTTVIIPIVHDQLCRAAVDHVDTADGLLGAFNSSSEACAESDVKIQSAFLVGLKGLVQIAMNPLIGKLIDLLFPAAILLVGIAADCTSILLYGLGDSYWVFLLARAVNGAGSAAIGTSGLAQVATCFTSLRMRNRAIGIANFVLFSANALGPAYGGFIYER-------TGRGVVFLAYLPMFAATACLLVPL-LRQGLVR------------------QRGGRPEGPAAPQSPQHPPPSQQQQPQQQDAGDAVAVSSPTSSPAAID--------ADHLVVPDND--NDEEVAAKR----PKPTPLWRLLTDPHIAACAGGLIVANLSHNCLAATLGIWMHHRYEATDTQKGLVWLPTLPFHFAATVASVWLCNRAPAWRGWVA-AGGLVLGGLACALLPFMPGKAWCTLPI--GLVFASIAVLDVTLLPLLSHLVDRRHTPVYGSVSCIAHASFSIATAFGAFAAGPIFLHLG 457          
BLAST of slc18a-2 vs. TrEMBL
Match: A0A0H3YJ27 (Slc18a-1 OS=Schmidtea mediterranea OX=79327 GN=slc18a-1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.625e-13
Identity = 103/442 (23.30%), Postives = 189/442 (42.76%), Query Frame = 2
Query:  188 NVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXX-XXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            N S     C    P    VS++  SK   +     I+G   D+ +   IL  G  +     ++Y ++++    I+ R++DA     +   G +I+  ++ N  +R +     + L +++ S  P+      E   ++ K +     F  L PL+I   +A +   +R +                 C K +N  NE     S+ V  ++ N ++   +   +  I SS SK  +++ D K                  +    K  N + MK      K++K+P+V   L  L   +L   +L  TLP +M  + C+ + QQG VW FGF   +    L  +L      + +  P++  +I G + I +  S  W ++ + +  M+F   + E +L P+   + D  ++  YGS + LT  + T+SG++GT   GP+ + FG
Sbjct:   52 NTSRTIFQCHLQKPPYFIVSMIFLSKSLAQFFFNSIIGCFVDKVNNFIILLIGQGLGIIIALIYALNNSITMYIVGRLLDAFVSCSLFIGGFSIVSKLFSNVNTRGRFFGLGNTLYFVSHSIGPVYGA---EVDVRLGKSAV----FFLLIPLWI-FTMAATFILYRRT--------------EKRCNKSKNNFNE---KLSIGVTPDETNELDDHNELKVA-IIISSNSKMPEKYSDFKG-----------------EKKFQKENNEIFMK----FYKIMKNPYVSSCLCQLFIVNLSMFALPATLPSWMGFRLCATEIQQGLVWAFGFIGYVSGVGLIVLLLKCAYQLRFFSPIIAQIIVGILLILLPLSHDWRLLFIPIIGMYFSVGVIEQVLFPLTTYLADHHFNSDYGSMASLTSQSLTLSGVVGTLSSGPIAQRFG 446          
BLAST of slc18a-2 vs. TrEMBL
Match: A0A267HB05 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025894g1 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.119e-13
Identity = 92/439 (20.96%), Postives = 183/439 (41.69%), Query Frame = 2
Query:  200 ASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSV--CWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            +S+    ++   +  + L+G K   ++ M P++G + D   P  IL  G   +  + ++Y + D+++  +LAR ++  G + + TSGL  + T + + R RN+ I   + +++ A +  P   G I+E        + R   F+   P+F   A  + P   R   + +  G              Q+ ++          +++ G+ +        + S P+S     D   DH +VP+                S    +   +  K     +LL DPH+      L+  +L  N L  TL I+M  ++ +  TQ+G VWL          ++S+    +      W+      +   A  +  F     W   + +G +F   ++ +  L+P++  ++D +++  YGS S +   +F+I+   G F  GP+  + G
Sbjct:   99 SSSEACAESDVKIQSAFLVGLKGLVQIAMNPLIGKLIDLLFPAAILLVGIAADCISILLYGLGDSYWVFLLARAVNGAGSAAIGTSGLAQVATCFTSLRMRNRAIGIANFVLFSANALGPAYGGFIYER-------TGRGVVFLAYLPMFAATACLLVPL-LRQGLVRQRGGRPEGPAAP------QSPQHRPPSQQQQPQQQDAGDAV--------AVSSPTSSPAAIDA--DHLVVPD----------------SGNDEEVAAKRPKPTPLWRLLTDPHIAACAGGLIVANLSHNCLAATLGIWMHHRYEATDTQKGLVWLPTLPFHFAATVASVWLCNRAPAWRGWVAAGGLALGGLACALLPFMPGKAWCT-LPIGLVFASIAVLDVTLLPLLSHLVDRRHTPVYGSVSCIAHASFSIATAFGAFAAGPIFLHLG 496          
BLAST of slc18a-2 vs. TrEMBL
Match: A0A0H3YK86 (Slc18a-3 OS=Schmidtea mediterranea OX=79327 GN=slc18a-3 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.864e-9
Identity = 98/467 (20.99%), Postives = 198/467 (42.40%), Query Frame = 2
Query:  125 FLSQMITTVFPAYSSVKTEIENVSIASTNCSND----NPSNVY--VSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTV--LMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVC-WILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLV 1498
            F++ M+  +FP     K   E++ + + N S++    N S  Y  +SIL  +K   ++++ P +G+   R     ILF+G  ++  + + Y   + ++  I+ RI +A+    ++ +  + +   Y + +    V     + + I G++ P   G +F+   K       +  F+ +  +  + A+ I      N               S +    +  KN L    + +V+    N I  ++  + S S     S+  +  +D+     K  S L+    +   +S  KS      K + +    L DP+ M+ L    +M+ SL       TLP FM   F + ++QQG +WL         FL     + K +    I+ MV + ++    +CI     WW I + L  +     + E I+ P++  I+  ++   +G  +G+ ++   ++   G+F +GP++
Sbjct:   25 FITGMVIPIFPTLID-KHFNESLPVPAANFSSEISVLNSSFNYQQLSILFATKNICQILLSPWMGYFCGRLGSLNILFSGVGLQTVSILFYGFGNKYFLLIIGRIFEALASGAINCAVSSFVAYRYTDHKKLGLVYGIGGLGLCIGGASGPAYGGWVFQYHGK-------LMVFLTVLSMTTVEAILILSLMIANK--------------SNKSHHIETIKNPLCAEINEIVENKFDNEIIISMPNNISIS-----SEGVNVLLDNSFKEPKFGSLLNENGNENNHLSVEKS------KPEHNIFYFLSDPYFMICLGAFPVMYFSLF--VYYATLPHFMKVTFGASESQQGVIWLLNLVGYFIGFLLGNFLNAKFAKSRHIVLMVTVYVHAIGALCISLMPSWWSIAIPLCLIVNQHLVFEIIIAPLLTSIVAKRHESKFGLMAGIIMMAIALTSSCGSF-LGPIL 455          
BLAST of slc18a-2 vs. Ensembl Cavefish
Match: slc18a2 (synaptic vesicular amine transporter [Source:NCBI gene;Acc:103032219])

HSP 1 Score: 53.5286 bits (127), Expect = 3.493e-7
Identity = 41/178 (23.03%), Postives = 83/178 (46.63%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSK-------PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGP 1492
            SK   E +K  S   L+KDP++++    + F ++    LE  LPI+M++  C+ + Q G  +L    S +       +   K    W+  ++G+++ G   +C+ F+K       P + +G  +G       M +  ++P++  ++D+++   YGS   +  + F +      F  GP
Sbjct:  271 SKVEPESQKGTSLMTLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCARKWQLGVAFLPASVSYLIGTNIFAVLANKMGR-WLCALIGMLLVGISILCVPFAKDIYGLILPNFGVGFAIG-------MVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMG-----FAFGP 435          

HSP 2 Score: 49.2914 bits (116), Expect = 7.501e-6
Identity = 43/182 (23.63%), Postives = 82/182 (45.05%), Query Frame = 2
Query:  140 ITTVFPAYSSVKTEIENVSIASTNCSN----DNP---SNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAV 664
            +T + P +++          ++ N SN    D+     NV V +L  SK   +LI  P +G +T+R      +F G  I   + +++  S ++    LAR +  +G S  S +G+ ++ ++Y ++  R      ++I + + G    ++ G  F S          ++ FV     F+ILAV
Sbjct:   88 LTNISPQFNTPTMPPTTTVTSAPNASNCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFLSTIMFAFSSSYTLLFLARSMQGVGSSCSSVAGMGMLASVYTDDEERG-----NAIGIALGGLAMGVLVGPPFGSV---------MYEFVGKTAPFLILAV 255          
BLAST of slc18a-2 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 51.2174 bits (121), Expect = 1.882e-6
Identity = 46/163 (28.22%), Postives = 77/163 (47.24%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICI-FFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  CS + Q G  +L    S +       L   K    W+  M+G+ I G   IC+   S  + +IG   G  F    M +  ++ ++  ++DI++S  YGS   +  +   +   IG    G +V   G
Sbjct:  284 LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMGR-WLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAI-GMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIG 444          
BLAST of slc18a-2 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 51.2174 bits (121), Expect = 2.001e-6
Identity = 46/163 (28.22%), Postives = 77/163 (47.24%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICI-FFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  CS + Q G  +L    S +       L   K    W+  M+G+ I G   IC+   S  + +IG   G  F    M +  ++ ++  ++DI++S  YGS   +  +   +   IG    G +V   G
Sbjct:  292 LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMGR-WLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAI-GMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIG 452          
BLAST of slc18a-2 vs. Ensembl Sea Lamprey
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 47.7506 bits (112), Expect = 5.323e-6
Identity = 33/141 (23.40%), Postives = 67/141 (47.52%), Query Frame = 2
Query:  230 SNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVI---------------TFDSILVYIAGSTSP--IIAG-AIFESASKI 598
             NV V +L  +K   +L+  P +G +T+R      +F G +I   + +++  + ++    LAR +  IG S  S +G+ ++ ++Y ++  R   +                F SI+    G  +P  ++AG A+F+ A ++
Sbjct:  147 ENVRVGLLFAAKATVQLLANPFIGPLTNRVGYHSPMFAGFIIMFLSTIMFAFAQSYPLLFLARALQGIGSSCSSVAGMGMLASLYPDDEERGNAMGVALGGLAMGVLVGPPFGSIMYDFVGKPAPFLVLAGLALFDGALQM 287          

HSP 2 Score: 46.9802 bits (110), Expect = 8.136e-6
Identity = 43/196 (21.94%), Postives = 88/196 (44.90%), Query Frame = 2
Query:  905 KMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGP 1492
            K  P  + + L+L D  +  +    SK+  E +       LL+DP++++    +   ++    LE  LPI+M++  CS + Q G  ++    S             K    W+  ++G+V+ G   IC+  +K  + + V    + F   M +  ++P++  ++D+++   YGS   +  + F +      F +GP
Sbjct:  268 KPAPFLVLAGLALFDGALQMLVLQPSKSEPESQTGTPLLTLLRDPYILITAGSICIANMGIAMLEPALPIWMMETMCSPKWQLGVAFIPASISYWIGTNIFGPLAHKMGR-WLCALIGMVVVGISIICVPLAKTIYGLIVPNFGVGFAIGMVDSSMMPLMGYLVDLRHVSVYGSVYAIADVAFCMG-----FALGP 457          
BLAST of slc18a-2 vs. Ensembl Sea Lamprey
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 46.9802 bits (110), Expect = 7.854e-6
Identity = 47/209 (22.49%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  980 SKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLK-TSVCWILPMVGIVINGA----ICICIFFSK---PWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGXXXXXXXXXXXXXXXSPFMACLRK 1582
            S++   M +     +L+ DP+++VV   L   ++    LE T+  +M K   +++ Q+G  WL  FF  +     ++    K   + W    +G+VI G+    +  C  F +   P  + G+C G      ++ +  L+P++  ++D++++  YGS   +  ++++++  +G    G +V   GF+ L + +     L +P +  LR 
Sbjct:  261 SRSRENMPQGTPIYRLMMDPYIVVVAGALTMANIPLAFLEPTIASWMKKTMGANEWQRGMTWLPAFFPHVLGVYITVKLAAKYPQLQWFYGGLGLVIIGSSSCLVPACRTFEELIAP--LCGICFGI-----ALVDTALLPLLAFLVDVRHASVYGSVYAIADISYSLAYAMGPIVAGQIVHTMGFVQLSLGMGLTNVLYAPMLLLLRH 462          
BLAST of slc18a-2 vs. Ensembl Medaka
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 57.3806 bits (137), Expect = 2.070e-8
Identity = 45/186 (24.19%), Postives = 78/186 (41.94%), Query Frame = 2
Query:   71 NQKLFLTVIEAFSVFLTVFLSQMITTVFPAY-SSVKTEIENVSIASTNCSNDNPS----------NVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASK 595
             QK  + VI   ++ L   L  +I  + P Y   ++   +N   A    SN   S          ++ + +L  SK   +L++ PI G   DR      LF G  +   + + +  ++N+ +  LAR I  +G +   TSG+ +I   Y  E  R+K +      +      +P   G ++E A K
Sbjct:   40 RQKRIILVIVCVALLLDNMLYMVIVPIIPDYLEGLQKAADNAQHAIVRHSNSTNSSTPKAPTGNFDLQIGVLFASKAIVQLLVNPISGTFIDRVGYDIPLFIGLNVMFLSTLTFAFAENYATLFLARSIQGLGSAFADTSGIALIADRYTEETERSKALGIALAFISFGSLVAPPYGGVLYEFAGK 225          
BLAST of slc18a-2 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 52.373 bits (124), Expect = 9.452e-7
Identity = 42/162 (25.93%), Postives = 79/162 (48.77%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  M+G+VI G   +C+ F+   + +    G + F   M +  ++ ++  ++DI+++  YG+   +  +   +   IG    G LV+  G
Sbjct:  244 LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSPKWQLGVAFLPASISYLIGTNLFGVLANKMGR-WLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVG 404          

HSP 2 Score: 50.8322 bits (120), Expect = 2.278e-6
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 2
Query:  200 ASTNCSNDN----PSNVYVSILIGSKYGTELIMFPIVGWITDR--SHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAV 664
            A+++C  D+      NV+V +L  SK   +L++ P VG +T+R   H P  +F G +I   + +++  S  +     AR +  IG S  S +GL ++ ++Y N+  R   +      + + G    ++ GA F S          ++ FV     F+ILA+
Sbjct:   69 ANSSCLQDSVFLEEENVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIP--MFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMG-----IALGGLAMGVLIGAPFGSV---------MYDFVGKRAPFLILAL 213          
BLAST of slc18a-2 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 51.6026 bits (122), Expect = 1.544e-6
Identity = 42/162 (25.93%), Postives = 79/162 (48.77%), Query Frame = 2
Query: 1025 LLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            LLKDP++++    L F ++    LE TLPI+M++  CS + Q G  +L    S +       +   K    W+  M+G+VI G   +C+ F+   + +    G + F   M +  ++ ++  ++DI+++  YG+   +  +   +   IG    G LV+  G
Sbjct:  311 LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSPKWQLGVAFLPASISYLIGTNLFGVLANKMGR-WLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVG 471          
BLAST of slc18a-2 vs. Planmine SMEST
Match: SMESG000076103.1 (SMESG000076103.1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 398/400 (99.50%), Postives = 399/400 (99.75%), Query Frame = 2
Query:   53 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPM 1252
            MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNI+STLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVID SQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWLFGFFSLIGFFLSSMLFHLKTSVCWILPM
Sbjct:    1 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNIDSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDSSQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWLFGFFSLIGFFLSSMLFHLKTSVCWILPM 400          
BLAST of slc18a-2 vs. Planmine SMEST
Match: SMESG000076103.1 (SMESG000076103.1)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 345/362 (95.30%), Postives = 351/362 (96.96%), Query Frame = 2
Query:   53 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLI-----GNSLETTLPIFMI 1123
            MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNI+STLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVID SQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLI      NS  + L ++++
Sbjct:    1 MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNIDSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDSSQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIEILFRSNSTRSCLAVWIL 362          

HSP 2 Score: 87.8113 bits (216), Expect = 1.600e-18
Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1
Query: 1126 EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN 1251
            EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN
Sbjct:  345 EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN 386          
BLAST of slc18a-2 vs. Planmine SMEST
Match: SMESG000076103.1 (SMESG000076103.1)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 344/361 (95.29%), Postives = 350/361 (96.95%), Query Frame = 2
Query:   56 MKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLI-----GNSLETTLPIFMI 1123
            MKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNI+STLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVID SQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLI      NS  + L ++++
Sbjct:    1 MKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIASTNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLVKENDGNNIDSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDSSQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIEILFRSNSTRSCLAVWIL 361          

HSP 2 Score: 87.8113 bits (216), Expect = 1.675e-18
Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1
Query: 1126 EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN 1251
            EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN
Sbjct:  344 EILFRSNSTRSCLAVWILFINRILFIKYALSFKDKCLLDFTN 385          
BLAST of slc18a-2 vs. Planmine SMEST
Match: SMESG000069017.1 (SMESG000069017.1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.402e-21
Identity = 138/532 (25.94%), Postives = 230/532 (43.23%), Query Frame = 2
Query:   11 SIFIFHSNFY*CRKMMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKT--EIENVS-IASTN----CSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWIL-PMVGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGXXXXXXXXXXXXXXXSPFMACLRK 1582
            +I I  S+FY      K   +  L + ++   + F+ V     + T+ P Y S +T  EI N S I ++N    C + +P  V +S++  SK    + + PI+G I DR +   IL    ++     +VY  S++    I+ RIIDA   S++  +  +II  +++  R R+K   F + L +++ S  P+   ++ E   K  K +     F+ L P+                     + IS++    +  +     KN+  +   L + EN   N       D     P++ SKN             +S S    +   + I   +S NH   +   +  K+LKDP V+  L  +   +L   SL  TLP +M  K CS + QQG VW FGF   I      ++          L P+ G +I G   I I F++ W  + + +  M+    + E I++P+   + D  Y+ +YG+ S LT  +  +  +I +   GP+ E +GF TL I L       SP     RK
Sbjct:   83 AIRILSSSFY-----AKFLRSDYLLVIIVVGLNFFMMVIEESSLYTILPKYLSNRTFGEINNYSRIYASNLSMKCVSKDPPYVIISMIFLSKNLATIFINPIIGMILDRMNNFIILIFAQILGVSVLLVYAFSNSILMYIIGRIIDAFVTSVIFLAVYSIISQMFLETRIRSKYYGFVNTLFFVSHSLGPVYGASVDE---KFGKSAV----FLLLIPI---------------------WSISLLFTYLLHRRIKTINKNKKGVPRFLEIMENHNWN-------DTRVDSPNNESKNLI-----------LSESSEKNETIKVKIENKQSGNH---RTLFTIFKMLKDPKVLACLVQIFVVNLCMFSLPPTLPSWMAFKLCSSELQQGIVWSFGFLGYILGVSLVIIIDAYAPRFRNLAPVAGQIIIGIQLIMIPFTRDWRFLFLPIIGMYISVGVVEQIILPLTTYLSDSLYNSNYGTMSSLTSQSLNLCSVISSLCSGPIAEKYGFTTLAIALGIINLSFSPISLIHRK 560          
BLAST of slc18a-2 vs. Planmine SMEST
Match: SMESG000070401.1 (SMESG000070401.1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.855e-14
Identity = 101/436 (23.17%), Postives = 189/436 (43.35%), Query Frame = 2
Query:  233 NVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGALIEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSRNKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFIILAVAISPFAFRNSYMSRYFGIXXXXXXXXECKKFQNGKNELDINNSLLVKENDGNNINSTLQQDCSESIPSS---GSKNADQFIDHKMVPNKMSSSLSLPDVDVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLETTLPIFMIKKFCSDQTQQGAVWXXXXXXXXXXXXXXXXXHLKTSVCWILPMVG-------IVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDIKYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFG 1510
            NV +S ++GS+    LI  PI G + +   P Q  + G   E F C++   ++ +   I+ + I+  G S+V+ + LTII   + +   ++ ++   SI + +    SP +AG ++E+  K++   A   + V+   + I++ V I+                    KSVE + F++  + ++ NNS+   E D  + +        E I S    G     +FI H                    +++T               KLL DP++ + +  ++   L   SL TTL I++ ++F  ++T QG VW+  F   I  +L      L   +   +P  G        +I+GA  I + F   WW++ + L       ++ + +L+P+V  I D++++  +GS + +   +  I      F  G +V  FG
Sbjct:   30 NVRISFIMGSRSLVHLIFTPIWGILINIFGPIQFGYIGLTTEIFGCLMLGFANTYIMLIIGKCIEGFGSSLVTVAALTIISLKFHDYEEKSCIMGLTSISIVLGNYVSPFVAGILYENF-KLDGQMAVYLSMVFCKFINILIYVVINK-------------------KSVEVEDFKD--SIINRNNSI---EPDRRSSSLKGTYHLLEKIGSGESLGMMMESEFITH--------------------VTETT-----------PIYKLLIDPYIAICILGIIACHLPHYSLLTTLSIWLHERFGVNETIQGLVWVPSFIFNIFTYL------LGLVLVKYVPHQGYIFVIISFIISGASNIALPFLPSWWLVMIVLSNFALNLTLVKFLLLPLVVMISDLRHNSVHGSVAAIINESMHIGAAFSFFAAGSIVNRFG 403          
The following BLAST results are available for this feature:
BLAST of slc18a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC18A21.244e-723.91solute carrier family 18 member A2 [Source:HGNC Sy... [more]
SLC18A12.597e-623.91solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A12.597e-623.91solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A18.005e-623.84solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A18.005e-623.84solute carrier family 18 member A1 [Source:HGNC Sy... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cat-14.352e-722.37pep chromosome:WBcel235:X:5705719:5710625:-1 gene:... [more]
cat-15.338e-722.37pep chromosome:WBcel235:X:5705719:5710585:-1 gene:... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC18A17.064e-725.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A17.247e-725.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A17.696e-725.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A18.195e-725.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a24.526e-621.91solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2e1.24.046e-729.66general transcription factor IIE, polypeptide 1, a... [more]
gtf2e1.24.107e-729.66general transcription factor IIE, polypeptide 1, a... [more]
gtf2e1.25.488e-728.47general transcription factor IIE, polypeptide 1, a... [more]
ENSXETT00000009730.12.062e-626.39chromaffin granule amine transporter [Source:NCBI ... [more]
ddx422.134e-625.27DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slc18a22.311e-723.37solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a18.107e-626.11solute carrier family 18 (vesicular monoamine), me... [more]
back to top
BLAST of slc18a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q05940|VMAT2_HUMAN5.972e-723.91Synaptic vesicular amine transporter OS=Homo sapie... [more]
sp|Q01827|VMAT2_RAT6.814e-724.46Synaptic vesicular amine transporter OS=Rattus nor... [more]
sp|Q8BRU6|VMAT2_MOUSE1.617e-623.37Synaptic vesicular amine transporter OS=Mus muscul... [more]
sp|Q27963|VMAT2_BOVIN5.855e-622.83Synaptic vesicular amine transporter OS=Bos taurus... [more]
back to top
BLAST of slc18a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFB70.000e+0100.00Slc18a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267GQ211.650e-1622.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0H3YJ271.625e-1323.30Slc18a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267HB052.119e-1320.96Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0H3YK867.864e-920.99Slc18a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc18a23.493e-723.03synaptic vesicular amine transporter [Source:NCBI ... [more]
SLC18A11.882e-628.22solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A12.001e-628.22solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc18a25.323e-623.40solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
slc18a3a7.854e-622.49solute carrier family 18 member 3a [Source:NCBI ge... [more]
back to top
BLAST of slc18a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc18a3a2.070e-824.19solute carrier family 18 member 3a [Source:NCBI ge... [more]
SLC18A19.452e-725.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A11.544e-625.93solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076103.10.000e+099.50SMESG000076103.1[more]
SMESG000076103.11.600e-1895.30SMESG000076103.1[more]
SMESG000076103.11.675e-1895.29SMESG000076103.1[more]
SMESG000069017.12.402e-2125.94SMESG000069017.1[more]
SMESG000070401.17.855e-1423.17SMESG000070401.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007849
GenBankAKN21537.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007849 ID=SMED30007849|Name=slc18a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1613bp
AATGCTTTTAAGTATATTTATTTTTCATTCTAATTTTTATTAATGTAGAA
AAATGATGAAACTCAGTTTGAATCAAAAATTATTTTTAACTGTTATTGAG
GCATTTTCTGTGTTTTTAACAGTTTTTCTGAGTCAAATGATTACAACAGT
TTTCCCTGCTTATTCATCCGTAAAAACTGAAATTGAGAATGTTTCTATCG
CATCGACAAATTGTTCAAATGATAATCCCAGTAATGTGTATGTATCGATT
CTTATTGGATCAAAATATGGCACGGAATTAATTATGTTTCCTATTGTTGG
TTGGATCACTGATCGCAGTCATCCGCCACAGATTTTGTTTACTGGAGCTC
TTATTGAAGCTTTCGCTTGCGTTGTTTATTGTATTTCTGATAATTTTTAC
AGCTCAATTTTAGCGAGAATAATTGACGCAATAGGCTATTCAATAGTATC
CACTTCAGGATTGACAATTATTTATACAATATATGTGAATGAAAGATCTC
GCAACAAAGTTATCACTTTTGATAGTATTTTGGTATATATTGCTGGGAGT
ACGTCTCCAATCATAGCTGGGGCTATTTTTGAAAGTGCCAGTAAAATTAA
TAAAGATTCTGCCCGGATTTTCACATTTGTATGGCTGTGTCCATTATTTA
TCATATTAGCCGTTGCAATAAGTCCATTTGCTTTCAGAAATTCTTATATG
TCTCGGTATTTTGGGATATCTGTAGTCAAGAAAAAGAGTGTGGAGTGTAA
GAAATTTCAAAATGGAAAAAATGAATTAGATATTAACAATTCGTTATTGG
TAAAGGAAAATGATGGAAATAATATTAATTCAACCCTTCAACAAGATTGC
AGTGAAAGTATACCTAGTTCAGGTAGTAAAAATGCAGATCAATTTATTGA
TCATAAAATGGTGCCAAATAAAATGAGTTCTTCTTTGTCGCTACCGGATG
TAGATGTAATCGATATTTCACAAACGAAATCAAAAAATCATTTAGAAATG
AAAAAGCAATTAAGTGCGGCTAAATTATTAAAAGATCCTCACGTAATGGT
CGTACTAACAGTTCTAATGTTTAATTCTCTGATTGGTAATAGCTTAGAAA
CGACATTGCCAATATTTATGATTAAGAAATTTTGTTCAGATCAAACTCAA
CAAGGAGCTGTTTGGCTGTTTGGATTCTTTTCATTAATAGGATTCTTTTT
ATCAAGTATGCTCTTTCATTTAAAGACAAGTGTTTGTTGGATTTTACCAA
TGGTTGGTATAGTTATTAATGGAGCAATATGCATTTGTATATTTTTCAGT
AAACCCTGGTGGGTAATCGGTGTATGTTTAGGATTCATGTTTTTTTTCTC
CTCAATGACCGAATGTATTTTGATTCCGGTTGTACCTAAAATAATTGATA
TAAAATATTCAAAATCGTACGGAAGCGCATCAGGGTTAACGCTACTTACA
TTTACGATCAGTGGACTGATTGGTACATTTCCAATTGGACCGTTGGTTGA
ATATTTCGGTTTTTTGACACTGTGTATTCTGCTTTGCTGCTTTACGTGTT
TATTATCCCCGTTTATGGCTTGTTTAAGAAAATATTTTAAATAATGTTAT
AATAAAAATTGAG
back to top

protein sequence of SMED30007849-orf-1

>SMED30007849-orf-1 ID=SMED30007849-orf-1|Name=SMED30007849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MMKLSLNQKLFLTVIEAFSVFLTVFLSQMITTVFPAYSSVKTEIENVSIA
STNCSNDNPSNVYVSILIGSKYGTELIMFPIVGWITDRSHPPQILFTGAL
IEAFACVVYCISDNFYSSILARIIDAIGYSIVSTSGLTIIYTIYVNERSR
NKVITFDSILVYIAGSTSPIIAGAIFESASKINKDSARIFTFVWLCPLFI
ILAVAISPFAFRNSYMSRYFGISVVKKKSVECKKFQNGKNELDINNSLLV
KENDGNNINSTLQQDCSESIPSSGSKNADQFIDHKMVPNKMSSSLSLPDV
DVIDISQTKSKNHLEMKKQLSAAKLLKDPHVMVVLTVLMFNSLIGNSLET
TLPIFMIKKFCSDQTQQGAVWLFGFFSLIGFFLSSMLFHLKTSVCWILPM
VGIVINGAICICIFFSKPWWVIGVCLGFMFFFSSMTECILIPVVPKIIDI
KYSKSYGSASGLTLLTFTISGLIGTFPIGPLVEYFGFLTLCILLCCFTCL
LSPFMACLRKYFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 18..474
e-value: 3.3E-21
score: 75.6
NoneNo IPR availablePANTHERPTHR23506:SF23GH10249Pcoord: 9..508
NoneNo IPR availablePANTHERPTHR23506FAMILY NOT NAMEDcoord: 9..508
NoneNo IPR availableCDDcd17384MFS_SLC18A1_2_VAT1_2coord: 61..509
e-value: 3.8985E-14
score: 71.8346
NoneNo IPR availableTMHMMTMhelixcoord: 419..441
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 454..476
NoneNo IPR availableTMHMMTMhelixcoord: 369..388
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 126..145
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 486..508
NoneNo IPR availableTMHMMTMhelixcoord: 158..176
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 17..511