Myotubularin-related protein 2

Overview
NameMyotubularin-related protein 2
Smed IDSMED30007848
Length (bp)2255
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myotubularin-related protein 2 (SMED30007848) t-SNE clustered cells

Violin plots show distribution of expression levels for Myotubularin-related protein 2 (SMED30007848) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myotubularin-related protein 2 (SMED30007848) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myotubularin-related protein 2 (SMED30007848) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007848

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007848SMESG000072462.1 Contig1066GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Match: MTMR2 (myotubularin related protein 2 [Source:HGNC Symbol;Acc:HGNC:7450])

HSP 1 Score: 434.876 bits (1117), Expect = 5.561e-144
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:    9 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 535          
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Match: MTMR2 (myotubularin related protein 2 [Source:HGNC Symbol;Acc:HGNC:7450])

HSP 1 Score: 435.261 bits (1118), Expect = 7.451e-144
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:    9 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 535          
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Match: MTMR2 (myotubularin related protein 2 [Source:HGNC Symbol;Acc:HGNC:7450])

HSP 1 Score: 435.261 bits (1118), Expect = 7.451e-144
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:    9 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 535          
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Match: MTMR2 (myotubularin related protein 2 [Source:HGNC Symbol;Acc:HGNC:7450])

HSP 1 Score: 435.261 bits (1118), Expect = 7.451e-144
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:    9 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 535          
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Match: MTMR2 (myotubularin related protein 2 [Source:HGNC Symbol;Acc:HGNC:7450])

HSP 1 Score: 436.032 bits (1120), Expect = 2.986e-143
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 607          
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Match: mtm-1 (Myotubularin-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N589])

HSP 1 Score: 340.502 bits (872), Expect = 1.363e-107
Identity = 200/554 (36.10%), Postives = 308/554 (55.60%), Query Frame = 3
Query:  150 NLLQEVYDFK--CGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-----------GDGN-CLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHK--EPGYRNSVLSDEYQRQLI-ESNNWRISKVNHNFEVCETYPDEVAVPKDVSDET---ITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQR-RTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR 1745
            +++QE  D K    E+++  E NVT F    K   G +++T YR++F               + +  K ++   L++P+G +   EK           GD N   TI CKD+R         S+        L +Y  P S N+ +FA VH     +  + G++      EY+R  I  S  W+   +N +++  ETYP    +P    +E    +    +FR+K R PVL WI+  T A+++R SQP TG++ KR+  DER+L +I +ANA    L I+DARP +NA+ N A+GGG E    Y +    FLNI NIHV+R+S+++L     P+ D   ++KAL+E+KWLN+++ IL G++     +++++ SVL+HCSDGWDRTAQ+TSL  + LD Y+RTI GF  LI+KEW   GHK  +R G   + +          ER+P+F+QF DC+WQI +QF  AFEF ++ LI ++D +Y+  +G FL+NSE+ R +  +    T+SFW +V  + +K+RNP+F       ++V+     L  +  W  YY R
Sbjct:   18 SMIQESIDLKLLAAESLIWTEKNVTYFGPLGKFP-GKIVITRYRMVFL--------------VGDGGKMYEQWKLDIPLGQVSRIEKVGRKTTSVAKRGDDNYGFTIYCKDYRVYRFTCNPASSDRKNVCDSLNRYAFPLSHNLPMFASVHAAETPRLMKDGWKIYSAEKEYERLGIPNSRLWKEVDINKDYKFSETYPRTFVIPTVSWEEGKPFVKKLGEFRSKERIPVLSWINQTTLASISRCSQPMTGISGKRSAEDERHLTNIMNANANCRELLILDARPAVNAKLNKAKGGGYEEN--YVNAPLTFLNIHNIHVVRDSLKRLLAALIPRVDEKGYYKALDESKWLNHVQSILEGAVKAVFNVDTEKQSVLIHCSDGWDRTAQLTSLAMIQLDSYYRTIEGFIVLIEKEWCSFGHKFGERIGHGDDNYSD-------GERSPVFVQFCDCLWQIMRQFPWAFEFTQELLICMLDELYACRYGTFLYNSEKIRLKDKKCDETTISFWSYVLENKKKFRNPMFKHG--KSNKVINVNPSLCGLHVWIDYYAR 545          
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Match: mtm-6 (Myotubularin-related protein 6 [Source:UniProtKB/Swiss-Prot;Acc:G5ED68])

HSP 1 Score: 325.094 bits (832), Expect = 1.057e-100
Identity = 169/447 (37.81%), Postives = 259/447 (57.94%), Query Frame = 3
Query:  348 EFKSLDLNLPVGFIQEFEKGD----GNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENI-KLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQR---TGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTP 1664
            E  S +L L  G I   EKG     G  L I+CK F+ +TL +  D +  D ++ L ++   P S N+ +L AF + + +    G+R    + E  RQ I  + W  S +N  + +C+TYP+++  P   S   +  +C+FR++ R PVL + H  T+A L R +QP TG +  R   DE+ ++ +  AN  ++ L ++D RP +NA  N  +G G E +  Y+++ + F +I NIHVMR S  +L D      D + + K LE + WL ++R ++  SL +AE I+   S +VHCSDGWDRT+Q+ +L QL+LDPY+RTI GFQ LI+K+WL  GHK   R    G L +E G         E +PIF Q++DC+WQI QQ   AF+FNE++LI++ + VYS  FG F+ N ++ RR   +  +T S W  +++  + Y NP ++P
Sbjct:   42 ENGSKELWLATGLISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETL-QRAAKPVSVNVTELLAFENREPVEDVRGWRRLDWNSEMTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFS-ARCVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRDVTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGFGHKFDDRCGHVGALNDEAG--------KEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLSKRTKSLWTWMDARHDDYMNPFYSP 478          
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Match: mtm-6 (Myotubularin-related protein 6 [Source:UniProtKB/Swiss-Prot;Acc:G5ED68])

HSP 1 Score: 324.709 bits (831), Expect = 1.974e-99
Identity = 175/475 (36.84%), Postives = 267/475 (56.21%), Query Frame = 3
Query:  348 EFKSLDLNLPVGFIQEFEKGD----GNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENI-KLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQR---TGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFP-QYRLPCIRFWKSYYLR 1745
            E  S +L L  G I   EKG     G  L I+CK F+ +TL +  D +  D ++ L ++   P S N+ +L AF + + +    G+R    + E  RQ I  + W  S +N  + +C+TYP+++  P   S   +  +C+FR++ R PVL + H  T+A L R +QP TG +  R   DE+ ++ +  AN  ++ L ++D RP +NA  N  +G G E +  Y+++ + F +I NIHVMR S  +L D      D + + K LE + WL ++R ++  SL +AE I+   S +VHCSDGWDRT+Q+ +L QL+LDPY+RTI GFQ LI+K+WL  GHK   R    G L +E G         E +PIF Q++DC+WQI QQ   AF+FNE++LI++ + VYS  FG F+ N ++ RR   +  +T S W  +++  + Y NP ++P   + H  L     R      W + Y R
Sbjct:  148 ENGSKELWLATGLISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETL-QRAAKPVSVNVTELLAFENREPVEDVRGWRRLDWNSEMTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFS-ARCVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRDVTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGFGHKFDDRCGHVGALNDEAG--------KEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLSKRTKSLWTWMDARHDDYMNPFYSP---TAHVALLDLDTRAARFTVWTAMYNR 609          
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Match: mtm-6 (Myotubularin-related protein 6 [Source:UniProtKB/Swiss-Prot;Acc:G5ED68])

HSP 1 Score: 324.709 bits (831), Expect = 1.974e-99
Identity = 175/475 (36.84%), Postives = 267/475 (56.21%), Query Frame = 3
Query:  348 EFKSLDLNLPVGFIQEFEKGD----GNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENI-KLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQR---TGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFP-QYRLPCIRFWKSYYLR 1745
            E  S +L L  G I   EKG     G  L I+CK F+ +TL +  D +  D ++ L ++   P S N+ +L AF + + +    G+R    + E  RQ I  + W  S +N  + +C+TYP+++  P   S   +  +C+FR++ R PVL + H  T+A L R +QP TG +  R   DE+ ++ +  AN  ++ L ++D RP +NA  N  +G G E +  Y+++ + F +I NIHVMR S  +L D      D + + K LE + WL ++R ++  SL +AE I+   S +VHCSDGWDRT+Q+ +L QL+LDPY+RTI GFQ LI+K+WL  GHK   R    G L +E G         E +PIF Q++DC+WQI QQ   AF+FNE++LI++ + VYS  FG F+ N ++ RR   +  +T S W  +++  + Y NP ++P   + H  L     R      W + Y R
Sbjct:  148 ENGSKELWLATGLISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETL-QRAAKPVSVNVTELLAFENREPVEDVRGWRRLDWNSEMTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFS-ARCVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRDVTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGFGHKFDDRCGHVGALNDEAG--------KEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLSKRTKSLWTWMDARHDDYMNPFYSP---TAHVALLDLDTRAARFTVWTAMYNR 609          
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Match: mtm-6 (Myotubularin-related protein 6 [Source:UniProtKB/Swiss-Prot;Acc:G5ED68])

HSP 1 Score: 320.472 bits (820), Expect = 7.285e-99
Identity = 167/446 (37.44%), Postives = 257/446 (57.62%), Query Frame = 3
Query:  348 EFKSLDLNLPVGFIQEFEKGD----GNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQR---TGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTP 1664
            E  S +L L  G I   EKG     G  L I+CK F+ +TL +  D +  D ++ L ++   P +   +L AF + + +    G+R    + E  RQ I  + W  S +N  + +C+TYP+++  P   S   +  +C+FR++ R PVL + H  T+A L R +QP TG +  R   DE+ ++ +  AN  ++ L ++D RP +NA  N  +G G E +  Y+++ + F +I NIHVMR S  +L D      D + + K LE + WL ++R ++  SL +AE I+   S +VHCSDGWDRT+Q+ +L QL+LDPY+RTI GFQ LI+K+WL  GHK   R    G L +E G         E +PIF Q++DC+WQI QQ   AF+FNE++LI++ + VYS  FG F+ N ++ RR   +  +T S W  +++  + Y NP ++P
Sbjct:   42 ENGSKELWLATGLISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETL-QRAAKPVNVT-ELLAFENREPVEDVRGWRRLDWNSEMTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFS-ARCVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRDVTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGFGHKFDDRCGHVGALNDEAG--------KEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLSKRTKSLWTWMDARHDDYMNPFYSP 476          
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Match: mtm (gene:FBgn0025742 transcript:FBtr0079223)

HSP 1 Score: 409.453 bits (1051), Expect = 1.555e-133
Identity = 218/535 (40.75%), Postives = 319/535 (59.63%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDA--MHKEPGYRNSVLSD---EYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR 1745
            GE    ++N+VT          G L +TNYRL             +F  +P   +E   + +++P+G I   EK  G          + I CKD R++    K  ++S     + L+    P S + +LFAF H  A  ++   G+    + +   E +R  + ++ WR +K+N ++ +C++YP   AVPK  SD+ +    QFR++ R PVL W++P T+AT+TR SQP  G++ KRN  DE YL  I +ANA ++ LTI+DARP  NA AN A+GGG ES++ Y ++  +FL+I NIHVMRES+RK+ + C+P  D+S W  A++ T WL +IR IL G++ + +K+ +   SV+VHCSDGWDRTAQ+T+L  L+LDP++RT+RGF+ LI+KEWL  GHK  QR        G   +    ++R+P+FLQFID VWQ++QQF  AFEFNE FLI ++D +YS  FG FL N+E +R   ++  KT S W H+NS +++Y NPLF         VL P   +  +R WK  Y R
Sbjct:   52 GEEDQDQKNDVTYVCPYRGPVFGALTITNYRL-------------YFRSLPLRDQE-PPVVVDVPLGVIARVEKIGGATSRGENSYGIEIFCKDMRNLRFAHKQQNHSRRTVFEKLQANAFPLSYSGRLFAFAHAAANSVNGNGGWDGWAVYEPLAELRRLGVPNDMWRATKLNESYAICDSYPAVWAVPKAASDDFLRRVAQFRSRCRLPVLSWMNPRTQATITRCSQPLVGVSGKRNSDDEAYLSFIMEANAQSDKLTIMDARPSANAIANKAKGGGYESEDAYKNVEINFLDIHNIHVMRESLRKVKEACFPTTDDSKWQTAIDNTLWLKHIRCILAGAVRIVDKVETMSTSVVVHCSDGWDRTAQLTALSMLLLDPHYRTVRGFEVLIEKEWLSFGHKFQQR-------IGHGDNKHSDADRSPVFLQFIDSVWQVSQQFNNAFEFNEHFLITIVDHLYSCRFGTFLCNTEAERVAEDLKHKTTSLWTHINSSLDQYLNPLFPSFTHGAELVLRPIASVRSVRLWKGLYCR 565          
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Match: mtm (gene:FBgn0025742 transcript:FBtr0345290)

HSP 1 Score: 409.453 bits (1051), Expect = 1.555e-133
Identity = 218/535 (40.75%), Postives = 319/535 (59.63%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDA--MHKEPGYRNSVLSD---EYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR 1745
            GE    ++N+VT          G L +TNYRL             +F  +P   +E   + +++P+G I   EK  G          + I CKD R++    K  ++S     + L+    P S + +LFAF H  A  ++   G+    + +   E +R  + ++ WR +K+N ++ +C++YP   AVPK  SD+ +    QFR++ R PVL W++P T+AT+TR SQP  G++ KRN  DE YL  I +ANA ++ LTI+DARP  NA AN A+GGG ES++ Y ++  +FL+I NIHVMRES+RK+ + C+P  D+S W  A++ T WL +IR IL G++ + +K+ +   SV+VHCSDGWDRTAQ+T+L  L+LDP++RT+RGF+ LI+KEWL  GHK  QR        G   +    ++R+P+FLQFID VWQ++QQF  AFEFNE FLI ++D +YS  FG FL N+E +R   ++  KT S W H+NS +++Y NPLF         VL P   +  +R WK  Y R
Sbjct:   52 GEEDQDQKNDVTYVCPYRGPVFGALTITNYRL-------------YFRSLPLRDQE-PPVVVDVPLGVIARVEKIGGATSRGENSYGIEIFCKDMRNLRFAHKQQNHSRRTVFEKLQANAFPLSYSGRLFAFAHAAANSVNGNGGWDGWAVYEPLAELRRLGVPNDMWRATKLNESYAICDSYPAVWAVPKAASDDFLRRVAQFRSRCRLPVLSWMNPRTQATITRCSQPLVGVSGKRNSDDEAYLSFIMEANAQSDKLTIMDARPSANAIANKAKGGGYESEDAYKNVEINFLDIHNIHVMRESLRKVKEACFPTTDDSKWQTAIDNTLWLKHIRCILAGAVRIVDKVETMSTSVVVHCSDGWDRTAQLTALSMLLLDPHYRTVRGFEVLIEKEWLSFGHKFQQR-------IGHGDNKHSDADRSPVFLQFIDSVWQVSQQFNNAFEFNEHFLITIVDHLYSCRFGTFLCNTEAERVAEDLKHKTTSLWTHINSSLDQYLNPLFPSFTHGAELVLRPIASVRSVRLWKGLYCR 565          
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Match: CG3530 (gene:FBgn0028497 transcript:FBtr0072029)

HSP 1 Score: 348.591 bits (893), Expect = 1.473e-108
Identity = 204/542 (37.64%), Postives = 307/542 (56.64%), Query Frame = 3
Query:  183 GENIVKEENNVTLFD-FSTKGQN-GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFE-KGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAF---VHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPK-PDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTP-ADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD 1784
            G +++K+  NV + D ++TK    G L LT   L+F   +SN                 ++  L++ V  I++      G+ L I+CK F SVT  +  DS   D +  LL K   P S N KL+ F    + D   K  G+    L  E++  L+ +  W +  +N  +E+C+TYP ++ VPK+ +   + ++ +FR+K R PVL ++H + KA++ R SQP +G +  R   DE+ L++I+  N+  + + ++D RP INA AN A G G E++  Y +I + FL I NIHV R S++K+ + C  K P  S +  ALE + WL +IR IL  S  +A  ++   SV+VHCSDGWDRTAQ+ SL QLML+PY+RTI+GFQ LI+K+WL  GHK S+R G +          +   E +PIF QF+DC WQ+  Q   AFEFNE+FL+ L D V+S  FG F+ N E+ R   ++  +T S W ++ + + +Y NPL+ P  DE+    L PQ    CI+FW+  Y R       ++P+ D
Sbjct:   74 GNSVLKKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNK----------------ETWILHMHVASIEKLPLSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLL-KLFQPVSIN-KLYCFNYQPNKDDFPKNAGWDYFKLEAEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRFRSKGRLPVLTYLH-NNKASICRCSQPLSGFS-ARCLEDEQMLEAIRKTNSNTDYMYVVDTRPRINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINALESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHI---------QTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFLLILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINPLYKPNVDEAIKANLAPQ----CIKFWRGMYSRFESGIHPREPLGD 582          
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Match: CG3530 (gene:FBgn0028497 transcript:FBtr0072028)

HSP 1 Score: 344.354 bits (882), Expect = 1.026e-107
Identity = 202/538 (37.55%), Postives = 302/538 (56.13%), Query Frame = 3
Query:  192 IVKEENNVTLFDFSTKGQN-GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFE-KGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVH---FDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPK-PDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTP-ADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD 1784
            + K EN   +  ++TK    G L LT   L+F   +SN                 ++  L++ V  I++      G+ L I+CK F SVT  +  DS   D +  LL K   P S N KL+ F +    D   K  G+    L  E++  L+ +  W +  +N  +E+C+TYP ++ VPK+ +   + ++ +FR+K R PVL ++H + KA++ R SQP +G +  R   DE+ L++I+  N+  + + ++D RP INA AN A G G E++  Y +I + FL I NIHV R S++K+ + C  K P  S +  ALE + WL +IR IL  S  +A  ++   SV+VHCSDGWDRTAQ+ SL QLML+PY+RTI+GFQ LI+K+WL  GHK S+R G +          +   E +PIF QF+DC WQ+  Q   AFEFNE+FL+ L D V+S  FG F+ N E+ R   ++  +T S W ++ + + +Y NPL+ P  DE+    L PQ    CI+FW+  Y R       ++P+ D
Sbjct:    6 LAKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNK----------------ETWILHMHVASIEKLPLSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLL-KLFQPVSIN-KLYCFNYQPNKDDFPKNAGWDYFKLEAEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRFRSKGRLPVLTYLH-NNKASICRCSQPLSGFS-ARCLEDEQMLEAIRKTNSNTDYMYVVDTRPRINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINALESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHI---------QTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFLLILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINPLYKPNVDEAIKANLAPQ----CIKFWRGMYSRFESGIHPREPLGD 510          
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Match: CG3530 (gene:FBgn0028497 transcript:FBtr0112940)

HSP 1 Score: 342.428 bits (877), Expect = 1.343e-107
Identity = 186/463 (40.17%), Postives = 274/463 (59.18%), Query Frame = 3
Query:  411 GNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVH---FDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPK-PDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTP-ADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD 1784
            G+ L I+CK F SVT  +  DS   D +  LL K   P S N KL+ F +    D   K  G+    L  E++  L+ +  W +  +N  +E+C+TYP ++ VPK+ +   + ++ +FR+K R PVL ++H + KA++ R SQP +G +  R   DE+ L++I+  N+  + + ++D RP INA AN A G G E++  Y +I + FL I NIHV R S++K+ + C  K P  S +  ALE + WL +IR IL  S  +A  ++   SV+VHCSDGWDRTAQ+ SL QLML+PY+RTI+GFQ LI+K+WL  GHK S+R G +          +   E +PIF QF+DC WQ+  Q   AFEFNE+FL+ L D V+S  FG F+ N E+ R   ++  +T S W ++ + + +Y NPL+ P  DE+    L PQ    CI+FW+  Y R       ++P+ D
Sbjct:   15 GSPLLIRCKTFLSVTFVIPKDSECHDVYTSLL-KLFQPVSIN-KLYCFNYQPNKDDFPKNAGWDYFKLEAEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRFRSKGRLPVLTYLH-NNKASICRCSQPLSGFS-ARCLEDEQMLEAIRKTNSNTDYMYVVDTRPRINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINALESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHI---------QTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFLLILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINPLYKPNVDEAIKANLAPQ----CIKFWRGMYSRFESGIHPREPLGD 460          
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Match: mtm1 (myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-128])

HSP 1 Score: 436.032 bits (1120), Expect = 2.154e-143
Identity = 234/559 (41.86%), Postives = 337/559 (60.29%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR--HYLQSRSQDPIAD-YSRILSRR----KRIFQTQL-NRQPESDEETNIAQP 1877
            G + +TNYRL F + +S         E P        + LN+P+G I   EK  G          L I CKD R++   LK + +S     +++ KY  P S  ++LFAF+  +  ++E G+      +EY+RQ + +N WR++ +N N+E+C+TYP  + VP   +++ +     FR++ R PV+ W H +  A +TR SQP  G++ KRN+ DERYL  I++AN    L TI DARP +NA AN A GGG E  + Y +    FL+I NIHVMRES++KL D+ YP  + S+W  +LE T WL +I+ +L G++ VA+K++S  SV+VHCSDGWDRTAQ+TSL  LMLD Y+RT+RGFQ L++KEW+  GHK + R G      G  +   Q  +R+PIFLQFIDCVWQ+T+QF  AFEFNE+ L+ ++D +YS  FG FL+N E  R +N V TKT+S W ++NSD   Y NP +TP      RVL+P   +  +  W +YY+R    +Q + Q P+   Y  +L+ R    K++ + QL +  P S   TN + P
Sbjct:   94 GKVFITNYRLYFKNTDS---------ETP--------VTLNIPLGVISRVEKMGGASSRGENSYGLEITCKDMRNLRFALKQEGHSRRDIFEIIFKYAFPLSHGMQLFAFLSQEK-YEENGWNVYEALEEYRRQGLPNNEWRVTFINKNYELCDTYPTILVVPYKATEDDLRKVATFRSRCRIPVMSWFHKENHAVITRCSQPLVGMSGKRNKDDERYLDLIREANGTTKL-TIYDARPNVNAVANKATGGGYEGDDAYQNAELVFLDIHNIHVMRESLKKLKDIVYPNVEESHWLSSLESTHWLEHIKLVLSGAIQVADKVSSGSSVMVHCSDGWDRTAQLTSLSMLMLDSYYRTLRGFQVLMEKEWISFGHKFASRIG-----HGDKNHADQ--DRSPIFLQFIDCVWQMTKQFPTAFEFNERLLVVILDHLYSCRFGTFLYNCESVRDSNNVRTKTVSLWSYINSDTSLYINPFYTPESS---RVLYPVASMRHLELWVTYYIRWNPRIQHQQQSPVEQRYKELLALRDQYLKKLEELQLSDSAPSSTHLTNSSTP 623          
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Match: mtmr2 (myotubularin related protein 2 [Source:NCBI gene;Acc:30644])

HSP 1 Score: 428.328 bits (1100), Expect = 1.067e-140
Identity = 232/533 (43.53%), Postives = 330/533 (61.91%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNS-FGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-----GDGNC-LTIKCKDFRSVTLKLKNDSNSVDR-FDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            G L +TNYRL F   +    FG                  L+LP+G +   EK     G G+    + CKD R++    K   +S+ +   ++L K+  P S N+ LFAF  +  +  E G++      E +RQ + + +WRISK+N ++E+C++YP  + VP  ++D+ +     FR K R PVL WIHP+++A + RSSQP  G   +R + DE+ L++I DANA ++ L I DARP +NA AN  +GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + S+W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  +MLD ++RTIRGFQ L++KEWL  GH+  QR G      G  + T    +R+PIFLQFIDCVWQ+T+QF AAFEFNE FLI ++D +YS LFG FL NSEQQR   E+  +T+S W  VNS +E++ NPL+     S H VLFP   +  ++ W SYY+R   + R Q+P+   Y  +L++R  +
Sbjct:   80 GSLTVTNYRLFFRCTDREPVFG------------------LDLPLGVLSRVEKIGAATGRGDVSYGLACKDMRNLRFVHKEPDDSLKKSVFEVLMKFAFPVSNNMSLFAF-EYKQVFPENGWKVYDPLAECKRQGLPNESWRISKLNDHYELCDSYPATLVVPVTITDDELRRVSSFRAKGRIPVLSWIHPESQAAVVRSSQPMVGQNGRRCKEDEKLLQAIMDANAQSHKLFIFDARPSVNAAANKMKGGGFESEDAYQNAELVFLDIHNIHVMRESLRKLKEVVYPNIEESHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLALIMLDSHYRTIRGFQILVEKEWLSFGHRFQQRVG-----HGDKNHTD--VDRSPIFLQFIDCVWQMTRQFPAAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRLKEEIPKRTVSLWSFVNSQLEEFVNPLYV--HYSSH-VLFPTVGIRHLQLWVSYYIRWNPRMRPQEPVHQRYKELLAKRAEL 583          
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Match: mtmr1b (myotubularin related protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-48])

HSP 1 Score: 426.017 bits (1094), Expect = 1.069e-139
Identity = 224/518 (43.24%), Postives = 316/518 (61.00%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            G L +T+++L F S   +S               F  LD+NL  G +   E         D   L I CKD R+     K +  S     K+L KY  P S N+ LFAF + +    E G++      EY+RQ + + +W ISKVN  +EVCETYP  + +P +V+++ +     FR K RFPVL WIHP+++A + R  QP  G + +R   DERYL++I DANA ++ L I DAR    A  N A+ GG E+++ Y ++  +FL IPNIHVMRES+RKL ++ YP  D  +W   ++ T WL Y+R +L G++ +A++I S + SV+VHCSDGWDRTAQ+TSL  LMLD ++R+++GFQ L++KEWL  GH+ + R        G        SER+P+F+QFIDCVWQ+T+QF +AFEFNE FLI ++D ++S LFG FL+NSEQ+R + EVY KT+S W +VNS IE++ NPL+   +   H VL+P   L  +  W SYY+R   + R Q PI
Sbjct:   93 GTLTITDFKLYFKSLTRDS--------------PF-VLDVNL--GAVSRLESIAVQSHGDDTQGLEIVCKDLRTPRFAYKKEGQSNLEMFKILSKYAFPLSHNLPLFAFKYRETF-PEDGWKIYDPVAEYKRQGLPNESWIISKVNSGYEVCETYPALLVLPSNVTEDELKRVAAFRAKRRFPVLSWIHPESQAAIVRCGQPQVGPSDRRCREDERYLQTILDANAQSHKLCIFDARQSTVADTNKAKDGGYENESFYINVELNFLEIPNIHVMRESLRKLKEVVYPAIDQQHWFSNVDATHWLEYVRLLLAGAVRIADRIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDAHYRSLKGFQVLLEKEWLSFGHRFASRV-------GHGDGNHANSERSPLFVQFIDCVWQMTRQFPSAFEFNELFLITVLDHLFSCLFGTFLYNSEQERVSKEVYNKTVSLWSYVNSQIEEFTNPLYVNYE---HHVLYPIASLRHLELWVSYYVRWNPRMRPQVPI 582          
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Match: mtmr1b (myotubularin related protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-48])

HSP 1 Score: 425.631 bits (1093), Expect = 2.595e-139
Identity = 224/518 (43.24%), Postives = 316/518 (61.00%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            G L +T+++L F S   +S               F  LD+NL  G +   E         D   L I CKD R+     K +  S     K+L KY  P S N+ LFAF + +    E G++      EY+RQ + + +W ISKVN  +EVCETYP  + +P +V+++ +     FR K RFPVL WIHP+++A + R  QP  G + +R   DERYL++I DANA ++ L I DAR    A  N A+ GG E+++ Y ++  +FL IPNIHVMRES+RKL ++ YP  D  +W   ++ T WL Y+R +L G++ +A++I S + SV+VHCSDGWDRTAQ+TSL  LMLD ++R+++GFQ L++KEWL  GH+ + R        G        SER+P+F+QFIDCVWQ+T+QF +AFEFNE FLI ++D ++S LFG FL+NSEQ+R + EVY KT+S W +VNS IE++ NPL+   +   H VL+P   L  +  W SYY+R   + R Q PI
Sbjct:  115 GTLTITDFKLYFKSLTRDS--------------PF-VLDVNL--GAVSRLESIAVQSHGDDTQGLEIVCKDLRTPRFAYKKEGQSNLEMFKILSKYAFPLSHNLPLFAFKYRETF-PEDGWKIYDPVAEYKRQGLPNESWIISKVNSGYEVCETYPALLVLPSNVTEDELKRVAAFRAKRRFPVLSWIHPESQAAIVRCGQPQVGPSDRRCREDERYLQTILDANAQSHKLCIFDARQSTVADTNKAKDGGYENESFYINVELNFLEIPNIHVMRESLRKLKEVVYPAIDQQHWFSNVDATHWLEYVRLLLAGAVRIADRIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDAHYRSLKGFQVLLEKEWLSFGHRFASRV-------GHGDGNHANSERSPLFVQFIDCVWQMTRQFPSAFEFNELFLITVLDHLFSCLFGTFLYNSEQERVSKEVYNKTVSLWSYVNSQIEEFTNPLYVNYE---HHVLYPIASLRHLELWVSYYVRWNPRMRPQVPI 604          
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Match: mtmr1a (myotubularin related protein 1a [Source:ZFIN;Acc:ZDB-GENE-050522-518])

HSP 1 Score: 402.905 bits (1034), Expect = 4.979e-130
Identity = 226/540 (41.85%), Postives = 313/540 (57.96%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAE-KINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            GE I     +V      T    G L +T+Y+L F S   ++     F            LD+NL  G I   E         + + + I CKD RS     K +  S     + L KY  P S  + LFAF  +     E G++      EY+R  + + +W ISK+N N+EVC+TYP  +  P  + ++ I     FR K+R PVL WIHP+T+AT+ R SQP  G T +R + DE YL++I DANA ++ L I DAR    A  +  + GG E++N Y ++  +FL IPNIHVMRES+RKL ++ YP  +   WH A++ T WL YIR +L G++ +A+   +S+ SV+VHCSDGWDRTAQ+TSL  LMLD Y+RT+RGFQ L++KEW+  GHK + R G   E   +       SER+P+F+QFIDCVWQ+ +QF +AFEFNE FLI ++D +YS LFG FL+NSEQ+R   EV  KT+S W ++NS  E + NP +   D   H VL+P   L  +  W  YY+R   + R Q P+
Sbjct:  120 GETIKTTVKDVMYICPFTGAVTGTLTITDYKLYFVSLERDA----PFI-----------LDVNL--GAISRLETISVQSLGENTSGMEIVCKDMRSPRFAYKKEEQSKLEILETLTKYAFPLSNELSLFAF-QYKEQFPEDGWKVYDPVAEYKRMGLPNESWSISKINSNYEVCDTYPALLVTPTSIKEDEIRRVASFRVKHRIPVLSWIHPETQATIVRCSQPMVGPTDRRCKEDEHYLQTIMDANAQSHKLAIFDARQNTVAHNHKTKDGGYENENFYPNMELNFLEIPNIHVMRESLRKLKEVVYPTIEEQRWHSAIDATHWLEYIRLLLAGAVRIADKVESSKSSVVVHCSDGWDRTAQLTSLSMLMLDSYYRTLRGFQVLLEKEWISFGHKFAARIGHGDENHAN-------SERSPLFVQFIDCVWQMMRQFPSAFEFNELFLITILDYLYSCLFGTFLYNSEQERVEKEVNRKTVSLWSYINSQSEDFTNPFY--VDYENH-VLYPLASLRHLELWVGYYVRWNPRMRPQMPV 631          
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Match: MTMR2 (myotubularin related protein 2 [Source:NCBI gene;Acc:100494494])

HSP 1 Score: 418.313 bits (1074), Expect = 3.893e-137
Identity = 226/566 (39.93%), Postives = 330/566 (58.30%), Query Frame = 3
Query:  162 EVYDFKCGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDG--------NCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQL 1832
            E++ + C   +     +VT     +    G   +TNYRL F                  S++  + L L+ P+G I   EK  G        N + I CKD R++    K D  +     + L K+  P +  + LFAF  +  +  E G++      EY+RQ I + +WRI++VN  +E+C+TYP  + VP ++SD+ +     FR ++R PVL WIHP+++A +TR SQP  G+  KR++ DE+YL+SI DANA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES RKL ++ YP    +NW   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRT Q+TSL  +MLD Y+RTIRGF+ L++KEW+  GH+  QRT       G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL N E Q+    V  +++S W  +NS +E + NPL+   + S H VL+P      +  W  YY+R   ++R    I    ++L  ++   Q +L
Sbjct:   17 EIFAYTC--ILYLSAKDVTYICPFSGAYRGSFTVTNYRLYF-----------------RSLERDRHLVLDAPLGIISRIEKIGGAASRGENPNGIEIVCKDMRNIRFAYKQDLRTRKSVFENLVKFAFPLNYGLPLFAF-EYKEVFPENGWKVYDPIQEYRRQGIPNESWRITRVNERYELCDTYPACLVVPANISDDELRKIAAFRAQDRIPVLSWIHPESQAAITRCSQPLPGVNGKRSKEDEKYLQSIMDANAQSHKVFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESQRKLKEISYPSIQEANWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTPQLTSLAMIMLDGYYRTIRGFEVLVEKEWVSFGHRFYQRT-------GHGDKNHADADRSPMFLQFIDCVWQMTRQFPNAFEFNEHFLIIILDHLYSCLFGTFLCNCELQKLKEGVLEESVSLWSFINSQLEDFINPLYV--NYSSH-VLYPVTSTRNLELWAGYYIRWNPRTRPPGAINSRYKVLLAKRAELQKRL 552          
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Match: MTMR2 (myotubularin related protein 2 [Source:NCBI gene;Acc:100494494])

HSP 1 Score: 417.542 bits (1072), Expect = 4.050e-137
Identity = 222/537 (41.34%), Postives = 320/537 (59.59%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDG--------NCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQL 1832
            G   +TNYRL F                  S++  + L L+ P+G I   EK  G        N + I CKD R++    K D  +     + L K+  P +  + LFAF  +  +  E G++      EY+RQ I + +WRI++VN  +E+C+TYP  + VP ++SD+ +     FR ++R PVL WIHP+++A +TR SQP  G+  KR++ DE+YL+SI DANA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES RKL ++ YP    +NW   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRT Q+TSL  +MLD Y+RTIRGF+ L++KEW+  GH+  QRT       G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL N E Q+    V  +++S W  +NS +E + NPL+   + S H VL+P      +  W  YY+R   ++R    I    ++L  ++   Q +L
Sbjct:   29 GSFTVTNYRLYF-----------------RSLERDRHLVLDAPLGIISRIEKIGGAASRGENPNGIEIVCKDMRNIRFAYKQDLRTRKSVFENLVKFAFPLNYGLPLFAF-EYKEVFPENGWKVYDPIQEYRRQGIPNESWRITRVNERYELCDTYPACLVVPANISDDELRKIAAFRAQDRIPVLSWIHPESQAAITRCSQPLPGVNGKRSKEDEKYLQSIMDANAQSHKVFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESQRKLKEISYPSIQEANWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTPQLTSLAMIMLDGYYRTIRGFEVLVEKEWVSFGHRFYQRT-------GHGDKNHADADRSPMFLQFIDCVWQMTRQFPNAFEFNEHFLIIILDHLYSCLFGTFLCNCELQKLKEGVLEESVSLWSFINSQLEDFINPLYV--NYSSH-VLYPVTSTRNLELWAGYYIRWNPRTRPPGAINSRYKVLLAKRAELQKRL 537          
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Match: mtmr1 (myotubularin related protein 1 [Source:NCBI gene;Acc:734091])

HSP 1 Score: 417.927 bits (1073), Expect = 7.386e-137
Identity = 217/512 (42.38%), Postives = 311/512 (60.74%), Query Frame = 3
Query:  270 YRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDS-NSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            Y   FW   S +   + F     +++      L++P+G I   EK            + I CKD R++ L  K +  N ++ F+ L++    P S  + LFAF + +      G++    + EY+RQ + + +W+I+K+N+ +E+C+TYP    VP  V DE       FR K R PVL WIHP+++AT+TR SQP  G   KR + DE+YL++I DANA ++ L I DAR    A  N  +GGG ES++ Y +    FL I NIHVMRES+RKL ++ YP  D + W   ++ T WL YIR +L GS+ +A+++ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTI+GF+ L++KEW+  GH+ + R        G        ++R+PIFLQFIDCVWQ+T QF AAFEFNE FLI ++D +YS LFG FL+NSEQQR   E+ TKTLS W ++NS ++++ NP +   +   H VL+P   L  +  W +YY+R   ++R Q PI
Sbjct:   43 YICPFWGAVSGTLTVTDFKMYFKNVERDPPFILDVPLGVISRVEKIGVQSQGSHSYGIEIVCKDMRNLRLAYKQEEQNKLEIFENLIKNAF-PVSNKLPLFAFSYKEKFSVN-GWKVYDPTAEYKRQGLPNESWKITKINNTYELCDTYPAVFVVPTSVLDEDFARVVAFRAKGRIPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGYESESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPAIDEARWLSNVDGTHWLEYIRMLLAGSVRIADRVESSKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFEVLLEKEWISFGHRFAMRV-------GHGDDNHADADRSPIFLQFIDCVWQMTNQFPAAFEFNELFLITILDHLYSCLFGTFLYNSEQQRMKEEIQTKTLSLWSYINSHVDEFTNPFYVNYE---HHVLYPVASLSHLELWVNYYVRWNPRTRPQMPI 542          
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Match: MTMR2 (myotubularin related protein 2 [Source:NCBI gene;Acc:100494494])

HSP 1 Score: 417.927 bits (1073), Expect = 7.511e-137
Identity = 222/537 (41.34%), Postives = 320/537 (59.59%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDG--------NCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQL 1832
            G   +TNYRL F                  S++  + L L+ P+G I   EK  G        N + I CKD R++    K D  +     + L K+  P +  + LFAF  +  +  E G++      EY+RQ I + +WRI++VN  +E+C+TYP  + VP ++SD+ +     FR ++R PVL WIHP+++A +TR SQP  G+  KR++ DE+YL+SI DANA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES RKL ++ YP    +NW   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRT Q+TSL  +MLD Y+RTIRGF+ L++KEW+  GH+  QRT       G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL N E Q+    V  +++S W  +NS +E + NPL+   + S H VL+P      +  W  YY+R   ++R    I    ++L  ++   Q +L
Sbjct:   57 GSFTVTNYRLYF-----------------RSLERDRHLVLDAPLGIISRIEKIGGAASRGENPNGIEIVCKDMRNIRFAYKQDLRTRKSVFENLVKFAFPLNYGLPLFAF-EYKEVFPENGWKVYDPIQEYRRQGIPNESWRITRVNERYELCDTYPACLVVPANISDDELRKIAAFRAQDRIPVLSWIHPESQAAITRCSQPLPGVNGKRSKEDEKYLQSIMDANAQSHKVFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESQRKLKEISYPSIQEANWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTPQLTSLAMIMLDGYYRTIRGFEVLVEKEWVSFGHRFYQRT-------GHGDKNHADADRSPMFLQFIDCVWQMTRQFPNAFEFNEHFLIIILDHLYSCLFGTFLCNCELQKLKEGVLEESVSLWSFINSQLEDFINPLYV--NYSSH-VLYPVTSTRNLELWAGYYIRWNPRTRPPGAINSRYKVLLAKRAELQKRL 565          
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Match: mtmr1 (myotubularin related protein 1 [Source:NCBI gene;Acc:734091])

HSP 1 Score: 417.927 bits (1073), Expect = 1.355e-136
Identity = 217/512 (42.38%), Postives = 311/512 (60.74%), Query Frame = 3
Query:  270 YRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDS-NSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            Y   FW   S +   + F     +++      L++P+G I   EK            + I CKD R++ L  K +  N ++ F+ L++    P S  + LFAF + +      G++    + EY+RQ + + +W+I+K+N+ +E+C+TYP    VP  V DE       FR K R PVL WIHP+++AT+TR SQP  G   KR + DE+YL++I DANA ++ L I DAR    A  N  +GGG ES++ Y +    FL I NIHVMRES+RKL ++ YP  D + W   ++ T WL YIR +L GS+ +A+++ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTI+GF+ L++KEW+  GH+ + R        G        ++R+PIFLQFIDCVWQ+T QF AAFEFNE FLI ++D +YS LFG FL+NSEQQR   E+ TKTLS W ++NS ++++ NP +   +   H VL+P   L  +  W +YY+R   ++R Q PI
Sbjct:   70 YICPFWGAVSGTLTVTDFKMYFKNVERDPPFILDVPLGVISRVEKIGVQSQGSHSYGIEIVCKDMRNLRLAYKQEEQNKLEIFENLIKNAF-PVSNKLPLFAFSYKEKFSVN-GWKVYDPTAEYKRQGLPNESWKITKINNTYELCDTYPAVFVVPTSVLDEDFARVVAFRAKGRIPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGYESESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPAIDEARWLSNVDGTHWLEYIRMLLAGSVRIADRVESSKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFEVLLEKEWISFGHRFAMRV-------GHGDDNHADADRSPIFLQFIDCVWQMTNQFPAAFEFNELFLITILDHLYSCLFGTFLYNSEQQRMKEEIQTKTLSLWSYINSHVDEFTNPFYVNYE---HHVLYPVASLSHLELWVNYYVRWNPRTRPQMPI 569          
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Match: Mtmr2 (myotubularin related protein 2 [Source:MGI Symbol;Acc:MGI:1924366])

HSP 1 Score: 432.565 bits (1111), Expect = 5.876e-143
Identity = 231/555 (41.62%), Postives = 331/555 (59.64%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI-ADYSRILSRRKRI 1817
            GENI     +VT     T    G L +T+YRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S  + LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  KT+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:    9 GENIKDMAKDVTYICPFTGAVRGTLTVTSYRLYF-----------------KSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNGLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKKTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHSRYKELLAKRAEL 535          
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Match: Mtmr2 (myotubularin related protein 2 [Source:MGI Symbol;Acc:MGI:1924366])

HSP 1 Score: 432.95 bits (1112), Expect = 3.063e-142
Identity = 231/555 (41.62%), Postives = 331/555 (59.64%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI-ADYSRILSRRKRI 1817
            GENI     +VT     T    G L +T+YRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S  + LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  KT+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTSYRLYF-----------------KSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNGLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKKTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHSRYKELLAKRAEL 607          
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Match: Mtm1 (X-linked myotubular myopathy gene 1 [Source:MGI Symbol;Acc:MGI:1099452])

HSP 1 Score: 418.313 bits (1074), Expect = 5.808e-137
Identity = 218/540 (40.37%), Postives = 327/540 (60.56%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDP 1775
            GE ++ E+  + +  F+   + G + +TNYRL   S  ++S                 +L L++P+G I   EK  G          L I CKD R++   LK + +S     ++L K+  P + N+ LFAFV+ +  + + G+      +EY+RQ + +++WRIS +N  +E+CETYP  + VP   SD+ +     FR++NR PVL WIHP+ K  + R SQP  G++ KRN+ DE+YL  I++ N   + L I DARP +NA AN A GGG ES + Y +    FL+I NIHVMRES++K+ D+ YP  + S+W  +LE T WL +I+ +L G++ VA++++S + SVLVHCSDGWDRTAQ+TSL  LMLD ++RTI GF+ L+ KEW+  GHK + R        G        ++R+PIFLQFIDCVWQ+++QF  AFEFNE FLI ++D +YS  FG FLFN +  R   ++  +T+S W  +NS+ +K++NP +T   +  +RVL+P   +  +  W +YY+R   + + Q P
Sbjct:   40 GELLITEKEVIYICPFNGPIK-GRVYITNYRLYLRSLETDS-----------------ALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVD-GWTVYNPVEEYRRQGLPNHHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIMRCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDAYQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQVADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFASR-------IGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLFNCDSARERQKLTERTVSLWSLINSNKDKFKNPFYT---KEINRVLYPVASMRHLELWVNYYIRWNPRVKQQQP 550          
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Match: Mtm1 (X-linked myotubular myopathy gene 1 [Source:MGI Symbol;Acc:MGI:1099452])

HSP 1 Score: 418.313 bits (1074), Expect = 5.808e-137
Identity = 218/540 (40.37%), Postives = 327/540 (60.56%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDP 1775
            GE ++ E+  + +  F+   + G + +TNYRL   S  ++S                 +L L++P+G I   EK  G          L I CKD R++   LK + +S     ++L K+  P + N+ LFAFV+ +  + + G+      +EY+RQ + +++WRIS +N  +E+CETYP  + VP   SD+ +     FR++NR PVL WIHP+ K  + R SQP  G++ KRN+ DE+YL  I++ N   + L I DARP +NA AN A GGG ES + Y +    FL+I NIHVMRES++K+ D+ YP  + S+W  +LE T WL +I+ +L G++ VA++++S + SVLVHCSDGWDRTAQ+TSL  LMLD ++RTI GF+ L+ KEW+  GHK + R        G        ++R+PIFLQFIDCVWQ+++QF  AFEFNE FLI ++D +YS  FG FLFN +  R   ++  +T+S W  +NS+ +K++NP +T   +  +RVL+P   +  +  W +YY+R   + + Q P
Sbjct:   40 GELLITEKEVIYICPFNGPIK-GRVYITNYRLYLRSLETDS-----------------ALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVD-GWTVYNPVEEYRRQGLPNHHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIMRCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDAYQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQVADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFASR-------IGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLFNCDSARERQKLTERTVSLWSLINSNKDKFKNPFYT---KEINRVLYPVASMRHLELWVNYYIRWNPRVKQQQP 550          
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Match: Mtm1 (X-linked myotubular myopathy gene 1 [Source:MGI Symbol;Acc:MGI:1099452])

HSP 1 Score: 418.313 bits (1074), Expect = 5.808e-137
Identity = 218/540 (40.37%), Postives = 327/540 (60.56%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDP 1775
            GE ++ E+  + +  F+   + G + +TNYRL   S  ++S                 +L L++P+G I   EK  G          L I CKD R++   LK + +S     ++L K+  P + N+ LFAFV+ +  + + G+      +EY+RQ + +++WRIS +N  +E+CETYP  + VP   SD+ +     FR++NR PVL WIHP+ K  + R SQP  G++ KRN+ DE+YL  I++ N   + L I DARP +NA AN A GGG ES + Y +    FL+I NIHVMRES++K+ D+ YP  + S+W  +LE T WL +I+ +L G++ VA++++S + SVLVHCSDGWDRTAQ+TSL  LMLD ++RTI GF+ L+ KEW+  GHK + R        G        ++R+PIFLQFIDCVWQ+++QF  AFEFNE FLI ++D +YS  FG FLFN +  R   ++  +T+S W  +NS+ +K++NP +T   +  +RVL+P   +  +  W +YY+R   + + Q P
Sbjct:   40 GELLITEKEVIYICPFNGPIK-GRVYITNYRLYLRSLETDS-----------------ALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVD-GWTVYNPVEEYRRQGLPNHHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIMRCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDAYQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQVADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFASR-------IGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLFNCDSARERQKLTERTVSLWSLINSNKDKFKNPFYT---KEINRVLYPVASMRHLELWVNYYIRWNPRVKQQQP 550          
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Match: sp|A6QLT2|MTMR2_BOVIN (Myotubularin-related protein 2 OS=Bos taurus OX=9913 GN=MTMR2 PE=2 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.640e-143
Identity = 239/582 (41.07%), Postives = 344/582 (59.11%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRIFQTQLNRQPE-SDEETNIAQPAGEARQ 1895
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+KVN  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+++ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  + +     Q E S+  T+ ++ AG   Q
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLSLFAF-EYKEVFPENGWKLYDSLSEYRRQGIPNESWRITKVNERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADRVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPRRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYVRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAGSPAQ 634          
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Match: sp|Q5ZIV1|MTMR2_CHICK (Myotubularin-related protein 2 OS=Gallus gallus OX=9031 GN=MTMR2 PE=2 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 4.437e-143
Identity = 238/582 (40.89%), Postives = 346/582 (59.45%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRIFQTQLNRQPE-SDEETNIAQPAGEARQ 1895
            GE I     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L I CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WR+SK+N ++E+C+TYP  +AVP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL +SEQQR    +  KT+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+P+ + Y  +L++R  + +     Q E ++  T+ ++ AG   Q
Sbjct:    9 GETIKDMAKDVTYICPFTGAIRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLEIVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKVYDPIWEYRRQGIPNESWRLSKINEHYELCDTYPAILAVPVNIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLSLLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCSSEQQRVKESLPKKTVSLWSYINSQLEDFTNPLYV--SYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPVHNRYKELLAKRAELQKKVEELQREITNRSTSSSERAGSPAQ 562          
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Match: sp|Q13614|MTMR2_HUMAN (Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4)

HSP 1 Score: 436.032 bits (1120), Expect = 1.434e-142
Identity = 232/555 (41.80%), Postives = 332/555 (59.82%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 607          
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Match: sp|Q5REB9|MTMR2_PONAB (Myotubularin-related protein 2 OS=Pongo abelii OX=9601 GN=MTMR2 PE=2 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 9.583e-142
Identity = 231/555 (41.62%), Postives = 331/555 (59.64%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            GENI     +VT     T    G L +TNYRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S N+ LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RT RGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  +T+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYF-----------------KSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHEIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVIVHCSDGWDRTAQLTSLAMLMLDGYYRTTRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAEL 607          
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Match: sp|Q9Z2D1|MTMR2_MOUSE (Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3)

HSP 1 Score: 432.95 bits (1112), Expect = 2.143e-141
Identity = 231/555 (41.62%), Postives = 331/555 (59.64%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI-ADYSRILSRRKRI 1817
            GENI     +VT     T    G L +T+YRL F                  S++      L+  +G I   EK  G          L   CKD R++    K +  +     + L KY  P S  + LFAF  +  +  E G++      EY+RQ I + +WRI+K+N  +E+C+TYP  + VP ++ DE +     FR++ R PVL WIHP+++AT+TR SQP  G++ KR++ DE+YL++I D+NA ++ + I DARP +NA AN A+GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + ++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RTIRGF+ L++KEWL  GH+   R        G        ++R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS LFG FL NSEQQR    +  KT+S W ++NS +E + NPL+     S H VL+P   +  +  W  YY+R   + + Q+PI + Y  +L++R  +
Sbjct:   81 GENIKDMAKDVTYICPFTGAVRGTLTVTSYRLYF-----------------KSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNGLPLFAF-EYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRV-------GHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKKTVSLWSYINSQLEDFTNPLY--GSYSNH-VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHSRYKELLAKRAEL 607          
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Match: A0A5J4N919 (Myotubularin-related protein 1/2 OS=Paragonimus westermani OX=34504 GN=DEA37_0013131 PE=4 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 2.185e-157
Identity = 254/597 (42.55%), Postives = 361/597 (60.47%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIK-EFKSLDLNLPVGFIQEFEK---GDGNC----LTIKCKDFRSVTLKL------------KNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLS----------DEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKI-NSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEF--------------GSTSSTSQKS---ERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRIL-SRRKRIFQTQLNRQPESDEETNIAQPAGEA 1889
             G+L LTNY+ +F+ YN  +   S ++ +P+      +   L +P+G IQ  ++   G G C    L I CKD R + L L            + DS     F   +  Y  P      LFA+V       E  + N V S          DEY RQ I +N W+I+K+N ++ + +TYP  +AVP DVSDE +      R++ R PVL W+HP++KA+LTR+SQP  G+  +R+ +DE  ++ I+ ANA  N L I DARP +NA AN +RGGG+E+   Y ++ Y FLNI NIH MR ++  + ++C+P+P  S+W K L ++KWL +I+QI+  +  VA+KI N + SVLVHCSDGWDRTAQ+TSL  LMLDP++RT+RGF+ L++KEW   GHK +QRTGG T+                G  SS  + S   ER+P+FLQFIDCVWQ+TQQF  +FEFNE+FLI +MD +Y+  FG FLFN E Q R + V  +T+S W +V+SDI  Y+NPL+TPA+ SGHR++FPQ+ L  ++FW +YY+R +   R QDP+A   R L    KR  +     Q  +++    ++P+ EA
Sbjct:   38 TGILELTNYKFVFYQYNKQT-DASQYHTLPSFFGLHQRQFMLQVPLGVIQSIDQKHGGQGACRGLGLYIVCKDLRYIKLILTVCSDFHVHPFWEQDSGRSSGFYDKMRAYTFPSISKQPLFAYVF-----GEHCFANKVFSFNGWEVYRPEDEYHRQNIFTNGWKITKINMDYRLSDTYPAVLAVPWDVSDELLMACAPHRSRGRVPVLSWLHPESKASLTRASQPQVGVQGRRSAADEELVQQIRTANANANSLLIFDARPQMNAMANKSRGGGVENPTYYENVQYMFLNIQNIHAMRAALTNVFEVCFPQPKESDWFKFLADSKWLYHIKQIIFAATSVADKIENHKTSVLVHCSDGWDRTAQVTSLAMLMLDPFYRTLRGFEVLVEKEWCSFGHKFAQRTGGPTDGGVVLPLTGSTIAPLPGKNSSPGRPSNSEERSPVFLQFIDCVWQMTQQFPHSFEFNERFLITIMDELYAAKFGTFLFNCEMQARDHGVRERTVSLWSYVDSDIHSYQNPLYTPAEVSGHRIIFPQHSLAQLQFWSAYYVRWHPIMRLQDPVARRDRALVDVMKRFRELTTAAQRNTNDLPVSSKPSTEA 628          
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Match: A0A1S8X0I3 (Myotubularin phosphatase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_03947 PE=4 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.098e-155
Identity = 248/576 (43.06%), Postives = 354/576 (61.46%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIK-EFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEP-----GYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKI-NSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEF---------------GSTSS--TSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAG 1883
            G + LTNYR +F S+       S+++ +P  +    K   L +P+G IQ  E+         G  L I CKD R+V L L + + +   ++KL + Y  P      LFA+   +    E      G+      +EY RQ I +N W+++K+N ++ + +TYP  +AVP +V+DE +      R++ R PVL W+HP++KA+LTR+SQP  G+  +R+ +DE  ++ I+ ANA  N L I DARP +NA AN  RGGG+E+   Y ++ Y FLNI NIH MR S+  + + CYP P   NW KAL ++KWL +I+QI+  +  VA+KI N + SVLVHCSDGWDRTAQ+TSL  LMLDP++RT+RGF+ LI+KEW   GHK +QRTGG  +                 GS+ S   S   ER+P+FLQFIDCVWQ+TQQF  +FEFNE+FLI +MD VY+  FG FLFN E Q R + V  +T+S W ++NSD++ Y+NP++TPA+ SGHR++FPQ+ L  ++FW  YY+R +   RSQDP+    R L    + F+ +L    +     +IA+PA 
Sbjct:   39 GNVELTNYRFIF-SHQLKHGDASYYHTLPAFVGLTHKLFVLQVPLGVIQSIEQKHTVQAASKGIGLYIVCKDLRNVKLLLTDFARATTFYEKL-KAYAFPSISKQPLFAYTFGERCIAENVFPFNGWEVYTPEEEYHRQNIFTNGWKLTKINVDYRLSDTYPALLAVPWEVTDELLMACAPHRSRGRVPVLSWLHPESKASLTRASQPQVGMQGRRSAADEELVRLIRTANANANNLLIFDARPQMNAVANKGRGGGVENPTYYENVQYVFLNIQNIHAMRASLTNVYEACYPMPKEGNWFKALADSKWLYHIKQIIFAATSVADKIENHKSSVLVHCSDGWDRTAQVTSLAMLMLDPFYRTLRGFEVLIEKEWCSFGHKFAQRTGGPADGGVVMPSNAGMPPLPPNGSSISPKPSSADERSPVFLQFIDCVWQMTQQFPHSFEFNERFLITIMDEVYAARFGTFLFNCEMQARDHGVRERTVSLWSYMNSDLKSYQNPMYTPAEVSGHRIIFPQHSLVHLQFWSGYYVRWHPIMRSQDPVLRRDRALVDVMKRFR-ELTIAAQRTAAGDIAEPAA 611          
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Match: A0A4S2MG92 (Myotubularin phosphatase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000230 PE=4 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.808e-155
Identity = 246/576 (42.71%), Postives = 353/576 (61.28%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIK-EFKSLDLNLPVGFIQEFEK-------GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEP-----GYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKI-NSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEF---------------GSTSS--TSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAG 1883
            G + LTNYR +F S+       S ++ +P  +    K   L +P+G IQ  E+         G  L + CKD R+V L L + + +   ++KL + Y  P      LFA+   +    E      G+      +EY RQ I +N W+++K+N ++ + +TYP  +AVP +V+DE +      R++ R PVL W+HP++KA+LTR+SQP  G+  +R+ +DE  ++ I+ ANA  N L I DARP +NA AN  RGGG+E+   Y ++ Y FLNI NIH MR S+  + + CYP P   NW KAL ++KWL +I+QI+  +  VA+KI N + SVLVHCSDGWDRTAQ+T+L  LMLDP++RT+RGF+ LI+KEW   GHK +QRTGG  +                 GS+ S   S   ER+P+FLQFIDCVWQ+TQQF  +FEFNE+FLI +MD VY+  FG FLFN E Q R + V  +T+S W ++NSD++ Y+NP++TPA+ SGHR++FPQ+ L  ++FW  YY+R +   RSQDP+    R L    + F+ +L    +     +IA+PA 
Sbjct:   39 GSVELTNYRFIF-SHQLKHGDTSCYHTLPAFVGLTHKLFVLQVPLGIIQSIEQKHTVQAAAKGIGLYVVCKDLRNVKLLLTDLARATTFYEKL-KAYTFPSISKQPLFAYTFGERCIAENVFPFNGWEVYTPEEEYHRQNIFTNGWKLTKINVDYRLSDTYPALLAVPWEVTDELLMACAPHRSRGRVPVLSWLHPESKASLTRASQPQVGMQGRRSAADEELVRLIRTANANANNLLIFDARPQMNAVANKGRGGGVENPTYYENVQYVFLNIQNIHAMRASLTNVYEACYPMPKEGNWFKALADSKWLYHIKQIIFAATSVADKIENHKSSVLVHCSDGWDRTAQVTALAMLMLDPFYRTLRGFEVLIEKEWCSFGHKFAQRTGGPADGGVVMPPNTGMPPLPPNGSSVSPKPSSADERSPVFLQFIDCVWQMTQQFPHSFEFNERFLITIMDEVYAARFGTFLFNCEMQARDHGVRERTVSLWSYMNSDLKSYQNPMYTPAEVSGHRIIFPQHSLVHLQFWSGYYVRWHPIMRSQDPVLRRDRALVDVMKRFR-ELTIAAQRTAAGDIAEPAA 611          
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Match: A0A504YJP4 (Myotubularin protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_04294 PE=4 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 8.559e-155
Identity = 244/551 (44.28%), Postives = 342/551 (62.07%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFW-SYNSNSFGKSHFYE--IPNSIKEFKSLDLNLPVGFIQEFE--------KGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEP-----GYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKI-NSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEF----------------GSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRIL 1799
            +GLL LTNY+LLF  +       + H Y   I  + ++F    L +P+G IQ  E        +  G  L I CKD R + L L +++ +   +D+L   Y  P      LFA+V  +    E      G+      DEY RQ I +N W+++KVN ++ + +TYP  +AVP +VSDE +T     R++ R PVL W+HP++KA+LTR+SQP  G+  +R+ +DE  ++ I+ ANA  N L I DARP  NA AN  RGGG+E+   Y ++ Y FLNI NIH MR ++ K+ + C+P+P++  W KAL ++KWL +I+QI+  +  VA+KI N + SVLVHCSDGWDRTAQ+TSL  LMLDP++RT+RGF+ LI+KEW   GHK +QRTGG  +                  G T   S   ER+P+FLQFIDCVWQ+ QQF  +FEFNE+FLI +MD +Y+  +G FLFNSE Q R + V  +T+S W H+  D + Y NPL+TPA+ SGHRV+FPQ+ L  ++FW +YY+R +   R Q+P+A   R L
Sbjct:   37 SGLLELTNYKLLFCQTLKPQDANQYHTYPSFITYAQRQFV---LQIPLGVIQTIEQKHAQTGSRTGGLGLYIMCKDLRDIKLMLTDNARASLFYDQL-RAYAFPSISRQPLFAYVFGEKCLAEKVYHFNGWDVYDPEDEYHRQNIFTNGWKVTKVNADYRLSDTYPALLAVPWEVSDELLTACAPHRSRGRVPVLSWLHPESKASLTRASQPQVGVQGRRSAADEELVRQIRAANANANSLLIFDARPHANAVANKGRGGGVENPTYYENVQYMFLNIQNIHAMRAALTKIFEACFPRPEDGRWLKALADSKWLYHIKQIIFAATSVADKIENHKTSVLVHCSDGWDRTAQVTSLAMLMLDPFYRTLRGFEVLIEKEWCSFGHKFAQRTGGPADGGVVLPSGPNSSGPVASNGGTGRPSSPDERSPVFLQFIDCVWQMMQQFPHSFEFNERFLITIMDELYAARYGTFLFNSEMQARDHGVRERTISLWSHIAYDYKGYINPLYTPAEVSGHRVIFPQHSLAQLQFWTAYYIRWHPIMRLQEPVARRDRAL 583          
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Match: A0A4E0R1H9 (Myotubularin protein 2 OS=Fasciola hepatica OX=6192 GN=D915_007845 PE=4 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 9.329e-155
Identity = 244/551 (44.28%), Postives = 342/551 (62.07%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFW-SYNSNSFGKSHFYE--IPNSIKEFKSLDLNLPVGFIQEFE--------KGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEP-----GYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKI-NSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEF----------------GSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRIL 1799
            +GLL LTNY+LLF  +       + H Y   I  + ++F    L +P+G IQ  E        +  G  L I CKD R + L L +++ +   +D+L   Y  P      LFA+V  +    E      G+      DEY RQ I +N W+++KVN ++ + +TYP  +AVP +VSDE +T     R++ R PVL W+HP++KA+LTR+SQP  G+  +R+ +DE  ++ I+ ANA  N L I DARP  NA AN  RGGG+E+   Y ++ Y FLNI NIH MR ++ K+ + C+P+P++  W KAL ++KWL +I+QI+  +  VA+KI N + SVLVHCSDGWDRTAQ+TSL  LMLDP++RT+RGF+ LI+KEW   GHK +QRTGG  +                  G T   S   ER+P+FLQFIDCVWQ+ QQF  +FEFNE+FLI +MD +Y+  +G FLFNSE Q R + V  +T+S W H+  D + Y NPL+TPA+ SGHRV+FPQ+ L  ++FW +YY+R +   R Q+P+A   R L
Sbjct:   37 SGLLELTNYKLLFCQTLKPQDANQYHTYPSFITYAQRQFV---LQIPLGVIQTIEQKHAQTGSRTGGLGLYIMCKDLRDIKLMLTDNARASLFYDQL-RAYAFPSISRQPLFAYVFGEKCLAEKVYHFNGWDVYDPEDEYHRQNIFTNGWKVTKVNADYRLSDTYPALLAVPWEVSDELLTACAPHRSRGRVPVLSWLHPESKASLTRASQPQVGVQGRRSAADEELVRQIRAANANANSLLIFDARPHANAVANKGRGGGVENPTYYENVQYMFLNIQNIHAMRAALTKIFEACFPRPEDGRWLKALADSKWLYHIKQIIFAATSVADKIENHKTSVLVHCSDGWDRTAQVTSLAMLMLDPFYRTLRGFEVLIEKEWCSFGHKFAQRTGGPADGGVVLPGGPNSSGPVASNGGTGRPSSPDERSPVFLQFIDCVWQMMQQFPHSFEFNERFLITIMDELYAARYGTFLFNSEMQARDHGVRERTISLWSHIAYDYKGYINPLYTPAEVSGHRVIFPQHSLAQLQFWTAYYIRWHPIMRLQEPVARRDRAL 583          
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Match: mtmr2 (myotubularin related protein 2 [Source:NCBI gene;Acc:103046532])

HSP 1 Score: 433.721 bits (1114), Expect = 1.112e-142
Identity = 238/557 (42.73%), Postives = 340/557 (61.04%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC------LTIKCKDFRSVTLKLKNDSNSVDR-FDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFT--PADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRR----KRIFQTQ---LNRQPESDEETN 1865
            G L +TNYRLLF   N            P  +       L+LP+G I   +K  G          + CKD R++    K   +S+ +   ++L K+  P S N+ LFAF  ++ +  E G++      EY+RQ + + +WRISKVN ++E+C++YP  + VP  ++D+ +     FR K R PVL W+HP+++A + R SQP +G++ KR + DE+ L++I DANA ++ + I DARP +NA AN  +GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + S+W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  +MLD ++RT+ GFQ LI+KEW+  GH+  QR G      G  + T   ++R+PIFLQFIDCVWQ+TQQF AAFEFNE FLI L+D +YS LFG FL NSEQQR   E+  +T+S W  VNS +E++ NPL+   PA      VL P   +  ++ W SYY+R   + R Q+P+   Y  +L++R    KR+ + Q    NR   S E   
Sbjct:   98 GTLTVTNYRLLFRGINRE----------PGVV-------LDLPLGVISRVDKIGGASSRGDVSYHLFCKDMRNLRFVHKQPDDSLKKSVFEVLTKFAFPVSNNLSLFAF-EYNQVFPENGWKVYDPLAEYRRQGLPNESWRISKVNDHYELCDSYPAALVVPVTITDDELRRVAAFRAKGRIPVLSWLHPESQAAVVRCSQPMSGVSGKRCKEDEKLLQAIMDANAQSHKIFIFDARPSVNAAANKMKGGGCESEDAYQNAELVFLDIHNIHVMRESLRKLKEVVYPNIEESHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLSLIMLDSHYRTVTGFQKLIEKEWISFGHRFQQRVG-----HGDQNHTD--ADRSPIFLQFIDCVWQMTQQFPAAFEFNEYFLITLLDQLYSCLFGTFLCNSEQQRVKEELVKRTVSVWSLVNSQLEEFVNPLYVHYPA-----HVLLPSVSIRHLQLWVSYYIRWNPRMRPQEPVHQRYKELLAKRAELQKRVEELQREVANRASTSSERAG 624          
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Match: mtmr2 (myotubularin related protein 2 [Source:NCBI gene;Acc:103046532])

HSP 1 Score: 434.106 bits (1115), Expect = 1.904e-142
Identity = 236/563 (41.92%), Postives = 343/563 (60.92%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC------LTIKCKDFRSVTLKLKNDSNSVDR-FDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFT--PADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRIFQ--TQLNRQPESDEETNIAQPAGEARQI 1898
            G L +TNYRLLF   N            P  +       L+LP+G I   +K  G          + CKD R++    K   +S+ +   ++L K+  P S N+ LFAF  ++ +  E G++      EY+RQ + + +WRISKVN ++E+C++YP  + VP  ++D+ +     FR K R PVL W+HP+++A + R SQP +G++ KR + DE+ L++I DANA ++ + I DARP +NA AN  +GGG ES++ Y +    FL+I NIHVMRES+RKL ++ YP  + S+W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRTAQ+TSL  +MLD ++RT+ GFQ LI+KEW+  GH+  QR G      G  + T   ++R+PIFLQFIDCVWQ+TQQF AAFEFNE FLI L+D +YS LFG FL NSEQQR   E+  +T+S W  VNS +E++ NPL+   PA      VL P   +  ++ W SYY+R   + R Q+P+   Y  +L++R  + +   +L R+  +   T+  +     R I
Sbjct:  123 GTLTVTNYRLLFRGINRE----------PGVV-------LDLPLGVISRVDKIGGASSRGDVSYHLFCKDMRNLRFVHKQPDDSLKKSVFEVLTKFAFPVSNNLSLFAF-EYNQVFPENGWKVYDPLAEYRRQGLPNESWRISKVNDHYELCDSYPAALVVPVTITDDELRRVAAFRAKGRIPVLSWLHPESQAAVVRCSQPMSGVSGKRCKEDEKLLQAIMDANAQSHKIFIFDARPSVNAAANKMKGGGCESEDAYQNAELVFLDIHNIHVMRESLRKLKEVVYPNIEESHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLSLIMLDSHYRTVTGFQKLIEKEWISFGHRFQQRVG-----HGDQNHTD--ADRSPIFLQFIDCVWQMTQQFPAAFEFNEYFLITLLDQLYSCLFGTFLCNSEQQRVKEELVKRTVSVWSLVNSQLEEFVNPLYVHYPA-----HVLLPSVSIRHLQLWVSYYIRWNPRMRPQEPVHQRYKELLAKRAELQKRVEELQREVANRASTSSERAGSPTRSI 655          
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Match: mtmr1b (myotubularin-related protein 1-like [Source:NCBI gene;Acc:111191475])

HSP 1 Score: 428.713 bits (1101), Expect = 1.019e-140
Identity = 225/556 (40.47%), Postives = 331/556 (59.53%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPE 1847
            GE I     +V      +   +G L +T+Y+L F      S  +   + +  ++     L+    +G     E   G  L I CKD R+     K    S     ++L KY  P S N+ LFAF  +     E G++      EY+RQ + + +W ISK+N ++EVCETYP  + +P  +S++ +     FR K RFPVL WIHP+++A + R  QP  G + +R   DERYL+++ DANA ++ L I DAR    A  N A+ GG E+++ Y ++  +FL IPNIHVMRES+RKL ++ YP  D   W  +++ T WL YIR +L G++ +A++I S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+R++RGFQ L++KEWL  GH+ + R        G        SER+P+F+QFIDCVWQ+T+QF +AFEFNE FLI ++D +YS LFG FL+NSEQ+R + EV++KT+S W ++NS +E + NPL+   +   H VL+P   L  +  W SYY+R   ++R Q P+  + + L     + + +L R+ E
Sbjct:   85 GEIIKAIAKDVMYICPFSGAVSGTLTITDYKLYF-----KSLARDPPFVLDVNLGAVSRLET---IGVQSHGENTRG--LEIVCKDLRNPRFAYKKQEQSKLEIFEMLSKYAFPLSHNMTLFAF-RYQEKFPEDGWKVYDPVAEYKRQGLPNESWLISKINSSYEVCETYPALLVLPASISEDELKRVAAFRAKRRFPVLSWIHPESQAAIVRCGQPQVGPSDRRCREDERYLQTVLDANAQSHKLCIYDARQSSVADTNKAKDGGYENESFYPNVELNFLEIPNIHVMRESLRKLKEVVYPAIDEQRWFSSVDATHWLEYIRLLLAGAVRIADRIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRSLRGFQVLLEKEWLSFGHRFASRV-------GHGDQNHANSERSPLFVQFIDCVWQMTRQFPSAFEFNELFLITMLDHLYSCLFGTFLYNSEQERVSKEVFSKTVSLWSYINSQVEDFSNPLYVNCE---HHVLYPVASLRNLELWVSYYVRWSPRTRPQVPVHHHMKEL----LLMRAELQRRVE 615          
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Match: mtmr1b (myotubularin-related protein 1-like [Source:NCBI gene;Acc:111191475])

HSP 1 Score: 428.713 bits (1101), Expect = 2.762e-140
Identity = 225/556 (40.47%), Postives = 331/556 (59.53%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPE 1847
            GE I     +V      +   +G L +T+Y+L F      S  +   + +  ++     L+    +G     E   G  L I CKD R+     K    S     ++L KY  P S N+ LFAF  +     E G++      EY+RQ + + +W ISK+N ++EVCETYP  + +P  +S++ +     FR K RFPVL WIHP+++A + R  QP  G + +R   DERYL+++ DANA ++ L I DAR    A  N A+ GG E+++ Y ++  +FL IPNIHVMRES+RKL ++ YP  D   W  +++ T WL YIR +L G++ +A++I S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+R++RGFQ L++KEWL  GH+ + R        G        SER+P+F+QFIDCVWQ+T+QF +AFEFNE FLI ++D +YS LFG FL+NSEQ+R + EV++KT+S W ++NS +E + NPL+   +   H VL+P   L  +  W SYY+R   ++R Q P+  + + L     + + +L R+ E
Sbjct:  108 GEIIKAIAKDVMYICPFSGAVSGTLTITDYKLYF-----KSLARDPPFVLDVNLGAVSRLET---IGVQSHGENTRG--LEIVCKDLRNPRFAYKKQEQSKLEIFEMLSKYAFPLSHNMTLFAF-RYQEKFPEDGWKVYDPVAEYKRQGLPNESWLISKINSSYEVCETYPALLVLPASISEDELKRVAAFRAKRRFPVLSWIHPESQAAIVRCGQPQVGPSDRRCREDERYLQTVLDANAQSHKLCIYDARQSSVADTNKAKDGGYENESFYPNVELNFLEIPNIHVMRESLRKLKEVVYPAIDEQRWFSSVDATHWLEYIRLLLAGAVRIADRIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRSLRGFQVLLEKEWLSFGHRFASRV-------GHGDQNHANSERSPLFVQFIDCVWQMTRQFPSAFEFNELFLITMLDHLYSCLFGTFLYNSEQERVSKEVFSKTVSLWSYINSQVEDFSNPLYVNCE---HHVLYPVASLRNLELWVSYYVRWSPRTRPQVPVHHHMKEL----LLMRAELQRRVE 638          
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Match: mtm1 (myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-128])

HSP 1 Score: 418.698 bits (1075), Expect = 1.756e-137
Identity = 232/541 (42.88%), Postives = 321/541 (59.33%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSV-DRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPI 1778
            GE  + +++ + +  F+     G + +TNYRL F S ++ S                 ++ L++P+G I   EK  G          L I CKD R++   LK + +S  D F ++  KY  P S    LFAF+  +   +E G+      DEY+RQ + +  WRIS +N N+E+C+TYP  + VP   ++E +     FR++ R PVL WIH D +A + R SQP  G++ KRN+ DERYL  I++AN    L TI DARP +NA AN A GGG E  + Y +    FL+I NIHVMRES++KL D+ YP  + S+W  +LE T WL +I+ +L G++ VA+K++S  SV+VHCSDGWDRTAQ+TSL  LMLD YFRT RGFQ L++KEW+  GHK + R G      G  +   Q  +R+PIFLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS  FG FL+N E  R    V  KT+S W  +NS    Y NP +T   ES H VL+P   +  +  W +YY+R   + R Q P+
Sbjct:   40 GEERIIDKDLIYMCPFN-GALKGKVFITNYRLYFRSTDTES-----------------TVTLDVPLGNISRIEKMGGASSRGENSYGLDITCKDMRNLRFALKQEGHSRRDLFGEIF-KYAFPLSHGQPLFAFLSQEKF-EENGWNVYKPMDEYRRQGLPNERWRISFINSNYELCDTYPTILVVPFKATEEDLRRVATFRSRCRIPVLSWIHRDNQAVIMRCSQPLVGMSGKRNKDDERYLDIIREANGTTKL-TIYDARPNVNAVANKATGGGYEGDDAYQNAELVFLDIHNIHVMRESLKKLKDIVYPNVEESHWLSSLESTHWLEHIKLVLSGAIQVADKVSSGNSVVVHCSDGWDRTAQLTSLSMLMLDSYFRTFRGFQVLLEKEWIGFGHKFASRIG-----HGDKNHADQ--DRSPIFLQFIDCVWQMTKQFPTAFEFNEHFLITVLDHLYSCRFGTFLYNCESVRENYNVRAKTVSLWSLINSSTSIYMNPFYTA--ESSH-VLYPVASMRHLELWVNYYIRWNPRIRHQLPL 549          
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Match: mtm1 (myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-128])

HSP 1 Score: 424.861 bits (1091), Expect = 1.419e-140
Identity = 226/556 (40.65%), Postives = 334/556 (60.07%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNN-LLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADY-SRILSRRKRI 1817
            GE++  EE  VT          G L++T+YRL F S      G      +P          L++P+G +   EK  G          L + CKD R++    + + +S  +    L K+  P S +++LFAF + +  H E G++      EYQR  +++  W+ISK+N ++E+C+TYP  + VP++ +D+ +     FR++ R PVL W+HP   A+LTR SQP  G++ KR+  DERYL+ I  ANA  +  L I DARP +NA AN A+GGG E++  Y    + FL+I NIHVMRES+RKL +L +P    S W  +LE T WL +I+ +L G++ +AEK+  +R SVLVHCSDGWDRTAQ+++L  L+LDPY+RT+RGF+ L++KEW+  GHK  QR        G        S+R+PIFLQF+DCVWQ+T+QF  AFEFNE+FLI L+D +YS L+G F+ N E+ RR      KT+S W  VNS  +++ +PL+   D    RVL P + +  ++ W SYY+R    ++  DP+ +  S +L++R+ +
Sbjct:   20 GESVKAEEPGVTYLCPYAGKLRGTLVITSYRLYFQSKEREEEG------LP--------FTLDVPLGVVNRIEKAGGASSRGEDAYRLEVTCKDLRNLRFAHRQEGHSRRKVFDTLVKFAFPLSHSMRLFAFDYKERFH-EDGWKIYDPEKEYQRLGMDNPPWKISKLNESYELCDTYPTVLVVPRNATDDDLRRTAAFRSRGRLPVLSWLHPRNLASLTRCSQPQVGVSGKRSREDERYLQLIMMANASQSRRLAIYDARPGVNAIANKAKGGGYETEEAYPFAEFVFLDIHNIHVMRESLRKLKELVFPTVTESRWLSSLEATHWLEHIKAVLSGAIQIAEKLELERTSVLVHCSDGWDRTAQLSALAMLLLDPYYRTLRGFEVLVEKEWVSSGHKFQQRV-------GHGDKNHADSDRSPIFLQFVDCVWQLTKQFPTAFEFNERFLIMLLDNLYSCLYGTFMGNCEKGRRQERTREKTVSLWSMVNSRQQEFISPLY---DREYTRVLTPVHSMRQLQLWVSYYIRWDPIAQLPDPVEELCSNLLAKREEL 550          
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Match: mtmr9 (myotubularin related protein 9 [Source:ZFIN;Acc:ZDB-GENE-040724-223])

HSP 1 Score: 251.521 bits (641), Expect = 7.582e-75
Identity = 155/461 (33.62%), Postives = 235/461 (50.98%), Query Frame = 3
Query:  405 GDGNCLTIKCKDFRSVTLKL------KNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCY-PKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-----SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSD--IEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR 1745
            G    LTIKCKD R + L +       N ++S++    L    +         F    F+A+  E G+ + +   E+ R    + +WR+S VN +F VC +YP  V +PK + DE +     FR   RFPVL + H      + R SQP TG   KR + DE+ + ++           IID R +  A+   A+GGG E +  Y        +I   ++M++S  KL + C  P  +   W   LE + WL +I+ IL  + + A+ ++S R     SVLVH SDG D T Q+++L Q++LD   RT+RGFQ L+++EWL  GH   +R         S  +  +  + AP FL F+DC  QI +QF  +FEF E+FL+ L +  Y+  FG FL NSE +R   +V  KT+S W  VN    +E+Y NPL+ P + +    ++P      +  W+  +LR
Sbjct:   64 GTVGTLTIKCKDLRIILLHIPGMEECHNIASSIEVLSTLTAVNLY-----YPFFYRPMFEAL--EDGWHSFLPEHEFTRLTSHTADWRLSHVNKDFTVCPSYPPVVIIPKAIDDEMVKKVSAFRQNGRFPVLSYYHKTNGMVMMRCSQPLTGSGGKRCKDDEKLVNAVLGPGKRG---YIIDTRSLHIAQQARAKGGGYEPEAHYPQWRRINKSIERYNLMQDSFIKLVEACNDPSHNMDRWLSKLEASNWLGHIKDILTAACLAAQCLDSARTREGASVLVHGSDGTDSTLQVSALAQVILDQDCRTLRGFQALVEREWLQAGHPFQERCS------RSAFANVKPRQEAPSFLLFLDCCQQIQRQFPCSFEFGERFLVLLFEHAYASQFGTFLCNSELERMKMKVQQKTVSMWSWVNRPEVMEQYLNPLYEPNNLA----IWPSVAPQSLVLWEGVFLR 504          
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002170.1 (pep scaffold:Pmarinus_7.0:GL484749:1247:6808:1 gene:ENSPMAG00000001972.1 transcript:ENSPMAT00000002170.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 3.588e-47
Identity = 84/211 (39.81%), Postives = 120/211 (56.87%), Query Frame = 3
Query: 1203 SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLN 1835
            SVLVHCSDGWDRTAQ+ S+ +++LDPY+RT+RGF  LI+KEW+  GHK SQR G +              E +P+FLQ ++CVWQ++ QF  AFEF+E+ L  +    +S  FGNFL N E++R    V  KT S W  +    E++ NPL+         VL P     C RFW+  +      S S+  +A+    L ++ +  Q ++ 
Sbjct:    9 SVLVHCSDGWDRTAQVCSVAEILLDPYYRTLRGFLVLIEKEWISFGHKFSQRCGFV---------EGDAREVSPVFLQLLECVWQLSLQFPCAFEFSERLLTSVHAHTHSCQFGNFLGNCERERAQLRVKEKTYSLWAFLWDKREEFYNPLYRADHRQNRGVLKPNLAPQCFRFWRGMFDAQDGASYSRPQVAEAVSKLQKKTQRLQGEVT 210          
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Match: mtmr8 (myotubularin related protein 8 [Source:NCBI gene;Acc:393365])

HSP 1 Score: 147.132 bits (370), Expect = 3.017e-39
Identity = 90/265 (33.96%), Postives = 144/265 (54.34%), Query Frame = 3
Query:  405 GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVH---FDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAY--NNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKP-DNSNWHKALEETKWLNYIRQILLGSLMVA 1181
              G  L +  K FRS+ LK + + +  D     + K   P + +  LFAF +     A  +E G+    L  E++R  + + +W+++ +N N+EVC TYP ++ VP  +S + +  + +FR+K RFP L ++H    A + R SQP +G +  R   DE+ L+++  AN    +  L ++D RP +NA AN A G G E++  Y +I ++FL I NIHVMR S+ KL D+   +      +   LE + WL +I+ IL  S  VA
Sbjct:   70 AGGPLLLLHTKTFRSLHLKFQCEQDCQD-VQLSIVKLCRP-AHHRDLFAFSYSPRVRATDREEGWTLLDLRSEFRRMGVPNKHWKLTDINANYEVCGTYPADLFVPC-ISTDIVLGSARFRSKARFPTLSYLHAHNGAAICRCSQPLSGFS-TRCAEDEQLLQAVWRANPGPGHETLYVVDTRPKLNAMANRAAGRGYENEENYANIRFEFLGIENIHVMRSSLAKLLDVSQARGLSQREFVSGLEASGWLRHIQTILQASTAVA 330          
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Match: sbf1 (SET binding factor 1 [Source:ZFIN;Acc:ZDB-GENE-040718-139])

HSP 1 Score: 146.747 bits (369), Expect = 2.395e-36
Identity = 104/330 (31.52%), Postives = 168/330 (50.91%), Query Frame = 3
Query:  957 ANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNS---NWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQR---------RTNEVYTKTL-SFWDHVNSDIEK----YRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAGEARQ 1895
            A+ ++G GI+ + ++       +  P++  ++ S +KL   C P    S    ++K+LEE++WL  I+++L  + +V E ++   SV+V   +GWD T Q+ S+ QL+ DP++RT+ GF+ L++KEW+  GH+ S R+        + +  SQ S  AP+FLQF+DCV Q+  QF   FEFN+ +L  L     S  F  FL +S+ +R         +  ++ +K   S WD+V   I K    + N ++ PAD  G  VL P   L C+R W  YY+    +S  + P  D+  I  R               D  + + QP G   Q
Sbjct: 1351 ADKSQGKGIKFEGVH-GCEVLLVEYPDVRAVKASFKKLLRACVPSTSPSQDMTFYKSLEESEWLQQIQRLLQLAELVVELLDGGSSVMVSLEEGWDITTQLVSMVQLLSDPFYRTLDGFRLLVEKEWISFGHRFSHRS--------NQTLASQGSGLAPLFLQFLDCVHQVHNQFPTEFEFNQYYLKFLAYHFVSNRFRTFLLDSDYERIEMGMMYEEKGEKLGSKPARSLWDYVER-IHKTSPVFYNYMYMPAD--GEEVLQPFSMLACLRVW-DYYVE---ESLGEGPSFDWELINGR--------------CDVASEVEQPDGTVPQ 1650          

HSP 2 Score: 62.003 bits (149), Expect = 5.233e-10
Identity = 30/69 (43.48%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  633 ESNNWRISKVNHNFEVCE--TYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQP 833
            +S  +RIS VN  +  C   +YP  + VP++V D T+    +   +NRFPV+CW H  TKA L RSS P
Sbjct: 1138 KSEIYRISTVNRMYGTCRRCSYPGLLIVPQNVQDSTLQKISRCYRQNRFPVICWRHSQTKAVLLRSSGP 1206          
BLAST of Myotubularin-related protein 2 vs. Ensembl Yeast
Match: YMR1 (Phosphatidylinositol 3-phosphate (PI3P) phosphatase; involved in various protein sorting pathways, including CVT targeting and endosome to vacuole transport; has similarity to the conserved myotubularin dual specificity phosphatase family [Source:SGD;Acc:S000003871])

HSP 1 Score: 174.866 bits (442), Expect = 1.396e-46
Identity = 129/446 (28.92%), Postives = 206/446 (46.19%), Query Frame = 3
Query:  612 EYQRQLIESNN----WRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYL----KSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYT-----------------SISYDFLNIPNIHV-------MRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLG-SLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSST-------------------------SQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLI-------DLMDAVYSGL-------------------------FGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESG 1679
            E++RQ ++S +    WR+S VN ++E C TYP ++ VP+  SD  + +A +FR++ R PVL + H  T   + RSSQP  GL  +R+  DE+ +     S  + +       I+DARP  NA A MA GGG E+ + Y                  +++  FL I NIH+       M E + +  DL  P     N  ++ + + WL     IL    +++   I +  +VLVHCSDGWDRT+Q+ SL ++ LDP++RT  GF  L++K+W   GH+  +R+G L  +     +T                         ++  E        I+ + +I+++F   F+ N++ L          +D VY  L                         +G FL NSE+++    +  KT S WD+  S  +++ NP F     SG
Sbjct:  164 EFRRQGLDSKDETCPWRLSTVNEHYEFCPTYPSKLFVPRSTSDILLKHASKFRSQKRIPVLTYHHKATDCNILRSSQPLPGLINQRSIQDEKLVWESFNSFCNKDIRRTKHVIVDARPRTNALAQMALGGGTENMDNYNFFLADNNMGVDKSLKLPTVTRLFLGIDNIHIVSNTAAYMTEVICQGGDLNLPL--EQNLIRSQKFSNWLKLNTLILKSVDMLLKSIIFNHSNVLVHCSDGWDRTSQVVSLLEICLDPFYRTFEGFMILVEKDWCSFGHRFLERSGHLNSDIRFHDNTMHSNFNDVDTNGDDLDIGVNTQDDYAEDDEGGEDETNLIN-LSRISKKFNENFKLNKKSLKFVSPVFQQFLDCVYQLLTQNPDLFEFNERFLRRLVYHLYSCQYGTFLSNSEKEKFQQNLPNKTKSVWDYFRSRRKQFINPNFIQRKRSG 606          
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Match: EDO44480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVM7])

HSP 1 Score: 412.92 bits (1060), Expect = 1.919e-135
Identity = 217/530 (40.94%), Postives = 314/530 (59.25%), Query Frame = 3
Query:  183 GENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR 1745
            GE       +VT     T    G L +TNY+L F + +          +IP +++        +P+G I   EK  G          L I CKDFR++    K +++S     + +  Y  P S     FA+   D      G+       E++R  + ++ W ++++N  +E+ +TYP  V VP  VSDE I     FR++NR PVLCW+HP   A++TR+SQP  GL   RN+ DE+Y ++I +AN   + L I DARP INA AN A+GGG E++  Y +    FL+I NIHVMRES+RKL D+C+P  D+++W   LE TKWL++I+ I+ G++ +A+ ++  R SV+VHCSDGWDRT Q+T+L  L++DPY+RTI GF+ LI+KEWL  GHK +QR       +G         +R+P+FLQFIDCVWQ+T+QF  AFEFNE FLI ++D +YS +FG FL+NSE QR   +V T+T S W ++N+ + +++NPL+ P       VLFP   L  +  W  YY+R
Sbjct:   43 GEKPQATAKDVTYLCPFTGPVRGFLYITNYKLFFKADD----------DIPFTVE--------VPLGTIYRVEKIGGTTSRGENAYGLEIYCKDFRNLRFAHKQENHSRRLIYERIMHYAFPASNGKPYFAYSFKDEFEYN-GWDVYDAEKEFERLGLPTDCWYVTRINEKYELSDTYPAVVGVPSSVSDEDIKKVAVFRSRNRLPVLCWLHPTNNASITRASQPNRGLL-ARNKDDEKYFQAILEANPQCHKLLIFDARPRINAVANQAKGGGYETEENYQNTEVIFLDIANIHVMRESLRKLKDICFPNIDDTHWLTNLENTKWLDHIKMIMAGAVRIADAVDRCRTSVVVHCSDGWDRTPQLTALAMLLMDPYYRTIIGFEVLIEKEWLSFGHKFNQR-------YGHGDKNHADDQRSPVFLQFIDCVWQVTRQFPCAFEFNETFLITILDHLYSCMFGTFLYNSESQREKEDVKTRTTSLWSYINTSMMEFKNPLYAPYLH--QHVLFPVPSLRRLELWTRYYIR 543          
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Match: EDO34710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNP0])

HSP 1 Score: 326.635 bits (836), Expect = 1.645e-101
Identity = 182/513 (35.48%), Postives = 289/513 (56.34%), Query Frame = 3
Query:  228 FSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVH---FDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLC--YPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRH 1748
            FS K   G L LT   L+F     +  G    + + + I   + L LN             G+ L I+CK F++ TL +  +    D +  LL  + + R +   L+AF +    + + +  G+    +  +Y R  + S+ W  +++N ++E+C+TYP+ + VPK  + E +  + +FR++ R PVL + H  T+A + R SQP  G    R   DE+ ++++ ++N  +  + I+D RP +NA AN A G G ES++ Y ++ + F+ I NIHVMR+S+ K+ ++    PK     ++  LE + WL +I+ IL  S+ +A+ +  ++ SVLVHCSDGWDRTAQ  SL  ++LDPY+RTI GFQ LI+KEWL  GHK + R G L          S + E +P+FLQF++ +WQ+ QQF  +F+FNE+FL+ L D VYS  FG FL N +++RR   +  +T S W ++  +I  Y NPL+    +     L+P      IRFW++ Y R+
Sbjct:   22 FSKKVSRGTLYLTPTHLIF----VDPVGAKETWILHSHILSLEKLPLN-----------AAGSPLRIRCKTFQNATLIIPKEKECHDIYTALL--FFSNREKLEDLYAFSYSPQTEKLTQSAGWALFDIKSDYTRMGVPSDLWTATQLNKDYELCDTYPNILYVPKSATKEVLVGSSRFRSRGRLPVLSFYHKSTQAAVCRCSQPLGGFK-GRCPEDEQMIQALLNSNPNSKFIYIVDTRPRLNALANRAAGKGYESEDFYENVKFQFVGIENIHVMRQSLFKMLEVVGESPKTPAGAFYSGLEASNWLKHIKNILDTSVFIAKAVAMEKASVLVHCSDGWDRTAQTCSLASIILDPYYRTIHGFQVLIEKEWLSFGHKFTDRCGLL---------QSDQKEFSPVFLQFLESIWQLLQQFPFSFQFNERFLLTLHDHVYSCQFGTFLGNCQKERRDLGLPKRTYSLWGYMWQNISDYANPLYREVTQDD--ALWPDTSPQAIRFWRAMYNRY 505          
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Match: EDO39920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S7])

HSP 1 Score: 291.967 bits (746), Expect = 9.747e-90
Identity = 178/545 (32.66%), Postives = 255/545 (46.79%), Query Frame = 3
Query:  204 ENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNS--------VLSDEYQRQLIES---NNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDA------------------NAYN-------------------------NLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQ-RSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADE 1673
            E N    +F T   +  L L+N+RL                        FK   LN+P+  I+  E  D   L + CKD RS  +   ++  SVD   K+  K + P S    LFAF H+      P    S           +E  R   E+   + WRIS  N +FEVC TYP    +P  +SD  +     FR   RFP + W H    A + R SQP  G    R+  DE  L++I  A                  N  N                           + I+DAR    A AN  +GGG E    Y +    F+N+ NIH +R S   L  LC    D  NW   +E+T WL++I  ++  ++ +   +++  R V+VHCSDGWDRT QI +L +L+LDP++RTI GF+ LID+EWL  GH+ + R G          S   ++ER P+FLQ++DCV Q+ +QF ++FEF+E +LI L+   YS LFG FL N+E  R T+ +  +TLS W ++    + +RN L+    +
Sbjct:   35 ELNGECVEFLTATADATLALSNFRLFI---------------------TFKCSFLNIPLMLIESVELRDLFILQVNCKDARSFRIVFDSNDQSVDWLHKVSAKIL-PYSRIEDLFAFAHYAWSMASPNSFTSQDASATPYSFLEEVHRMGFETGVDSPWRISDANSSFEVCRTYPRLHVIPSSISDSDLAKVASFRCSGRFPSIVWRHMTNGAVIARCSQPQVGWLGWRSAEDELLLQAIGQACTSDRYPSVAKLLNGITVNGINKKHDMGDVLNGPADMSEDGPIARNPKQVLIVDARSYTAAYANRGKGGGFEYTEYYPNCEVMFMNLANIHGIRRSFHSLRALCSGSYDVPNWWSLIEKTNWLHHISMLIKSAVTIVHAVHTDGRPVVVHCSDGWDRTTQIVALAELLLDPFYRTIEGFKILIDREWLQFGHRFADRCG--------HGSDIDENERCPVFLQWLDCVHQLQKQFPSSFEFSETYLIKLLHHTYSCLFGTFLGNNEHGRHTDAIKARTLSVWSYILPRKKDFRNLLYAGGGD 549          
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Match: EDO33774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR96])

HSP 1 Score: 259.61 bits (662), Expect = 1.877e-77
Identity = 174/531 (32.77%), Postives = 270/531 (50.85%), Query Frame = 3
Query:  207 NNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEK---GDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKL-FAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATG-LTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKA-LEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSD--IEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQD 1772
            +NV L   +T    G L +T + L+F                  S +  +S +L L +  ++  EK   G    LTI CK+F  V +++ ND          ++      ++ +K  F + H  A+  E G+       ++ +    + +WRIS VN N+EVC +YP  V VP  VSD+ +  + QFR   RFPVLC+ H  T++ L RS +P  G ++ KR + DE+ + S   +        I+D R       + ++GGG+E ++ Y        NI    V+ +S+ KL + C+ +  + N + + LE   W++ I+ +L  +  VA  +++    VLVH   G D T Q+TSL Q++LDP  RT+RGFQ+L+D+EW+  GH  S R   +   F ST    Q     P+FL F+DCVWQI QQF  +FEF++ FLI L +  Y   FG FL N+E+ R T ++  KT+S W ++N D  +E   NP++    E    VL+P      +  W   YL+   Q R+ D
Sbjct:   13 DNVLLKRRNTPYIEGTLCITGHHLIF------------------SSRTQRSEELFLLISGVEHVEKKFVGQEAILTICCKNFDLVKMRI-NDMEKALNLISTIDALSTLENQTLKYPFFYRHVGALSGEDGWDMFSNDLDFAKVCSSTQSWRISHVNINYEVCASYPTSVIVPLGVSDDELKASAQFRHGARFPVLCYFHKATQSVLMRSGEPLCGSMSNKRCKEDEKLVNSALGSMKKG---MIVDTRSTPAVMNSRSKGGGLEPESNYPQWKRSNHNIEKHTVLIDSVCKLMEACFDQNLSMNAYLSRLESCGWMDQIQAVLGTACYVAHCLHTDGIPVLVHDGAGLDATLQVTSLSQVILDPDCRTVRGFQSLVDREWIRGGHPFSNRCTRVG--FSSTKYKGQ----GPVFLLFLDCVWQIYQQFPCSFEFHDSFLICLFEHAYYSQFGTFLCNNEKNRVTVKLKEKTISLWSYLNQDEILEDMLNPMY----ERNESVLWPSVAPQSLVLWPGLYLKWQKQQRNGD 511          
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Match: EDO48708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH6])

HSP 1 Score: 198.749 bits (504), Expect = 9.027e-59
Identity = 107/250 (42.80%), Postives = 149/250 (59.60%), Query Frame = 3
Query:  999 YTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRH 1748
            Y   S  FL+IPNIH +R+S+ +L  +C        W   LE T+WL YI  IL G+  +A  ++   S LVHCSDGWDRT+Q+T L QL+LDPY+RT  GFQ LI+KEW+  GH+   R G  T            S+R+PIFLQF+DCVWQ+ +QF +AF+F   +L+ L D V S  FGNFL+N+ Q+R    +   T+S W H+N+  + Y N ++ P +      L P   L  ++ W  Y+LR+
Sbjct:    1 YQGCSLVFLDIPNIHAVRDSLDRLQAVC-ESSSQKKWLSHLESTQWLAYIAAILKGATTIARFVDKGVSTLVHCSDGWDRTSQLTLLAQLLLDPYYRTFTGFQVLIEKEWISFGHRFRDRLGHPT----------CPSQRSPIFLQFLDCVWQVHKQFPSAFQFTANYLLKLADHVNSQWFGNFLYNNVQERHHAFITRTTVSLWSHLNAVKDNYTNSIYQPTE-----TLVPVSSLRRLQLWSDYFLRY 234          
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Match: mtmr2 (myotubularin related protein 2 [Source:NCBI gene;Acc:101157315])

HSP 1 Score: 435.261 bits (1118), Expect = 6.657e-144
Identity = 226/528 (42.80%), Postives = 331/528 (62.69%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGN---CLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            G +MLTNYRL F                  S +   +  L++P+G ++  E    +      I CKD R++    K    +     +++ K+  P S  ++LFAF H+  +  E G++      EY+RQ I + +WRI+K+N ++E+C+TYP  + VP ++ D+ +     FR K R PVL WIHP+++AT+TR SQP  G+  KR + DE+YL++I DANA ++ L I DARP ++A AN  +GGG+ES++ Y +    FL+I NIHVMRES+RK+ +  YP  D+++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRT Q+TSL  LMLD Y+RTIRGF+ LI+KEWL  GH+  QR G      G  + T   +ER+P+F+QF+DCVWQ+T+QF +AFEFNE FLI +++ ++S LFG FL N EQQR   EV  KT+S W ++NS +E++ NP +   + S H VLFP   L  +  W SYY+R   + R Q+P+   Y  +L++R  +
Sbjct:   53 GTVMLTNYRLFF-----------------KSTEREPTFMLDMPLGVVRRVEIYRTHRDVSYDIICKDTRNLRFLQKYPEETKKSIFEVMTKFAFPVSNGLQLFAF-HYQQVFPENGWKVYDALAEYKRQGIPNESWRITKINDHYELCDTYPASLVVPVNIPDDELKKVAAFRGKGRIPVLSWIHPESQATVTRCSQPMAGVNGKRCKEDEKYLQAIMDANAQSHKLFIFDARPNVSALANKMKGGGVESEDAYQNAELVFLDIHNIHVMRESLRKVKEAIYPNIDDAHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTTQLTSLAMLMLDGYYRTIRGFEILIEKEWLSFGHRFQQRIG-----HGDKNYTD--AERSPVFVQFVDCVWQLTRQFPSAFEFNEYFLITILEHLFSCLFGTFLCNCEQQRLKEEVPKKTVSLWSYINSQLEEFTNPFY--VNYSNH-VLFPVVSLHHLELWVSYYIRWNPRMRPQEPLHQRYKELLAKRAEL 552          
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Match: mtmr2 (myotubularin related protein 2 [Source:NCBI gene;Acc:101157315])

HSP 1 Score: 436.417 bits (1121), Expect = 1.370e-143
Identity = 226/528 (42.80%), Postives = 331/528 (62.69%), Query Frame = 3
Query:  249 GLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGN---CLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIAD-YSRILSRRKRI 1817
            G +MLTNYRL F                  S +   +  L++P+G ++  E    +      I CKD R++    K    +     +++ K+  P S  ++LFAF H+  +  E G++      EY+RQ I + +WRI+K+N ++E+C+TYP  + VP ++ D+ +     FR K R PVL WIHP+++AT+TR SQP  G+  KR + DE+YL++I DANA ++ L I DARP ++A AN  +GGG+ES++ Y +    FL+I NIHVMRES+RK+ +  YP  D+++W   LE T WL +I+ IL G+L +A+K+ S + SV+VHCSDGWDRT Q+TSL  LMLD Y+RTIRGF+ LI+KEWL  GH+  QR G      G  + T   +ER+P+F+QF+DCVWQ+T+QF +AFEFNE FLI +++ ++S LFG FL N EQQR   EV  KT+S W ++NS +E++ NP +   + S H VLFP   L  +  W SYY+R   + R Q+P+   Y  +L++R  +
Sbjct:  104 GTVMLTNYRLFF-----------------KSTEREPTFMLDMPLGVVRRVEIYRTHRDVSYDIICKDTRNLRFLQKYPEETKKSIFEVMTKFAFPVSNGLQLFAF-HYQQVFPENGWKVYDALAEYKRQGIPNESWRITKINDHYELCDTYPASLVVPVNIPDDELKKVAAFRGKGRIPVLSWIHPESQATVTRCSQPMAGVNGKRCKEDEKYLQAIMDANAQSHKLFIFDARPNVSALANKMKGGGVESEDAYQNAELVFLDIHNIHVMRESLRKVKEAIYPNIDDAHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTTQLTSLAMLMLDGYYRTIRGFEILIEKEWLSFGHRFQQRIG-----HGDKNYTD--AERSPVFVQFVDCVWQLTRQFPSAFEFNEYFLITILEHLFSCLFGTFLCNCEQQRLKEEVPKKTVSLWSYINSQLEEFTNPFYV--NYSNH-VLFPVVSLHHLELWVSYYIRWNPRMRPQEPLHQRYKELLAKRAEL 603          
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Match: mtm1 (myotubularin 1 [Source:NCBI gene;Acc:101168528])

HSP 1 Score: 428.328 bits (1100), Expect = 5.890e-141
Identity = 244/577 (42.29%), Postives = 343/577 (59.45%), Query Frame = 3
Query:  150 NLLQEVYDFKCGENIV-KEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNC--------LTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLR--HYLQSRSQDPIAD-YSRILSRR----KRIFQTQL 1832
            +LL  V      E I+ K+   +  F+ + KG+   +++TNYRL F                 NS+     + L++P+G I   EK  G          L I CKD R++   LK + +S     +LL +Y  P S    LFA+++ +    E G+      +E++RQ + +N WRI+ +N N+E+C+TYP  +AVP   ++E +     FR++ R PVL WIH + KA + R SQP  G++ KRN+ DERYL  I++AN    L TI DARP +NA AN A GGG E    Y +    FL+I NIHVMRES++KL D+ YP  + S+W  +LE T WL +I+ +L G++ VA+K++   SV+VHCSDGWDRTAQ+TSL  LMLD +FRT+RG Q LI+KEW+  GHK + R G      G  + T Q  +R+PIF+QFIDCVWQ+T+QF  AFEFNE  L+ ++D +YS  FG FL+N E  R  NEV TKTLS W  VNS +E Y NP +TP  ESG RVL+P   +  +  W +YY+R    +Q + Q P+   Y  +L+ R    K++ Q Q+
Sbjct:   27 DLLANVSLLPGEERIIDKDVIYICPFNGAVKGK---VLITNYRLYF-----------------NSVDLDVLVSLDVPLGAISRVEKMGGASSRGENSYGLDITCKDMRNLRFALKQEGHSRRDLFELLFRYAFPLSHGSPLFAYLNQEKF-PENGWSIYKPVEEFRRQGLPNNKWRITFINKNYELCDTYPTVLAVPFKSTEEDLKRVATFRSRGRIPVLSWIHRENKAVIVRCSQPLVGMSGKRNKDDERYLDLIREANDTTKL-TIYDARPSVNAVANKATGGGYEGDE-YQNAELVFLDIQNIHVMRESLKKLKDIVYPTVEESHWLSSLESTHWLEHIKLVLSGAIQVADKVSGGHSVVVHCSDGWDRTAQLTSLAMLMLDSHFRTLRGLQVLIEKEWISFGHKFASRIG-----HGDKNHTDQ--DRSPIFVQFIDCVWQMTKQFPTAFEFNENLLLTILDHLYSCRFGTFLYNCESARDQNEVRTKTLSLWSLVNSKMEIYLNPFYTP--ESG-RVLYPVASMRHLELWVTYYIRWNPRIQHQQQSPVEQRYRELLALRDEYLKKLEQLQM 570          
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Match: mtmr1a (myotubularin-related protein 2 [Source:NCBI gene;Acc:101157977])

HSP 1 Score: 410.223 bits (1053), Expect = 1.937e-133
Identity = 226/542 (41.70%), Postives = 321/542 (59.23%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPV-------GFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPE 1847
            +G L +T+Y+L F S       +S F            LD+NL V        F  + E   G  L + CKD RS     K +       D +L KY+ P S N+ LFAF + +    + G++    + EY+RQ + + +W IS+VN  +E+C+TYP  + +P ++++E +     FR ++R PVL WIHP+++AT+ R SQP  G + +R + DER L+ I DANA ++ LTI DAR    A +N A+ GG ES++ Y +    FL IPNIHV+RES RKL D+ YP  D ++WH A+++T WL YIR +L G+  VA K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RT+ GFQ L++KEW+  GHK   R G   ++          SER+P+F+QF+DCVWQ+T+QF +AFEFNE FLI ++D +YS LFG FL NSEQ+R   EV TKT S W ++NS  E + NP +   +   + VL+P      +  W  Y+ R     RSQ P+    + L     I + +L R+ E
Sbjct:  111 SGTLTITDYKLYFTSGEK----ESPFV-----------LDINLGVISRLEAISFPDQEEMTKG--LELVCKDMRSPRFAFKFEETQPSVVD-VLNKYVFPLSHNLPLFAFQYKETFPAD-GWKVYDAAAEYRRQGLPNESWTISRVNSIYELCDTYPSTLVIPTNITEEDLKRVASFRARHRVPVLSWIHPESQATIVRCSQPLVGPSDRRCKEDERLLQVIMDANAQSHKLTIFDARQSSVAISNKAKDGGFESESFYANAELIFLEIPNIHVIRESQRKLKDMLYPTIDEAHWHSAIDQTHWLEYIRLLLAGAAKVAHKVESGKSSVVVHCSDGWDRTAQLTSLSMLMLDGYYRTLTGFQVLVEKEWISFGHKFCARVGHGDKDHAD-------SERSPLFVQFVDCVWQMTRQFPSAFEFNELFLITVLDYLYSCLFGTFLCNSEQERVAQEVQTKTASLWSYINSQSEDFTNPFY---ENYQNHVLYPLASSRHLELWTGYHARWNPHMRSQVPVHQTLKEL----LILRAELQRKVE 619          
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Match: mtmr1a (myotubularin-related protein 2 [Source:NCBI gene;Acc:101157977])

HSP 1 Score: 410.609 bits (1054), Expect = 3.042e-133
Identity = 226/542 (41.70%), Postives = 321/542 (59.23%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPV-------GFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPE 1847
            +G L +T+Y+L F S       +S F            LD+NL V        F  + E   G  L + CKD RS     K +       D +L KY+ P S N+ LFAF + +    + G++    + EY+RQ + + +W IS+VN  +E+C+TYP  + +P ++++E +     FR ++R PVL WIHP+++AT+ R SQP  G + +R + DER L+ I DANA ++ LTI DAR    A +N A+ GG ES++ Y +    FL IPNIHV+RES RKL D+ YP  D ++WH A+++T WL YIR +L G+  VA K+ S + SV+VHCSDGWDRTAQ+TSL  LMLD Y+RT+ GFQ L++KEW+  GHK   R G   ++          SER+P+F+QF+DCVWQ+T+QF +AFEFNE FLI ++D +YS LFG FL NSEQ+R   EV TKT S W ++NS  E + NP +   +   + VL+P      +  W  Y+ R     RSQ P+    + L     I + +L R+ E
Sbjct:  132 SGTLTITDYKLYFTSGEK----ESPFV-----------LDINLGVISRLEAISFPDQEEMTKG--LELVCKDMRSPRFAFKFEETQPSVVD-VLNKYVFPLSHNLPLFAFQYKETFPAD-GWKVYDAAAEYRRQGLPNESWTISRVNSIYELCDTYPSTLVIPTNITEEDLKRVASFRARHRVPVLSWIHPESQATIVRCSQPLVGPSDRRCKEDERLLQVIMDANAQSHKLTIFDARQSSVAISNKAKDGGFESESFYANAELIFLEIPNIHVIRESQRKLKDMLYPTIDEAHWHSAIDQTHWLEYIRLLLAGAAKVAHKVESGKSSVVVHCSDGWDRTAQLTSLSMLMLDGYYRTLTGFQVLVEKEWISFGHKFCARVGHGDKDHAD-------SERSPLFVQFVDCVWQMTRQFPSAFEFNELFLITVLDYLYSCLFGTFLCNSEQERVAQEVQTKTASLWSYINSQSEDFTNPFY---ENYQNHVLYPLASSRHLELWTGYHARWNPHMRSQVPVHQTLKEL----LILRAELQRKVE 640          
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Match: SMESG000072462.1 (SMESG000072462.1)

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 585/587 (99.66%), Postives = 585/587 (99.66%), Query Frame = 3
Query:  138 MIGKNLLQEVYDFKCGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAGEARQI 1898
            MIGKNLLQEVYDFKCGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNS DRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGY NSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAGEARQI
Sbjct:    1 MIGKNLLQEVYDFKCGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSADRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPGYSNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRILSRRKRIFQTQLNRQPESDEETNIAQPAGEARQI 587          
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Match: SMESG000032817.1 (SMESG000032817.1)

HSP 1 Score: 280.796 bits (717), Expect = 3.896e-82
Identity = 173/516 (33.53%), Postives = 261/516 (50.58%), Query Frame = 3
Query:  246 NGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENI------KLFAFVHFDAMHKEPGYR--------------NSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDA---NAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQ-RSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESG------HRVLFPQY 1703
            N  + LTNYRL F   N+                  K   + +P+  + + E+ D   LT+  K       KL  DS+ +         ++   SEN+      K+FAF  F+++ K    +              + VL  E++R    +  W+I+ VN  F+VC +YP    VP  +SDE I    +FR   RFP + W      A + R +QP  GL + RN  DE + K +      N     L IIDAR    A+ N  RGGG+E    Y      F+ + NIH +R S   ++       +  NW  ++E + WL Y+ ++L  +  +A  +N   RSV++HCSDGWDRT Q+TSL Q++LD ++RTI+GF+ LI++EW+  GHK S R G         + +    E +PIF+Q++DC+ Q+ +Q+   FEFNE FL+ L   VYSGLFGNF+FNSE++R+ N VY+ T   W+ ++   E   NPLF     +        +V++P+Y
Sbjct:   30 NYTMSLTNYRLCFICKNNVD----------------KICHIGIPLNLLLKIEQVDFKHLTLWTK--VGSVYKLSFDSSDI------CHDWLMNISENLNIKTSGKMFAFNFFESLEKLKSEKWLLYGIKQKSKSSDSKVLKKEFKRMKFSNKIWKITDVNKKFQVCNSYPPYHIVPCSISDEDIKAMAEFRGNKRFPSVVWRSQKNGAVIIRCAQPQVGLMFWRNSFDETFFKEVLKCLKCNGNKKRLLIIDARHYSTAQFNRIRGGGVEYSEYYGEAEIVFMQLENIHSVRSSFDCISMF---SMNGENWFTSIENSCWLKYLSKLLKSACDIARALNEDGRSVIIHCSDGWDRTPQLTSLSQILLDDFYRTIKGFKVLIEREWIHFGHKFSDRCG--------FNKSVDNKEWSPIFVQWLDCIHQLIRQYPCYFEFNETFLVKLALHVYSGLFGNFMFNSEEERQNNGVYSSTACIWNFLSESNEDIINPLFYKFSVAETNFDVYKKVIYPKY 510          
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Match: SMESG000032817.1 (SMESG000032817.1)

HSP 1 Score: 280.026 bits (715), Expect = 4.793e-82
Identity = 172/513 (33.53%), Postives = 260/513 (50.68%), Query Frame = 3
Query:  255 LMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENI------KLFAFVHFDAMHKEPGYR--------------NSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDA---NAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQ-RSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESG------HRVLFPQY 1703
            + LTNYRL F   N+                  K   + +P+  + + E+ D   LT+  K       KL  DS+ +         ++   SEN+      K+FAF  F+++ K    +              + VL  E++R    +  W+I+ VN  F+VC +YP    VP  +SDE I    +FR   RFP + W      A + R +QP  GL + RN  DE + K +      N     L IIDAR    A+ N  RGGG+E    Y      F+ + NIH +R S   ++       +  NW  ++E + WL Y+ ++L  +  +A  +N   RSV++HCSDGWDRT Q+TSL Q++LD ++RTI+GF+ LI++EW+  GHK S R G         + +    E +PIF+Q++DC+ Q+ +Q+   FEFNE FL+ L   VYSGLFGNF+FNSE++R+ N VY+ T   W+ ++   E   NPLF     +        +V++P+Y
Sbjct:    1 MSLTNYRLCFICKNNVD----------------KICHIGIPLNLLLKIEQVDFKHLTLWTK--VGSVYKLSFDSSDI------CHDWLMNISENLNIKTSGKMFAFNFFESLEKLKSEKWLLYGIKQKSKSSDSKVLKKEFKRMKFSNKIWKITDVNKKFQVCNSYPPYHIVPCSISDEDIKAMAEFRGNKRFPSVVWRSQKNGAVIIRCAQPQVGLMFWRNSFDETFFKEVLKCLKCNGNKKRLLIIDARHYSTAQFNRIRGGGVEYSEYYGEAEIVFMQLENIHSVRSSFDCISMF---SMNGENWFTSIENSCWLKYLSKLLKSACDIARALNEDGRSVIIHCSDGWDRTPQLTSLSQILLDDFYRTIKGFKVLIEREWIHFGHKFSDRCG--------FNKSVDNKEWSPIFVQWLDCIHQLIRQYPCYFEFNETFLVKLALHVYSGLFGNFMFNSEEERQNNGVYSSTACIWNFLSESNEDIINPLFYKFSVAETNFDVYKKVIYPKY 478          
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Match: SMESG000069357.1 (SMESG000069357.1)

HSP 1 Score: 265.388 bits (677), Expect = 5.452e-78
Identity = 143/398 (35.93%), Postives = 221/398 (55.53%), Query Frame = 3
Query:  582 PGYRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANAYNNL------LTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQR-SVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVY---TKTLSFWDHV-NSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYL 1742
            P     +++ E+ R     + WRIS +N  F++C TYP    VPK   D  I    +FR+K RF  + +   +    + RS QP TG++  RNE+DE+Y   I D      L      L I DAR   +A+ N  +GGG+ES+  Y+  S +FLNIPN+H +R S          + D+ N+++ + ++ WL  IRQ++  +  + + +  ++ SVL+HCSDGWDRT Q+ SL Q+++DPY+RTI GF+ LI +EW+L GHK ++R      +F          E +PIF+Q++DCV+Q+ QQF   F FNE FLI L   VYSG+FG F          N V    T+T S W  +   ++  + NPL++P      +++ P++++  I+ W + Y 
Sbjct:   45 PNNEKEIITKEFDRMQFSGDFWRISSINEEFKICSTYPQYHIVPKSFPDNLIKEMAKFRSKGRFISVSYRSIEAGTVMLRSGQPLTGVSCWRNEADEKYFHVINDNRTCEVLETEGLQLKIYDARSYTSAQLNRVKGGGMESETNYSIKSLEFLNIPNMHAVRNSFESFTKALL-ENDSDNFYELIFKSNWLQLIRQLIKSASQITDTMCIKKISVLIHCSDGWDRTPQLVSLSQILMDPYYRTIEGFRILIYREWILFGHKFNERCALWPVDFS--------REYSPIFVQWLDCVYQLLQQFPDYFHFNETFLIKLAIHVYSGMFGTF----------NTVISNTTETCSLWSFLCQKEMHDFINPLYSP--HKTFKLIKPKFQMSNIKLWNNLYF 421          
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Match: SMESG000005879.1 (SMESG000005879.1)

HSP 1 Score: 258.07 bits (658), Expect = 3.684e-75
Identity = 174/538 (32.34%), Postives = 270/538 (50.19%), Query Frame = 3
Query:  207 NNVTLFDF--STKGQNGLLMLTNYRLLFWSYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCKDFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFV-HFDAMHKEP-GY--RNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETITNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKSIKDANA--YNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPNIHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEKINSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLMGHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFEFNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIEKYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADYSRI 1796
            +NV L D   S+ G  G L +T   L+F S                 +KE K + ++L            G  L I  KDF      ++ D+N  D+   +L K +    ++ KL  F  + +    +P G+   N  L+  + R  I +  W  + +N N+++ +TYP  + +P   S   +    +FR++ RFPVL + +   K+ L R SQP  G + +  E D   LK IKDA +  +++ L ++D RP INA  N ARG G ES   Y  I + F  I NIHVMR S+ KL   C     +   H  ++++ WL +I+ I   SL +A+K+    +V+VHCSDGWDRT+Q+  L Q+++DPY+RTI G + +I+K+WL  GHK S R G L        S+   +E +P+F QF+DCV+Q+ ++F   F++NE+ L  L       +FG F+ N E+ R   + Y +  S W +V +++  Y NP +   +    +VL    R     FW + Y           PI D S +
Sbjct:   10 DNVRLLDSYESSIGIKGKLHITVSHLIFLS---------------EDLKEEKWILIHLISSIDSPSVNSMGKVLIISLKDFHIYRFVIE-DNNGSDKLRLVLLKLIANVDQHSKLPCFSPNSNQQFPQPIGWILSNKRLTSSFMRMGIPNRQWEFTDINTNYKMSDTYPSVIVIPVGTSKAIMEACSKFRSRGRFPVLSYYYSPAKSALCRCSQPLVGFSARCTE-DITMLKRIKDAASEEHSDKLHVVDTRPKINALTNRARGKGYESDIDYEKIVFQFFQIENIHVMRSSLEKLLKACRNMRQSHLSH--VDKSGWLKHIKWIYDASLYIAQKLLLGENVVVHCSDGWDRTSQVCGLTQIIIDPYYRTIEGLEDVIEKDWLSFGHKFSDRCGHL--------SSVDPTEISPVFTQFLDCVFQLLKKFPNQFQYNERLLRHLHRWSQDCVFGTFVGNCEKDRLDLKNYERCYSVWGYVKNNLWDYLNPYYDSNEII--KVLDEPLRNSDFSFWSALYC----------PIEDLSTV 508          
The following BLAST results are available for this feature:
BLAST of Myotubularin-related protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTMR25.561e-14441.80myotubularin related protein 2 [Source:HGNC Symbol... [more]
MTMR27.451e-14441.80myotubularin related protein 2 [Source:HGNC Symbol... [more]
MTMR27.451e-14441.80myotubularin related protein 2 [Source:HGNC Symbol... [more]
MTMR27.451e-14441.80myotubularin related protein 2 [Source:HGNC Symbol... [more]
MTMR22.986e-14341.80myotubularin related protein 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtm-11.363e-10736.10Myotubularin-related protein 1 [Source:UniProtKB/... [more]
mtm-61.057e-10037.81Myotubularin-related protein 6 [Source:UniProtKB/... [more]
mtm-61.974e-9936.84Myotubularin-related protein 6 [Source:UniProtKB/... [more]
mtm-61.974e-9936.84Myotubularin-related protein 6 [Source:UniProtKB/... [more]
mtm-67.285e-9937.44Myotubularin-related protein 6 [Source:UniProtKB/... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtm1.555e-13340.75gene:FBgn0025742 transcript:FBtr0079223[more]
mtm1.555e-13340.75gene:FBgn0025742 transcript:FBtr0345290[more]
CG35301.473e-10837.64gene:FBgn0028497 transcript:FBtr0072029[more]
CG35301.026e-10737.55gene:FBgn0028497 transcript:FBtr0072028[more]
CG35301.343e-10740.17gene:FBgn0028497 transcript:FBtr0112940[more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtm12.154e-14341.86myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-12... [more]
mtmr21.067e-14043.53myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr1b1.069e-13943.24myotubularin related protein 1b [Source:ZFIN;Acc:Z... [more]
mtmr1b2.595e-13943.24myotubularin related protein 1b [Source:ZFIN;Acc:Z... [more]
mtmr1a4.979e-13041.85myotubularin related protein 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTMR23.893e-13739.93myotubularin related protein 2 [Source:NCBI gene;A... [more]
MTMR24.050e-13741.34myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr17.386e-13742.38myotubularin related protein 1 [Source:NCBI gene;A... [more]
MTMR27.511e-13741.34myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr11.355e-13642.38myotubularin related protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtmr25.876e-14341.62myotubularin related protein 2 [Source:MGI Symbol;... [more]
Mtmr23.063e-14241.62myotubularin related protein 2 [Source:MGI Symbol;... [more]
Mtm15.808e-13740.37X-linked myotubular myopathy gene 1 [Source:MGI Sy... [more]
Mtm15.808e-13740.37X-linked myotubular myopathy gene 1 [Source:MGI Sy... [more]
Mtm15.808e-13740.37X-linked myotubular myopathy gene 1 [Source:MGI Sy... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QLT2|MTMR2_BOVIN1.640e-14341.07Myotubularin-related protein 2 OS=Bos taurus OX=99... [more]
sp|Q5ZIV1|MTMR2_CHICK4.437e-14340.89Myotubularin-related protein 2 OS=Gallus gallus OX... [more]
sp|Q13614|MTMR2_HUMAN1.434e-14241.80Myotubularin-related protein 2 OS=Homo sapiens OX=... [more]
sp|Q5REB9|MTMR2_PONAB9.583e-14241.62Myotubularin-related protein 2 OS=Pongo abelii OX=... [more]
sp|Q9Z2D1|MTMR2_MOUSE2.143e-14141.62Myotubularin-related protein 2 OS=Mus musculus OX=... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N9192.185e-15742.55Myotubularin-related protein 1/2 OS=Paragonimus we... [more]
A0A1S8X0I31.098e-15543.06Myotubularin phosphatase domain-containing protein... [more]
A0A4S2MG924.808e-15542.71Myotubularin phosphatase domain-containing protein... [more]
A0A504YJP48.559e-15544.28Myotubularin protein 2 OS=Fasciola gigantica OX=46... [more]
A0A4E0R1H99.329e-15544.28Myotubularin protein 2 OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtmr21.112e-14242.73myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr21.904e-14241.92myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr1b1.019e-14040.47myotubularin-related protein 1-like [Source:NCBI g... [more]
mtmr1b2.762e-14040.47myotubularin-related protein 1-like [Source:NCBI g... [more]
mtm11.756e-13742.88myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-12... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtm11.419e-14040.65myotubularin 1 [Source:ZFIN;Acc:ZDB-GENE-051113-12... [more]
mtmr97.582e-7533.62myotubularin related protein 9 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000002170.13.588e-4739.81pep scaffold:Pmarinus_7.0:GL484749:1247:6808:1 gen... [more]
mtmr83.017e-3933.96myotubularin related protein 8 [Source:NCBI gene;A... [more]
sbf12.395e-3631.52SET binding factor 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YMR11.396e-4628.92Phosphatidylinositol 3-phosphate (PI3P) phosphatas... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444801.919e-13540.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347101.645e-10135.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399209.747e-9032.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337741.877e-7732.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487089.027e-5942.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtmr26.657e-14442.80myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtmr21.370e-14342.80myotubularin related protein 2 [Source:NCBI gene;A... [more]
mtm15.890e-14142.29myotubularin 1 [Source:NCBI gene;Acc:101168528][more]
mtmr1a1.937e-13341.70myotubularin-related protein 2 [Source:NCBI gene;A... [more]
mtmr1a3.042e-13341.70myotubularin-related protein 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Myotubularin-related protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072462.10.000e+099.66SMESG000072462.1[more]
SMESG000032817.13.896e-8233.53SMESG000032817.1[more]
SMESG000032817.14.793e-8233.53SMESG000032817.1[more]
SMESG000069357.15.452e-7835.93SMESG000069357.1[more]
SMESG000005879.13.684e-7532.34SMESG000005879.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007848 ID=SMED30007848|Name=Myotubularin-related protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2255bp
ATTGAAGTAAATAACGAAAGGAATTTAAATATATAAATTGAGATATTTTT
ATATTTTCTTTTTAATTCCGATTATTCTATTCTTTTATAGAATTTTGTAA
AAGATTTATTAATTTTTTTTGAAAATTTAAAGAAAAGATGATTGGCAAAA
ATTTATTGCAAGAAGTTTACGACTTCAAATGTGGGGAAAATATAGTAAAG
GAAGAAAATAATGTTACGTTGTTTGATTTTTCTACCAAAGGACAGAATGG
TTTATTGATGCTGACAAATTATCGTTTGCTATTTTGGTCATACAATTCCA
ATAGTTTTGGTAAATCGCACTTTTATGAAATTCCAAATAGCATTAAAGAA
TTCAAAAGTTTGGACCTTAATTTGCCAGTAGGTTTTATACAGGAATTCGA
AAAAGGAGATGGGAACTGTTTGACTATCAAATGCAAAGATTTTAGATCTG
TTACGTTGAAATTAAAAAACGATAGCAATTCTGTCGACCGATTCGACAAA
TTACTAGAAAAATACATGAATCCACGGTCGGAAAATATCAAATTATTCGC
TTTTGTTCACTTTGATGCAATGCACAAAGAACCTGGATATAGGAATTCGG
TGTTGTCGGACGAATATCAGAGGCAACTTATTGAATCGAATAATTGGCGA
ATCTCTAAGGTCAATCATAATTTTGAAGTTTGTGAAACGTATCCCGATGA
AGTAGCAGTTCCAAAAGATGTTTCGGATGAAACTATTACAAATGCATGCC
AATTTCGAACAAAAAACCGATTCCCAGTTCTTTGTTGGATTCATCCAGAT
ACGAAAGCTACGCTCACACGATCCAGTCAGCCAGCAACTGGATTAACCTG
GAAGCGTAACGAAAGTGATGAAAGATATCTTAAATCTATTAAAGATGCGA
ATGCTTACAACAATTTGTTAACAATTATTGATGCTAGACCAATGATAAAT
GCTCGGGCAAATATGGCTAGAGGGGGTGGTATAGAAAGTCAAAATATCTA
CACATCAATTTCATACGATTTCCTGAACATTCCAAACATTCACGTTATGC
GAGAAAGCATGCGGAAATTAGCTGATTTGTGTTATCCCAAGCCCGATAAT
AGCAATTGGCATAAGGCACTTGAAGAAACTAAGTGGCTTAATTATATACG
TCAAATTCTACTGGGATCTTTAATGGTGGCGGAAAAAATAAATAGCCAGC
GAAGTGTTTTAGTGCACTGTAGCGATGGTTGGGATCGCACTGCACAGATC
ACGAGTTTACCGCAACTTATGTTGGATCCTTACTTTCGTACAATTCGTGG
ATTTCAAACTCTAATTGATAAAGAATGGTTACTAATGGGTCATAAAATTT
CCCAAAGAACCGGAGGTCTCACTGAAGAGTTTGGCTCGACAAGTAGCACG
AGTCAGAAATCCGAACGTGCTCCAATCTTTCTTCAATTTATCGACTGTGT
CTGGCAAATCACCCAGCAATTTCTAGCGGCATTTGAATTCAACGAACAAT
TTCTAATAGATTTAATGGACGCAGTCTACAGCGGTCTCTTTGGGAACTTT
TTATTCAACAGTGAACAGCAACGTCGAACCAATGAAGTTTACACGAAGAC
TTTGTCATTTTGGGATCATGTCAATTCTGACATTGAGAAATATAGAAATC
CGTTGTTTACTCCAGCAGATGAAAGCGGTCATCGGGTTCTTTTCCCGCAA
TACAGGCTGCCGTGTATTCGATTTTGGAAAAGCTATTATTTGAGACATTA
TTTACAAAGCAGAAGCCAAGATCCGATTGCCGATTATAGTCGGATTCTCA
GCCGCAGGAAAAGGATATTTCAAACTCAACTTAATCGTCAACCGGAAAGT
GACGAAGAAACAAACATTGCTCAGCCTGCTGGCGAAGCGAGACAAATTTA
ATACAATAGTTTATATTTTTCAATTGAAAAATAGATATATTATATAAATA
TAATTAATTTTTATTATTATTATTATTATTGCGGTTAGTAGTTATGTTGG
AGGACTTTCTCTATTTGGGTGTCTATCTCTGTGTGTGTGTGTGCGTGTGG
TTATGTAATGTCAGCAAATGTACGAGGGAAATACCCGTGTATATATTATA
CATATTTGTGTGTAATCAAGTAATATTTTTATTGCATTTTCAGCGTTTAT
TTAGGAGTTAGTATATTTATTGGATGATAATGTGAACCAATGAGCAACCT
TGATTATTATTGTATTGAAGAAATTATTAGTAAATTATTATTATTATTAT
TATTA
back to top

protein sequence of SMED30007848-orf-1

>SMED30007848-orf-1 ID=SMED30007848-orf-1|Name=SMED30007848-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=588bp
MIGKNLLQEVYDFKCGENIVKEENNVTLFDFSTKGQNGLLMLTNYRLLFW
SYNSNSFGKSHFYEIPNSIKEFKSLDLNLPVGFIQEFEKGDGNCLTIKCK
DFRSVTLKLKNDSNSVDRFDKLLEKYMNPRSENIKLFAFVHFDAMHKEPG
YRNSVLSDEYQRQLIESNNWRISKVNHNFEVCETYPDEVAVPKDVSDETI
TNACQFRTKNRFPVLCWIHPDTKATLTRSSQPATGLTWKRNESDERYLKS
IKDANAYNNLLTIIDARPMINARANMARGGGIESQNIYTSISYDFLNIPN
IHVMRESMRKLADLCYPKPDNSNWHKALEETKWLNYIRQILLGSLMVAEK
INSQRSVLVHCSDGWDRTAQITSLPQLMLDPYFRTIRGFQTLIDKEWLLM
GHKISQRTGGLTEEFGSTSSTSQKSERAPIFLQFIDCVWQITQQFLAAFE
FNEQFLIDLMDAVYSGLFGNFLFNSEQQRRTNEVYTKTLSFWDHVNSDIE
KYRNPLFTPADESGHRVLFPQYRLPCIRFWKSYYLRHYLQSRSQDPIADY
SRILSRRKRIFQTQLNRQPESDEETNIAQPAGEARQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR030564Myotubularin_fam
IPR003595Tyr_Pase_cat
IPR011993PH-like_dom_sf
IPR010569Myotubularin-like_Pase_dom
IPR016130Tyr_Pase_AS
IPR029021Prot-tyrosine_phosphatase-like
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 302..464
e-value: 6.4E-4
score: 24.3
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 19..124
e-value: 5.3E-7
score: 31.7
IPR010569Myotubularin-like phosphatase domainPFAMPF06602Myotub-relatedcoord: 138..479
e-value: 9.7E-130
score: 432.6
IPR010569Myotubularin-like phosphatase domainPROSITEPS51339PPASE_MYOTUBULARINcoord: 150..534
score: 108.056
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 564..587
NoneNo IPR availableCDDcd14532PTP-MTMR6-likecoord: 156..465
e-value: 8.11032E-127
score: 372.83
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 16..140
IPR030564Myotubularin familyPANTHERPTHR10807MYOTUBULARIN-RELATEDcoord: 36..563
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 359..369
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 147..537