cAMP-dependent protein kinase type I-alpha regulatory subunit

Overview
NamecAMP-dependent protein kinase type I-alpha regulatory subunit
Smed IDSMED30007839
Length (bp)1541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007839) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30007839SMESG000074764.1 dd_Smed_v4_2180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007839SMESG000074764.1 dd_Smed_v4_2180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007839SMESG000074764.1 dd_Smed_v4_2180_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007839SMESG000074764.1 dd_Smed_v4_2858_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9390])

HSP 1 Score: 495.352 bits (1274), Expect = 1.355e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9390])

HSP 1 Score: 495.352 bits (1274), Expect = 1.355e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9390])

HSP 1 Score: 495.352 bits (1274), Expect = 1.355e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9390])

HSP 1 Score: 495.352 bits (1274), Expect = 1.355e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9390])

HSP 1 Score: 495.352 bits (1274), Expect = 1.355e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 374.4 bits (960), Expect = 1.005e-126
Identity = 192/398 (48.24%), Postives = 259/398 (65.08%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISI 1260
            L + + Y++ HNI QL+K+ +V LC+ KP++PV F++++F+ L +Q  ++  N   ++  +  +                                             K++  RR  +S E   EDD   Y K V+PKD  T  +L  A+ KN+LF+HL+E E+  ++DAMFP+ K A E +I+QG++GDNFY+ID+G V++YVN E   T++EGGSFGELALIYGTPRAATV A TDVKLW IDR +YRRILMGS  KKRK+Y EFLS+V IL +LD+WE+  VADALE  +F+ G +VV+QG+ G++F++I+EG A V QK SD      VG L  SDYFGEIALLL+RPRAATV A   LKC+KLDR RFERVMG   EILKR++  YNSY+ +
Sbjct:   10 LAQCQAYVQRHNIQQLVKEAIVVLCIHKPDNPVLFLKDHFEKLNEQRAQEGGNPDAADDDDIIVE------------------------------------------PPKRSGGRRTGISAEPIKEDDT-EYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVKL 364          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 374.785 bits (961), Expect = 1.208e-126
Identity = 192/398 (48.24%), Postives = 259/398 (65.08%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISI 1260
            L + + Y++ HNI QL+K+ +V LC+ KP++PV F++++F+ L +Q  ++  N   ++  +  +                                             K++  RR  +S E   EDD   Y K V+PKD  T  +L  A+ KN+LF+HL+E E+  ++DAMFP+ K A E +I+QG++GDNFY+ID+G V++YVN E   T++EGGSFGELALIYGTPRAATV A TDVKLW IDR +YRRILMGS  KKRK+Y EFLS+V IL +LD+WE+  VADALE  +F+ G +VV+QG+ G++F++I+EG A V QK SD      VG L  SDYFGEIALLL+RPRAATV A   LKC+KLDR RFERVMG   EILKR++  YNSY+ +
Sbjct:   20 LAQCQAYVQRHNIQQLVKEAIVVLCIHKPDNPVLFLKDHFEKLNEQRAQEGGNPDAADDDDIIVE------------------------------------------PPKRSGGRRTGISAEPIKEDDT-EYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVKL 374          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 350.132 bits (897), Expect = 1.141e-117
Identity = 172/289 (59.52%), Postives = 217/289 (75.09%), Query Frame = 1
Query:  394 KKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISI 1260
            K++  RR  +S E   EDD   Y K V+PKD  T  +L  A+ KN+LF+HL+E E+  ++DAMFP+ K A E +I+QG++GDNFY+ID+G V++YVN E   T++EGGSFGELALIYGTPRAATV A TDVKLW IDR +YRRILMGS  KKRK+Y EFLS+V IL +LD+WE+  VADALE  +F+ G +VV+QG+ G++F++I+EG A V QK SD      VG L  SDYFGEIALLL+RPRAATV A   LKC+KLDR RFERVMG   EILKR++  YNSY+ +
Sbjct:   45 KRSGGRRTGISAEPIKEDDT-EYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVKL 332          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 131.339 bits (329), Expect = 3.640e-32
Identity = 74/249 (29.72%), Postives = 136/249 (54.62%), Query Frame = 1
Query:  490 KTMSA---LSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGP-LKCVKLDRKRFERVMGSCAEILK 1224
            KT+ A   +  A++KN     L +++  ++ + M+ +  +A + +IQ+G+ GD  +++ +GE+++     L   +  G   GELA++Y   R A+V+A TDV+LW +DR  ++ I     +++      FL++V I + L +     +AD ++   +D G Y+++QGE G+ F++I  G  KV Q+        E+  L   D+FGE ALL    R A + A  P ++ + LDR+ F +++G    + K
Sbjct:  153 KTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK 401          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 131.339 bits (329), Expect = 3.640e-32
Identity = 74/249 (29.72%), Postives = 136/249 (54.62%), Query Frame = 1
Query:  490 KTMSA---LSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGP-LKCVKLDRKRFERVMGSCAEILK 1224
            KT+ A   +  A++KN     L +++  ++ + M+ +  +A + +IQ+G+ GD  +++ +GE+++     L   +  G   GELA++Y   R A+V+A TDV+LW +DR  ++ I     +++      FL++V I + L +     +AD ++   +D G Y+++QGE G+ F++I  G  KV Q+        E+  L   D+FGE ALL    R A + A  P ++ + LDR+ F +++G    + K
Sbjct:  153 KTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK 401          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300535)

HSP 1 Score: 492.656 bits (1267), Expect = 8.048e-173
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300534)

HSP 1 Score: 492.656 bits (1267), Expect = 8.048e-173
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300528)

HSP 1 Score: 492.656 bits (1267), Expect = 8.048e-173
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300530)

HSP 1 Score: 492.656 bits (1267), Expect = 8.048e-173
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0299892)

HSP 1 Score: 492.656 bits (1267), Expect = 8.048e-173
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1ab (protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) b [Source:ZFIN;Acc:ZDB-GENE-050417-238])

HSP 1 Score: 502.286 bits (1292), Expect = 1.399e-176
Identity = 245/400 (61.25%), Postives = 311/400 (77.75%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HN+ QLLKDC+V+LC S+P+ P++F+REYF+ LEK+  K  LN+ ++               S +DS    ED ++              + VV      K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLFSHLD+ ERSDIFDAMFP+   A EI+IQQGD+GDNFY+IDQGE+++YVN+E   ++ EGGSFGELALIYGTPRAATVRA T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+D + +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   14 LRECEVYVQKHNVQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEESKQLLNQQKAS--------------SRSDSR---EDEVS-----------PPMNPVV------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVNNEWATSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVVQGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 379          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1b (protein kinase, cAMP-dependent, regulatory, type I, beta [Source:ZFIN;Acc:ZDB-GENE-060929-580])

HSP 1 Score: 494.967 bits (1273), Expect = 1.206e-173
Identity = 242/400 (60.50%), Postives = 299/400 (74.75%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E +++ HNI Q+LK+C+V LC++KP  P+ F+RE+F+ LEK+  K  +   +S  + +D H                                D+  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGEV++YVN E   ++ EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   14 LKGCEVFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEECKQIMARQKSN-SQSDSH--------------------------------DDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 380          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1b (protein kinase, cAMP-dependent, regulatory, type I, beta [Source:ZFIN;Acc:ZDB-GENE-060929-580])

HSP 1 Score: 494.967 bits (1273), Expect = 1.206e-173
Identity = 242/400 (60.50%), Postives = 299/400 (74.75%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E +++ HNI Q+LK+C+V LC++KP  P+ F+RE+F+ LEK+  K  +   +S  + +D H                                D+  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGEV++YVN E   ++ EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   14 LKGCEVFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEECKQIMARQKSN-SQSDSH--------------------------------DDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 380          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1aa (protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) a [Source:ZFIN;Acc:ZDB-GENE-050116-2])

HSP 1 Score: 484.567 bits (1246), Expect = 1.740e-169
Identity = 232/400 (58.00%), Postives = 302/400 (75.50%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HNI QLLKDC+V+LC ++P  P++++R+YF+ LE +  K  +  S+ + ++     +   S   N  +                                K R RRGA+S EVYTE+DA SYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMF +   A E +IQQGD+GDNFY+IDQGE+++YVN+E   ++ EGGSFGELALIYGTPRAATVRA T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE++ F+DG+ +V QG+ G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   14 LRECERYVQKHNIQQLLKDCIVQLCTARPERPMAYLRDYFEKLELEEAKQMV--SQQKSSSRSDSREDEVSPPMNPVV--------------------------------KGRRRRGAISAEVYTEEDATSYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWVTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALETVQFEDGQKIVVQGQPGDEFFIILEGSAAVLQRRSENEEFVEVGRLAPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 379          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1b (protein kinase, cAMP-dependent, regulatory, type I, beta [Source:ZFIN;Acc:ZDB-GENE-060929-580])

HSP 1 Score: 338.961 bits (868), Expect = 7.708e-115
Identity = 158/214 (73.83%), Postives = 187/214 (87.38%), Query Frame = 1
Query:  625 GDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            GD+GDNFY+IDQGEV++YVN E   ++ EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:    4 GDEGDNFYVIDQGEVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 217          

HSP 2 Score: 63.1586 bits (152), Expect = 5.956e-11
Identity = 47/152 (30.92%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  448 DAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGS------FGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMG-STIKKRKL--YQEFLS 876
            D  SY + ++    +      + + K  +   LD+ ER  + DA+ P+  +  E ++ QG+ GD+F+II +G   +      N    E G       FGE+AL+   PRAATV A   +K   +DR  + R+L   S I KR +  Y  F+S
Sbjct:   63 DRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFIS 214          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 496.508 bits (1277), Expect = 5.116e-174
Identity = 242/400 (60.50%), Postives = 301/400 (75.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y++ +NI QLLK+C+V LC++KP+ P+ F+RE+F+ LEK+  K  L + +S  + +D H+ +      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP++  A E +IQQGD+GDNFY+IDQGE ++YVN E    + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   14 LKGCEVYVQKYNIQQLLKECIVNLCIAKPDRPMKFLREHFEKLEKEECKQILAQQKSN-SQSDSHDDEISPPPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVNHIAGETVIQQGDEGDNFYVIDQGEADVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 380          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 496.893 bits (1278), Expect = 1.067e-173
Identity = 244/400 (61.00%), Postives = 304/400 (76.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y++ +NI QLLK+C+V LC++KP+ P+ F+RE+F+ LEK+  K  L + +S   ++          SH+D ++    +                  VV      KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP++  A E +IQQGD+GDNFY+IDQGE ++YVN E    + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   48 LKGCEVYVQKYNIQQLLKECIVNLCIAKPDRPMKFLREHFEKLEKEECKQILAQQKSNSQSD----------SHDDEISPPPPN-----------------PVV------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVNHIAGETVIQQGDEGDNFYVIDQGEADVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 414          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 454.907 bits (1169), Expect = 3.158e-158
Identity = 213/290 (73.45%), Postives = 251/290 (86.55%), Query Frame = 1
Query:  397 KARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP++  A E +IQQGD+GDNFY+IDQGE ++YVN E    + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   52 KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVNHIAGETVIQQGDEGDNFYVIDQGEADVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 341          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 352.829 bits (904), Expect = 9.021e-119
Identity = 167/261 (63.98%), Postives = 211/261 (80.84%), Query Frame = 1
Query:  397 KARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDR 1179
            K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMF +   A E +IQQGD+GDNFY++DQGE+++YVN++   ++ EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGE             Q    L+C+ + R
Sbjct:   53 KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQGEMDVYVNNDWMTSIGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEF------------QCATLLRCIGVRR 301          

HSP 2 Score: 62.7734 bits (151), Expect = 3.352e-10
Identity = 46/153 (30.07%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  802 DRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERV-MGSCAEILKRNIKKYNSYIS 1257
            D  SY R ++    K      + + +  +   LD  E+  + DA+ S+ +  GE V++QG+ G++FY++ +G   V+    +++    +GE      FGE+AL+   PRAATV+A   +K   +DR  + R+ MGS      R  K Y  ++S
Sbjct:   70 DAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQGEMDVY---VNNDWMTSIGE---GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL----RKRKMYEEFLS 212          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 353.984 bits (907), Expect = 1.426e-118
Identity = 167/261 (63.98%), Postives = 211/261 (80.84%), Query Frame = 1
Query:  397 KARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDR 1179
            K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMF +   A E +IQQGD+GDNFY++DQGE+++YVN++   ++ EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGE             Q    L+C+ + R
Sbjct:  100 KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQGEMDVYVNNDWMTSIGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEF------------QCATLLRCIGVRR 348          

HSP 2 Score: 63.1586 bits (152), Expect = 3.308e-10
Identity = 46/153 (30.07%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  802 DRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERV-MGSCAEILKRNIKKYNSYIS 1257
            D  SY R ++    K      + + +  +   LD  E+  + DA+ S+ +  GE V++QG+ G++FY++ +G   V+    +++    +GE      FGE+AL+   PRAATV+A   +K   +DR  + R+ MGS      R  K Y  ++S
Sbjct:  117 DAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQGEMDVY---VNNDWMTSIGE---GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL----RKRKMYEEFLS 259          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 489.96 bits (1260), Expect = 1.222e-171
Identity = 243/400 (60.75%), Postives = 297/400 (74.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y++ H I Q+LK+C+V LC++KP+ P+ F+RE+F+ LEK+  +  L   +S        N +C S                          DE  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLFSHLD+ ERSDIFDAMFP+     E +IQQG++GDNFY+IDQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCEMYVQKHGIQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKEENRQILARQKS--------NSQCDSH-------------------------DEEISPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 489.96 bits (1260), Expect = 1.222e-171
Identity = 243/400 (60.75%), Postives = 297/400 (74.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y++ H I Q+LK+C+V LC++KP+ P+ F+RE+F+ LEK+  +  L   +S        N +C S                          DE  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLFSHLD+ ERSDIFDAMFP+     E +IQQG++GDNFY+IDQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCEMYVQKHGIQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKEENRQILARQKS--------NSQCDSH-------------------------DEEISPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1a (protein kinase, cAMP dependent regulatory, type I, alpha [Source:MGI Symbol;Acc:MGI:104878])

HSP 1 Score: 487.649 bits (1254), Expect = 1.037e-170
Identity = 238/400 (59.50%), Postives = 303/400 (75.75%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HNI  LLKD +V+LC ++P  P++F+REYF+ LEK+  +      ++ I  +          S  D ++    +                  VV      K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLFSHLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGE+++YVN+E   +V EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   15 LRECELYVQKHNIQALLKDSIVQLCTTRPERPMAFLREYFERLEKEEARQIQCLQKTGIRTD----------SREDEISPPPPN-----------------PVV------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1a (protein kinase, cAMP dependent regulatory, type I, alpha [Source:MGI Symbol;Acc:MGI:104878])

HSP 1 Score: 487.649 bits (1254), Expect = 1.037e-170
Identity = 238/400 (59.50%), Postives = 303/400 (75.75%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HNI  LLKD +V+LC ++P  P++F+REYF+ LEK+  +      ++ I  +          S  D ++    +                  VV      K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLFSHLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGE+++YVN+E   +V EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   15 LRECELYVQKHNIQALLKDSIVQLCTTRPERPMAFLREYFERLEKEEARQIQCLQKTGIRTD----------SREDEISPPPPN-----------------PVV------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 399.053 bits (1024), Expect = 1.007e-137
Identity = 187/257 (72.76%), Postives = 221/257 (85.99%), Query Frame = 1
Query:  496 MSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            M+AL+KAI KNVLFSHLD+ ERSDIFDAMFP+     E +IQQG++GDNFY+IDQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:    1 MTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 257          

HSP 2 Score: 63.929 bits (154), Expect = 5.716e-11
Identity = 47/152 (30.92%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  448 DAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGS------FGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMG-STIKKRKL--YQEFLS 876
            D  SY + ++    +      + + K  +   L++ ER  + DA+ P+  +  E ++ QG+ GD+FYII +G   +      N    E G       FGE+AL+   PRAATV A   +K   +DR  + R+L   S I KR +  Y  F+S
Sbjct:  103 DRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFIS 254          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P31319|KAPR_APLCA (cAMP-dependent protein kinase regulatory subunit OS=Aplysia californica OX=6500 PE=2 SV=2)

HSP 1 Score: 498.819 bits (1283), Expect = 2.523e-174
Identity = 238/400 (59.50%), Postives = 305/400 (76.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+E E Y++ HNI QLLK+C+V+L ++KP SP++F+R++F  LEK+ +    ++S +  ++    +        + ++N+                                R+RRGAVS EVY E+DAA YVKKVVPKDYKTM+ALSKAI KNVLFSHLD+ ERSDIFDAMFP+H+ A E++IQQGD+GDNFY+IDQGEV++YVN+    ++ EGGSFGELALIYGTPRAATV+A TDVKLWGIDRDSYRRILMGSTI+KRK+Y++FLS+V ILE LDKWE+LTVADALE + F+D E +V+QGE GEDF++I+EG A V Q+ S++E  +EVG L  SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI +YNS++S++V
Sbjct:   11 LKECEAYVQKHNIQQLLKECIVQLVVNKPESPLAFLRDHFDRLEKEQVAKEKSKSATPPSDEKEEDMSSTPPQMHPAMNK--------------------------------RMRRGAVSAEVYREEDAAQYVKKVVPKDYKTMAALSKAISKNVLFSHLDDNERSDIFDAMFPVHRHAGEVIIQQGDEGDNFYVIDQGEVDVYVNNVHVTSIGEGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTIRKRKIYEDFLSKVSILENLDKWERLTVADALEPVQFEDKEEIVRQGEPGEDFFIILEGSAAVLQRRSENEEPVEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCSDILKRNISQYNSFVSLSV 378          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P31321|KAP1_HUMAN (cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4)

HSP 1 Score: 495.352 bits (1274), Expect = 6.507e-173
Identity = 241/400 (60.25%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E Y+++H I Q+LKDC+V LC+SKP  P+ F+RE+F+ LEK+  +  L   +S  + +D H+++      N  +                                KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQG++GDNFY++DQGEV++YVN E    +SEGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DFY+I EG A V Q+ S +E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   15 LKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN-SQSDSHDEEVSPTPPNPVV--------------------------------KARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q5ZM91|KAP0_CHICK (cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Gallus gallus OX=9031 GN=PRKAR1A PE=2 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 9.772e-173
Identity = 240/396 (60.61%), Postives = 302/396 (76.26%), Query Frame = 1
Query:   79 EEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            E Y++ HNI QLLKDC+V+LC  +P+ P+ F+REYF+ LEK+  K  LN+ +S               S +DS                    DE S         K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY++DQGE+++YVN+E   +V EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A G LKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   19 ELYVQKHNIQQLLKDCIVQLCTVRPDRPMGFLREYFERLEKEETKQLLNQQKSG--------------SRSDSRE------------------DEISPPPPMNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVVDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLAPSDYFGEIALLMNRPRAATVVARGLLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 382          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P16905|KAPR1_DROME (cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=2 SV=2)

HSP 1 Score: 492.656 bits (1267), Expect = 8.067e-172
Identity = 244/400 (61.00%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E YI+ H I ++LKDC+V+LC+ +P +PV F+R+YFQ LE++ +K  L+ S   I+ +D  +           L+ +    A                            RRG +S E  TE+DA +YVKKVVPKDYKTM+ALSKAI KNVLF+HLDE ERSDIFDAMFP++  A E +IQQGD+GDNFY+ID GEV+++VN EL  T+SEGGSFGELALIYGTPRAATVRA TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFLSRV ILE LDKWE+LTVAD+LE+ +FDDGE +VKQG  G+DFY+I+EG A V Q+ S+ E+  EVG L +SDYFGEIALLL+RPRAATV A GPLKCVKLDR RFERV+G CA+ILKRNI +YNS++S++V
Sbjct:   14 LRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVK--LDASRQVISPDDCED-----------LSPMPQTAA------------------------PPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 376          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P09456|KAP0_RAT (cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2)

HSP 1 Score: 490.73 bits (1262), Expect = 4.440e-171
Identity = 239/400 (59.75%), Postives = 304/400 (76.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HNI  LLKD +V+LC ++P  P++F+REYF+ LEK+  +   +  +S I  +          S  D ++    +                  VV      K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLFSHLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGE+++YVN+E   +V EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   15 LRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEARQIQSLQKSGIRTD----------SREDEISPPPPN-----------------PVV------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 381          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A1I8J2X2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004255g1 PE=4 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 257/406 (63.30%), Postives = 312/406 (76.85%), Query Frame = 1
Query:   49 KMNASYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            + + ++L+E+E YIK HNI Q LK+C+V LC+++P++P ++IR++F  LEK+                    +   SF+                    A   D+ + ++      K R RRGAVSGEVYTE+DAASYVKKVVPKDYKTM+ALSKAI KNVLFSHLD+ ERSDIFDAMFPLH+ A E++I+QG +GDNFYI+DQGEV+IYVN E   TV EGGSFGELALIYGTPRAATV+A TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFL +VPILE LDKWE+LTVADALE + F+D E VV+QGE G+DF++I+EGVA V QKPS++E  +EVG+L  SDYFGEIALLL+RPRAATV A GPLKCVKLDRKRFERVMG C++ILKRNI KYNSYIS+TV
Sbjct:    4 RTDEAHLKEVENYIKSHNIQQSLKECIVHLCVARPDNPFAYIRDFFDKLEKERT-----------------GQAPASFAALPQAEPPA----------PAAEEDDSAGLMMPQSAPKKRGRRGAVSGEVYTEEDAASYVKKVVPKDYKTMAALSKAIAKNVLFSHLDDNERSDIFDAMFPLHRNATEVIIEQGAEGDNFYILDQGEVDIYVNGEHVGTVGEGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLGKVPILENLDKWERLTVADALEPVAFEDNEVVVRQGEPGDDFFIILEGVAAVLQKPSENEEAVEVGKLGPSDYFGEIALLLDRPRAATVTAKGPLKCVKLDRKRFERVMGPCSDILKRNISKYNSYISLTV 382          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A1I8JK81 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 1.639e-180
Identity = 257/406 (63.30%), Postives = 310/406 (76.35%), Query Frame = 1
Query:   49 KMNASYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            + + ++L+E+E YIK HNI Q LK+C+V LC+++P++P ++IR++F  LEK                         SF+                    A   D+ + ++      K R RRGAVSGEVYTE+DAASYVKKVVPKDYKTM+ALSKAI KNVLFSHLD+ ERSDIFDAMFPLH+ A E++I+QG +GDNFYI+DQGEV+IYVN E   TV EGGSFGELALIYGTPRAATV+A TDVKLWGIDRDSYRRILMGSTI+KRK+Y+EFL +VPILE LDKWE+LTVADALE + F+D E VV+QGE G+DF++I+EGVA V QKPS++E  +EVG+L  SDYFGEIALLL+RPRAATV A GPLKCVKLDRKRFERVMG C++ILKRNI KYNSYIS+TV
Sbjct:    4 RTDEAHLKEVENYIKSHNIQQSLKECIVHLCVARPDNPFAYIRDFFDKLEKA----------------------PASFAALPQAEPPA----------PAAEEDDSAGLMMPQSAPKKRGRRGAVSGEVYTEEDAASYVKKVVPKDYKTMAALSKAIAKNVLFSHLDDNERSDIFDAMFPLHRNATEVIIEQGAEGDNFYILDQGEVDIYVNGEHVGTVGEGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLGKVPILENLDKWERLTVADALEPVAFEDNEVVVRQGEPGDDFFIILEGVAAVLQKPSENEEAVEVGKLGPSDYFGEIALLLDRPRAATVTAKGPLKCVKLDRKRFERVMGPCSDILKRNISKYNSYISLTV 377          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A1I8HGN2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 7.250e-178
Identity = 251/410 (61.22%), Postives = 314/410 (76.59%), Query Frame = 1
Query:   61 SYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSA--------KDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            ++L+++E Y++ H + ++LK+C+V+LC  +P++P  +I+EYF  ++K  +   L   +   T     +    + +   S        A + + G   +VD  S  +           + +K R RRGAVSGEVYTE+DAASYVKKVVPKDYKTM ALSKAI KNVLFSHLDE ERSDIFDAMFPLH+ A+E++I+QG +GDNFYI+DQGEV+I+VN     TVSEGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGSTI+KRK+Y+EFLS+VPILE LD WE+LTVADALE++ F+D + VV+QGE GEDF++I+EGVA V QKPS+++  +EVG L  SDYFGEIALLL+RPRAATV A GPLKCVKLDRKRFERVMG C +ILKRNI KYNSYI +TV
Sbjct:    8 AHLKDVESYLEKHGVQKVLKECIVQLCTVQPDNPFEYIKEYFDKVDKDRI---LMPDQFATTGAGSESLASSALATGTSRALASTAGAALPMPGTEGDVDYDSETMLPPMPAAAAAPQSQKQRTRRGAVSGEVYTEEDAASYVKKVVPKDYKTMGALSKAITKNVLFSHLDENERSDIFDAMFPLHRNADEVIIEQGAEGDNFYILDQGEVDIFVNGNYISTVSEGGSFGELALIYGTPRAATVKAKTEVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSKVPILENLDLWERLTVADALENVTFEDQKIVVRQGEAGEDFFIILEGVASVLQKPSENDEAVEVGRLGPSDYFGEIALLLDRPRAATVIARGPLKCVKLDRKRFERVMGPCGDILKRNIAKYNSYILLTV 414          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A1I8H3F0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016081g3 PE=4 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 2.571e-177
Identity = 250/410 (60.98%), Postives = 315/410 (76.83%), Query Frame = 1
Query:   61 SYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVC--------SAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            ++L+++E Y++ H + ++LK+C+V+LC  +P++P  +I+EYF  ++K  +   L   +   T     +    + +   S          + + G   +VD  S  +         + + +K R RRGAVSGEVYTE+DAASYVKKVVPKDYKTM ALSKAI KNVLFSHLDE ERSDIFDAMFPLH+ A+E++I+QG +GDNFYI+DQGEV+I+VN +   TVSEGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGSTI+KRK+Y+EFLS+VPILE LD WE+LTVADALE++ F+D + VV+QGE GEDF++I+EGVA V QKPS+++  +EVG L  SDYFGEIALLL+RPRAATV A GPLKCVKLDRKRFERVMG C +ILKRNI KYNSYI +TV
Sbjct:    8 AHLKDVEGYLEKHGVQKVLKECIVQLCTVQPDNPFEYIKEYFDKVDKDRI---LMPDQFATTGAGSESLASSALATGTSRALASTAGTALPMPGTEGDVDYDSETMLPPMPAAAAAPQSQKQRTRRGAVSGEVYTEEDAASYVKKVVPKDYKTMGALSKAITKNVLFSHLDENERSDIFDAMFPLHRNADEVIIEQGAEGDNFYILDQGEVDIFVNGDYISTVSEGGSFGELALIYGTPRAATVKAKTEVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSKVPILENLDLWERLTVADALENVTFEDQKIVVRQGEAGEDFFIILEGVASVLQKPSENDEAVEVGRLGPSDYFGEIALLLDRPRAATVIARGPLKCVKLDRKRFERVMGPCGDILKRNIAKYNSYILLTV 414          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A1S8WHE0 (Cyclic nucleotide-binding domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_10517 PE=4 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.728e-176
Identity = 265/480 (55.21%), Postives = 331/480 (68.96%), Query Frame = 1
Query:   61 SYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLE--------------------KQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNEL------EDHMAGMEIIG----------------LACNVDEYS----------------------SVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEV--------------EIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            S++  +E+YIK +NIH+LL+D +V LCL +P++PV ++REYF+ LE                    K N+  +L+ ++   + N+       SF+ +D++N L      E      + +G                +  NVD                         S   S++  + R RRGAVSGEVYTE+DAASYVKKVVPKDYKTM+ALSKAI KNVLFSHLDE ERSDIFDAMFP+H+   +++IQQGD+GDNFYI+DQGEV              +I+VN+E + TV EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGSTI++RK+YQEFL RVPIL+ LDKWE+LTVADALE + F+DGE VV+QGE G+DF++I EG AKV QKPS+S   +EVG+L  SDYFGEIALLL+RPRAATV A GPL+CVKLDRKRFERVMG C++ILKRNI KYNSYIS++V
Sbjct:    5 SFINGVEDYIKRYNIHELLRDSIVNLCLYRPSNPVGYLREYFEKLETKSIPCGADSMENGGVTSSQKSNIPRHLSTTKKPYSTNESGPLPPVSFNQSDNVNHLNCNHKEEPRSHDADFVGANNFLSGTFLNETVPQIPYNVDPNGGASESGVGEAGSSGGNESFTTFSPSGSSEVTRRRSRRGAVSGEVYTEEDAASYVKKVVPKDYKTMTALSKAIAKNVLFSHLDETERSDIFDAMFPVHRNPGDVIIQQGDEGDNFYIVDQGEVDPIHVVHFMVCVIAQIFVNNEYSSTVGEGGSFGELALIYGTPRAATVKAKTEVKLWGIDRDSYRRILMGSTIRRRKMYQEFLCRVPILDNLDKWERLTVADALEPVRFEDGEVVVRQGEPGDDFFIITEGTAKVLQKPSESVEPVEVGKLRPSDYFGEIALLLDRPRAATVVAQGPLRCVKLDRKRFERVMGPCSDILKRNIAKYNSYISLSV 484          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 498.049 bits (1281), Expect = 7.184e-175
Identity = 244/400 (61.00%), Postives = 308/400 (77.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E Y++ HNI QLLKDC+V+LC S+P  P+ F+REYF+ LEK+  K  L++ ++               S +DS    ED ++              + VV      K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLFSHLD+ ERSDIFDAMFP+   A EI+IQQGD+GDNFY+IDQGE+++YVN+E   ++ EGGSFGELALIYGTPRAATVRA T+ KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+D + +V QGE G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   14 LRECELYVQKHNIQQLLKDCIVQLCTSRPERPMVFLREYFERLEKEEAKQLLSQQKTS--------------SRSDSR---EDEVS-----------PPMNPVV------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVNNEWATSIGEGGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVVQGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 379          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1aa (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103047413])

HSP 1 Score: 486.878 bits (1252), Expect = 1.459e-170
Identity = 234/400 (58.50%), Postives = 305/400 (76.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E+Y++ H+I QLLKDC+V+LC S+P  P++F+R+YF+ LEK+  K  + + +S   ++    +   S   N  +                                K R RRGA+S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMFP++  A E +IQQGD+GDNFY+IDQGE+++YVN+    ++ EGGSFGELALIYGTPRAATVRA T+VKLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE++ F+DG+ +V QG+ G++F++I+EG A V Q+ S++E  +EVG L  SDYFGEIALL+NRPRAATV A  PLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   14 LRECEQYVQKHSIQQLLKDCIVQLCTSRPERPMAFLRDYFERLEKEEAKQMVGQQKSSSRSD--SREDEISPPMNPVV--------------------------------KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVNYIAGETVIQQGDEGDNFYVIDQGEMDVYVNNAWVTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALETVQFEDGQKIVVQGQPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARSPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 379          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:111191378])

HSP 1 Score: 484.567 bits (1246), Expect = 1.622e-169
Identity = 238/400 (59.50%), Postives = 296/400 (74.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E +++ HN+ Q+LK+C+V LC++KP  P+ F+RE+F+ LEK+  K  L   +S   ++   ++                                  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGEV++YVN E    + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE L+KWE+LTVADALE + F+DGE +V QGE G+DF++I EG A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   16 LKGCEIFVQKHNVQQILKECIVNLCIAKPERPMKFLREHFEKLEKEECKQILARQKSSSQSDSHDDE---------------------------------VSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTGIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 382          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 210.69 bits (535), Expect = 6.275e-63
Identity = 108/266 (40.60%), Postives = 170/266 (63.91%), Query Frame = 1
Query:  472 VVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVN-DELNCTVSE---GGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKP---SDSEN--EIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            V PK  +    L +A +  +LF  LD+++ S++ DAMF +  +  E +I QGDDGDNFY+I++G  +I V  D + C V +    GSFGELAL+Y TPRAAT+ A  +  LWG+DR ++RR+++ +  KKR++Y+ F+  VP+L+ L+  E++ + D L    F DGE ++ QG++ + FY++  G  K+  K    +D ++  E+E+       YFGE+AL+ N+PRA +  A G +KC+ +D + FER++G C EI+KRNI  Y
Sbjct:  102 VHPKTDEQRCRLQEACKDILLFKALDQEQFSEVLDAMFEVIVQPQEHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYDNKGSFGELALMYNTPRAATIIAKQEGALWGLDRATFRRLIVKNNAKKRRMYECFIESVPLLKSLEISERMKIVDVLGVKIFHDGERIIMQGDMADCFYIVESGEVKIMMKSKTKADRQDNAEVEITRCTRGQYFGELALVTNKPRAGSAYAVGDIKCLVIDVQAFERLLGPCKEIMKRNIAHY 367          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:103029925])

HSP 1 Score: 209.149 bits (531), Expect = 5.076e-62
Identity = 130/391 (33.25%), Postives = 212/391 (54.22%), Query Frame = 1
Query:  103 IHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYT--EDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYV-NDELNCTVSE---GGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQK----PSDS-ENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            + +LL+   V++  ++P   + F  +YF  L+           E+E       N++  +     ++N +E+ M     I      DE       A      +RR +V  E +   EDD     +   PK  +    L +A +  +LF +LD+++ S + DAMF     + E +I Q DDGDNFY+I++G  +I V +D  + TV      GSFGELAL+Y TPRAAT+ A +   LW +DR ++RRI++ +  KKRK+Y+ F+  +P+L  L+  E++ V D L S  +  GE ++ QG++ + FY++  G  ++  K     +DS E E+++       YFGE+AL+ N+PRAA+  A   +KC+ +D + FER++G C +I+KRNI  Y
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQLK-----------ENESRGGAFGNEQNSAVRAGKAVNFIEEAMQ----IDSENEEDEDDDEEFVAPVINRFIRRASVCAEAFNPDEDDEDKEPRVTHPKTDEQRHRLQEACKDILLFKNLDQEQMSQVLDAMFDKAVTSGEHIIDQDDDGDNFYVIERGTFDILVKSDGTSRTVGSYDNRGSFGELALMYNTPRAATIVATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSSKVYSKGEQIIAQGDLADSFYIVESGEVRITMKRNRLKTDSEEEEVDIATCTRGQYFGELALVTNKPRAASAYAVENVKCLVMDVQAFERLLGPCMDIMKRNIANY 384          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 165.622 bits (418), Expect = 2.697e-48
Identity = 74/183 (40.44%), Postives = 121/183 (66.12%), Query Frame = 1
Query:  715 GSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVF-----QKPSDS--ENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            GSFGELAL+Y TPRAAT+ A T+  LW +DR ++RRI++ +  +KRK+Y+ F+  VP+L+ LD  E++ V D + + +++DGE ++ QG   + F+++  G  ++      Q P+++  E E+E+       YFGE++L+ N+PRAA+  A G +KC  +  + FER++G C +I+KRNI  Y
Sbjct:   24 GSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCTRGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPFERLLGPCMDIMKRNITHY 206          

HSP 2 Score: 52.7582 bits (125), Expect = 3.937e-8
Identity = 36/119 (30.25%), Postives = 52/119 (43.70%), Query Frame = 1
Query:  517 IEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELN---------------CTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRIL 828
            IE   L   LD  ER  + D +     +  E +I QG   D F+I++ GEV I +  +                 CT   G  FGEL+L+   PRAA+  A  +VK   +    + R+L
Sbjct:   76 IESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCT--RGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPFERLL 192          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008271.1 (pep scaffold:Pmarinus_7.0:GL478901:32972:39586:1 gene:ENSPMAG00000007483.1 transcript:ENSPMAT00000008271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 2.505e-47
Identity = 82/187 (43.85%), Postives = 111/187 (59.36%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQG 627
            + + E Y++ HNI  LLKDC+V+LC+++P  P+ F+RE+F+ LEK+ LK   N +      ND++     S + N  +                                  R RRGAVS EVYTE+D   Y +KV+PKDYKTM+ALSKAI +NVLFSHLD+ ERSDIFDAMFP+   A +++IQQG
Sbjct:    8 VRDCERYVQKHNIQALLKDCIVQLCVARPERPMRFLREFFEKLEKEQLKTGWNNASGGNAANDVN---AASPTANPVI--------------------------------ATRNRRGAVSAEVYTEEDVKGYERKVIPKDYKTMAALSKAIARNVLFSHLDDSERSDIFDAMFPVTHIAGDVVIQQG 159          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 154.451 bits (389), Expect = 4.306e-43
Identity = 103/322 (31.99%), Postives = 172/322 (53.42%), Query Frame = 1
Query:  103 IHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITN--NDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARL-----RRGAVSGEVYTEDDAASYVKKVV--PKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYV--NDELNC--TVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKV 1029
            + +LL+   V++  S+P   + F   YF  + +Q  ++       ++ +  +D H +          +N  E+++AG          D+         D +A +     RR +V  E Y  D+     +  V  PK  +  + L +A +  ++F +LD+++ S + DAMF    +  E +I QG DGDNFY+I++G  +IYV  ND   C    +  GSFGELAL+Y T RAAT+ A ++  LWG+DR ++RRI++ +  KKRK+Y+ F+  VP+L+ LD  E+L V D + S +F D E ++ QGE  + FY++  G  ++
Sbjct:    9 LTELLQAFTVEVLRSRPADLLDFAAAYFAEM-RQRARERCGAPAQQLADGFDDAHGR---------GVNFSEENVAGHSSNSDNNGDDDRDDDDDDESDFEAPVISRFTRRASVCAEAYNPDEEEEDTETRVIHPKTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESGEVRI 320          

HSP 2 Score: 63.5438 bits (153), Expect = 2.861e-11
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = 1
Query:  820 RILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSY 1251
            R++   T ++R   QE    + I + LD+ +   V DA+     + GE+V+ QG  G++FY+I  G+  ++   +D      VG       FGE+AL+ N  RAAT+ A        LDR  F R+      I+K   KK   Y
Sbjct:  129 RVIHPKTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSR--CVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRI------IVKNAAKKRKMY 264          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 1.400e-38
Identity = 65/95 (68.42%), Postives = 77/95 (81.05%), Query Frame = 1
Query:  607 EILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPIL 891
            EI+  Q  D     I+   EVE+YVN EL  ++ EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V IL
Sbjct:    1 EIVETQNKDCLRLNIVCDSEVEVYVNVELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          

HSP 2 Score: 43.8986 bits (102), Expect = 5.215e-6
Identity = 33/77 (42.86%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1045 DSENEIEVG-ELLTS----DYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERV-MGSCAEILKRNIKKYNSYIS 1257
            DSE E+ V  EL+TS      FGE+AL+   PRAATV+A   LK   +DR  + R+ MGS      R  K Y  ++S
Sbjct:   18 DSEVEVYVNVELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL----RKRKMYEEFLS 90          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006754.1 (pep scaffold:Pmarinus_7.0:GL480706:4401:8544:-1 gene:ENSPMAG00000006099.1 transcript:ENSPMAT00000006754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 3.226e-36
Identity = 76/165 (46.06%), Postives = 99/165 (60.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKER 561
            L E EEY++ H I  +LK C+V+LC+++P  P+ F+RE+F+ LEK+  K  L+              +  S S +DS  E        EI     N      VV      K R RR A S EVYTE+DAASYV+KV+PKDYKTM+ALSKAI++NVLFSHLD+ ER
Sbjct:   14 LRECEEYVQRHGIQAVLKQCIVQLCIARPERPMQFLREHFERLEKEEAKQFLS--------------RRMSNSLSDSWEE--------EISPPPPN-----PVV------KGRSRRMAFSAEVYTEEDAASYVRKVIPKDYKTMAALSKAIQRNVLFSHLDDNER 145          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 194.126 bits (492), Expect = 4.032e-57
Identity = 103/279 (36.92%), Postives = 162/279 (58.06%), Query Frame = 1
Query:  409 RRGAVSGEVYTEDDAASYVKKVVPKDYK-----TMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRN 1230
            RR +VSGE    ++   +     P  YK      +  L K+I  N LF+ LD   +  + + +          +I+QGD GD FY++++G V+ YVND    +   G SFGELAL+Y +PRAATV A +D  LW +DR ++R+IL+GS+ KKR +Y + L  +P+L+ L  +++  +ADAL++  +  GE ++++G+ GE+FY+I  G   V +K      +  + +L   DYFGE+ALL + PR ATV A    K   L +  F+R++G   ++LK N
Sbjct:  142 RRTSVSGETLQPNNFDDWT----PDHYKEKSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKK-----GQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVDVLKLN 411          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 450.669 bits (1158), Expect = 1.055e-156
Identity = 232/405 (57.28%), Postives = 288/405 (71.11%), Query Frame = 1
Query:   55 NASYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVND-ELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            +A  L + E Y++ HNI  +LKDC+V+LC+SKP +P  F REYF+ LEK+     L E+E E                     E+E+H    +                       R RRGAVS    TED+A SYVKKVVPKDYKTM+ALSKAI KN+LFSHLDE ERSDIFDAM  +   A EI+I+QGD+GDNFYI+D GEV+++VN+  L  T+ EGGSFGELALIYGTPRAAT++A TDVKLW IDR +YRRILMGS I+KR++Y++FL +V ILE LDKWE+LTVADALE   F DG+ VV QGE G++F++I+EG A V Q+ S +E+ IEV  L  SDYFGEIAL+LNRPRAATVQA G LKCVKLDR+RFERV+G C +ILKRNI++YNS++S+ V
Sbjct:   10 DAEALRQCEIYVEKHNIQGVLKDCIVQLCISKPENPYKFFREYFEKLEKKEETARL-EAEPE------------------QRAEVEEHPPPSKPF--------------------QRQRRGAVSAAPITEDEATSYVKKVVPKDYKTMAALSKAITKNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVNNVGLVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVEGTAVVLQRRSANEDFIEVSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRFERVLGPCIDILKRNIQQYNSFVSLVV 375          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO38262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH8])

HSP 1 Score: 221.476 bits (563), Expect = 2.154e-67
Identity = 134/387 (34.63%), Postives = 211/387 (54.52%), Query Frame = 1
Query:  103 IHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTED--DAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYV----NDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKV-FQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            +  LL+D  V +   KP   V F   YF  L+   LK+  ++   +       +        +D+ NE ED              DE        K++ AR  R +V  E +  D  D       V PK  +    L+ AI+  +LF +L +++ +++ DAMF    +A + +I QGDDGDNFY+ID+G+ +IYV     +++  +    GSFGELAL+Y TPRAAT+ + ++  +WG+DR ++RRIL+ +  KKRK+++  L  VP+L+E+ ++E++ +ADAL S  F DGE ++KQG+  +  Y +  G   +     SD   E+E+ +     YFGE+AL+ +  RAA+V + G   C  LD   FER++G C +I+KRNI  Y
Sbjct:    9 LSDLLQDFTVHVLREKPEDIVDFAANYFMKLK---LKEKRSQKGKKKNKEKGVSFGPPGNDEDDTYNEDED--------------DEMPE---PPKNRYAR--RQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKEQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVIDRGQYDIYVRIDGQEKMVGSYDNKGSFGELALMYNTPRAATIVSTSEGVIWGLDRMTFRRILLKAAAKKRKVHEALLETVPLLQEITEYERMNLADALVSRQFKDGECIIKQGDEADFMYFVESGTVSIRMHNKSDPTTEVEIAQCTKGGYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLLGPCMDIMKRNIDGY 373          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO49534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ3])

HSP 1 Score: 183.726 bits (465), Expect = 4.809e-53
Identity = 121/389 (31.11%), Postives = 198/389 (50.90%), Query Frame = 1
Query:   97 HNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDA-ASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVN----DELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEV-GELLTSDYFGEIALLLNRPRAATVQA-CGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
              +H+LL+  ++ +   +P+  V F   YF  L                +   IH+      S   S  E ED     E + L  +  +  S     ++ +  LRR +V+GEVY   ++     ++  PK       L   I    +F    + + + + DAM+       E +I+QGD GDNFYIID+GE E+        E    +   GSFGELAL+Y  PR+AT+RA T   LW +DR S+RRIL+ +T +KR+ Y+  L R+P+L +L  +E+ ++ADAL +  + D E +++Q +  +  Y I  G+ ++  + S   ++++V       +YFGE+AL+    R A+V A  G + C  L+   FER++G C  +++RN+K Y
Sbjct:    8 QELHKLLQSFILDVFTEQPDDLVDFAASYFSKLN--------------TSRKPIHS------SSTPSTQE-EDDFYCSESLSLPSDRFKRPSY---QQNHRLYLRRDSVAGEVYEPVNSNCVSAQRFYPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETNGAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSFRRILVDTTERKRRHYETLLERIPVLSQLTAYERTSLADALTTSVYRDEECIIRQDDPADCLYFIESGIVEISIRDSKDRSKVKVISTAGPGEYFGELALVNKTKRGASVHAKGGQVTCAVLEVNAFERLLGPCKGLMQRNMKTY 372          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO41163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S513])

HSP 1 Score: 176.792 bits (447), Expect = 1.523e-50
Identity = 108/289 (37.37%), Postives = 162/289 (56.06%), Query Frame = 1
Query:  397 KARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNC------TVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQG-EVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            K R RR AVS E Y  ++ A +  K  PK  +  + L K + +  LF     ++   I D+MF       EI+I+ GD+GDNFY+I+ GE +++  D          T +  G FGELAL++ + R AT+ A T+  LW +DR ++ ++++G   ++R+   E L  V IL+EL   E   V+DAL    F DGE V+++G E     Y I +G  +V  K  + E  +E       +YFGE+AL++N+PR+A+V A G  K   L +  FER+MG C EI+KRN K+Y
Sbjct:   78 KGRSRRAAVSAEPYNPNENADFKAKFHPKSEEQRNHLKKKLLELWLFEKFHREDLDVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVTVKDGEVEKTVE----FDKNYFGELALVMNQPRSASVYAVGECKFASLKKDDFERLMGPCKEIMKRNAKEY 362          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 151.369 bits (381), Expect = 2.203e-39
Identity = 96/292 (32.88%), Postives = 160/292 (54.79%), Query Frame = 1
Query:  385 AKDKKARLR------RGAVSGEVYTEDDAASYVKKVV---PKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQA-CGPLKCVKLDRKRFERVMGSCAEILKRN 1230
            A ++K +LR      R AVSGE  T+    S   K +   PKD+++   +  AI +N    +L+  +  +I D M+    + N+++IQ+GD G+  Y I  G +++   +++   +  G  FGELA++Y   R ATV A    KLW IDR  ++ I+M + + ++  +  FL  VP+L+EL   E   +AD LE   +  G+Y++++ E G+ FY+I +G A+V Q+        E+ +L   DYFGE ALL    R A V A    ++C+ +DR  F  V+G+  E+ +++
Sbjct:    7 APERKKKLRPSKKEKRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVIGNMDELREKD 298          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 497.664 bits (1280), Expect = 8.714e-175
Identity = 243/400 (60.75%), Postives = 300/400 (75.00%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L+  E +++ HNI Q+LK+C+V LC++KP  P+ F+RE+F+ LEK+  K  +   +S  + +D H                                D+  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGEV++YVN EL   + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG+A V Q+ SD+E  +EVG L  SDYFGEIALLLNRPRAATV A GPLKCVKLDR RFERV+G C+EILKRNI++YNS+IS+TV
Sbjct:   14 LKSCEIFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEECKHIMARQKSN-SQSDSH--------------------------------DDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV 380          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1ab (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:101156203])

HSP 1 Score: 496.123 bits (1276), Expect = 3.300e-174
Identity = 241/400 (60.25%), Postives = 305/400 (76.25%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            L E E+Y++ HNI QLLKDC+V+LC S+P+ P++F+REYF+ LEK+  K              I N++    S +DS +E                V    + V      K R RRGA S EVYTE+DAASYV+KV+PKDYKTM+AL+KAIEKNVLF+HLD+ ERSDIFDAMFP+   A E +I QGD+GDNFY+IDQGE+++YVN+E   ++ EGGSFGELALIYGTPRAATV+A T+VKLWGIDRDSYRRILMGST++KRK+Y+EFL +V ILE LDKWE+LTVADALE + F+DG+ +V QGE G++F++I+EG A V Q+ S+ E  +EVG L  SDYFGEIALL+NRPRAATV A GPLKCVKLDR RFERV+G C++ILKRNI++YNS++S++V
Sbjct:   14 LRECEQYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEEAKQ-------------IQNQQKAGSSRSDSRDE---------------EVSPPMNPVV-----KGRRRRGAFSAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVILQGDEGDNFYVIDQGEMDVYVNNEWVTSIGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLRKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSEHEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 380          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 401.364 bits (1030), Expect = 1.554e-137
Identity = 198/348 (56.90%), Postives = 250/348 (71.84%), Query Frame = 1
Query:   67 LEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIAL 1110
            L+  E +++ HNI Q+LK+C+V LC++KP  P+ F+RE+F+ LEK+  K  +   +S  + +D H                                D+  S        KAR RRG VS EVYTE+DA SYV+KV+PKDYKTM+AL+KAI KNVLF+HLD+ ERSDIFDAMFP+   A E +IQQGD+GDNFY+IDQGEV++YVN EL   + EGGSFGELALIYGTPRAATV+A TD+KLWGIDRDSYRRILMGST++KRK+Y+EFLS+V ILE LDKWE+LTVADALE + F+DGE +V QGE G+DF++I EG+A V Q+ SD+E  +EVG L  SDYFG+  L
Sbjct:   14 LKSCEIFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEECKHIMARQKSN-SQSDSH--------------------------------DDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIASVLQRRSDNEEYVEVGRLGPSDYFGQCHL 328          

HSP 2 Score: 65.0846 bits (157), Expect = 4.841e-11
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  802 DRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTS----DYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERV-MGSCAEILKRNIKKYNSYIS 1257
            D  SY R ++    K      + +S+  +   LD  E+  + DA+  +    GE V++QG+ G++FY+I +G   V+            GEL+T+      FGE+AL+   PRAATV+A   LK   +DR  + R+ MGS      R  K Y  ++S
Sbjct:  108 DAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVN----------GELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL----RKRKMYEEFLS 250          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 214.927 bits (546), Expect = 2.713e-64
Identity = 114/285 (40.00%), Postives = 172/285 (60.35%), Query Frame = 1
Query:  409 RRGAVSGEVYTEDDAASYVKKVV--PKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSEN-----EIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            RR +V  E +  DD     +  V  PK  +    L +A    +LF  LD+++ S + DAMF L  +  E +I QG DGDNFY+I++G  +I V+ +     +  GSFGELAL+Y TPRAAT+ A  +  LWG+DR ++RR+++ +  KKR++Y+ F+  VP+L+ L+  E++ + D L    F DGE ++ QGE  E FY++  G  K+  K     +     E+E+       YFGE+AL+ N+PRAA+  A G +KC+ +D + FER++GSC EI+KRNI  Y
Sbjct:   91 RRVSVCAEAFNPDDDDEDTEPRVVHPKTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHY 375          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 207.994 bits (528), Expect = 1.775e-61
Identity = 109/291 (37.46%), Postives = 170/291 (58.42%), Query Frame = 1
Query:  406 LRRGAVSGEVYT--EDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVN----DELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPS------DSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            +RR +V  E +   ED+     +   PK  +    L +A    +LF +LD +E S + DAMF       E +I Q DDGDNFY+I+ G   I+V     ++L       GSFGELAL+Y TPRAAT+ A +   LW +DR ++RRI++ +  KKR+LY+ F+  +P+L  L+  E++ V D L +  ++D + ++ QG++ + FY++  G  ++  K S        E E+E+       YFGE+AL+ N+PRAA+  A G +KC+ +D + FER++G C +I+KRNI  Y
Sbjct:  100 IRRASVCAEAFNPDEDEEDKEPRVTYPKTDEQRQRLQEACRDILLFKNLDPEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANY 390          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000074764.1 (SMESG000074764.1)

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 403/405 (99.51%), Postives = 404/405 (99.75%), Query Frame = 1
Query:   52 MNASYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            MNASYLE+LEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNL DNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV
Sbjct:    1 MNASYLEDLEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLNDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 405          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000006310.1 (SMESG000006310.1)

HSP 1 Score: 354.369 bits (908), Expect = 7.168e-121
Identity = 165/229 (72.05%), Postives = 200/229 (87.34%), Query Frame = 1
Query:  580 MFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYISITV 1266
            MFP+H+   EI+IQQGD+GDNFYIIDQG+V+I +N E   +V EGGSFGELALIYGTPRAATVRA T+VKLWGIDRDSYRRILMGSTI+KR++Y+EFLS+VPILE LDKWE+LTVADALE++ F++ + VVKQG+ G+DF++I +G A V Q+P D+E   EVG+L  SDYFGEI+LLL+RPRAATV A GPLKCVKLDRKRFERV+G C++ILKRNI KYNS+IS+TV
Sbjct:    1 MFPVHRNPAEIIIQQGDEGDNFYIIDQGQVDIIMNGEYVNSVVEGGSFGELALIYGTPRAATVRARTEVKLWGIDRDSYRRILMGSTIRKRRMYEEFLSKVPILENLDKWERLTVADALETVCFENNQIVVKQGDPGDDFFIITDGTAAVLQQPMDTEESFEVGKLGPSDYFGEISLLLDRPRAATVIAKGPLKCVKLDRKRFERVLGPCSDILKRNISKYNSFISLTV 229          

HSP 2 Score: 63.1586 bits (152), Expect = 4.864e-11
Identity = 47/152 (30.92%), Postives = 80/152 (52.63%), Query Frame = 1
Query:  448 DAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIY---VNDELNCTVSEGGS---FGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMG-STIKKRKL--YQEFLS 876
            D  SY + ++    +      + + K  +  +LD+ ER  + DA+  +  + N+I+++QGD GD+F+II  G   +    ++ E +  V + G    FGE++L+   PRAATV A   +K   +DR  + R+L   S I KR +  Y  F+S
Sbjct:   75 DRDSYRRILMGSTIRKRRMYEEFLSKVPILENLDKWERLTVADALETVCFENNQIVVKQGDPGDDFFIITDGTAAVLQQPMDTEESFEVGKLGPSDYFGEISLLLDRPRAATVIAKGPLKCVKLDRKRFERVLGPCSDILKRNISKYNSFIS 226          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000017499.1 (SMESG000017499.1)

HSP 1 Score: 210.305 bits (534), Expect = 6.171e-63
Identity = 126/389 (32.39%), Postives = 210/389 (53.98%), Query Frame = 1
Query:  103 IHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQN--LKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVY---TEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSYI 1254
            + +LL++  + +   KP++ V +  EYF++L  ++  + ++ N + SE ++ND + KK                                            R RR +V+ E +    EDD    V  +  K     S L +AI+   LF  LD+++R  + D+M  +  ++++ +I QGD GD+FY+I++G  +I+VN       S+ GSFGELAL+Y TPRAAT+ + T+  LW +DR ++R I++ +  KKR++Y+  L  V +L+EL  +++  VADAL S  ++D E +++QG+ G + + I  G  +V +  +D     EV  L   DYFGE+ALL+  PR A+V A G      LD K FER++G C  ++K+N+ KY + +
Sbjct:   12 LTELLQNFAISVLRHKPHNLVHYAFEYFKDLSSKHEEINNSGNHTHSEDSDNDDNIKKQVQ-----------------------------------------RGRRQSVAAESFDPEKEDDEDLPV--IYSKTDAQRSRLVEAIKPIFLFRSLDDEQRGKVIDSMREVVVESDQKVIVQGDGGDDFYVIEKGMFDIFVNGSKIGNYSDTGSFGELALMYNTPRAATIISVTNGILWAMDRKTFRHIVLKNAFKKRQMYEGLLQSVDLLDELSSYDRTNVADALVSRTYEDSEMILEQGKPGMEMFFIENGEVRVIRDTNDGSPPKEVNRLHKGDYFGEVALLIKEPRLASVYAVGKTTVAVLDIKSFERLLGPCINLMKKNLPKYRNQL 357          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000023850.1 (SMESG000023850.1)

HSP 1 Score: 204.527 bits (519), Expect = 1.199e-60
Identity = 132/389 (33.93%), Postives = 200/389 (51.41%), Query Frame = 1
Query:  109 QLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGE--VYTEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVND----ELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEG---VAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNS 1248
            ++L D   ++   +P+  V ++  YF                 +I +   HNK   S  HND  +          +  L  ++D   S     K  KA  RR +V+ E     + D    +  V+PK  +    L +  ++ +LF  LD+ + + + +AMF +  K  E +I QGDDGDNFY+ID G    Y+ D    +L       G FGELAL+Y   R+ATV A T   LW +DR ++R +++  T  ++++Y  FL + PI +E+   E++ +ADAL    +DD E ++KQG  G++ + I  G   + KV Q       EIE+  L    YFGE+ALL N+ R A+ QA G  +C  LD K FER+MG C EI+KRNI+ YN+
Sbjct:   14 EMLVDLTFEVLKDQPDDFVEYVSNYF----------------LKIYDEQGHNKVYKS-PHNDQSDSF--------VNSLLDSLDSIDSEDIEVK-PKANYRRKSVAAERIDMDDIDDDDDIYAVIPKTDEQRQRLKEVCKQILLFQALDDDQLNHVINAMFLVEPKPGENIIVQGDDGDNFYVIDSGIFNCYIKDGDKDKLIHVYENEGFFGELALMYNAVRSATVTAETAGTLWAMDRKTFRSLVVVQTHNRKQIYDTFLKQFPIFQEMTASERMNIADALVPKKYDDKEVIIKQGRPGQEMFFIENGEVLITKVHQG-----KEIEITRLHVGQYFGELALLSNQARQASAQAVGETRCAMLDVKTFERLMGPCLEIMKRNIEDYNT 371          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000019065.1 (SMESG000019065.1)

HSP 1 Score: 194.897 bits (494), Expect = 5.006e-57
Identity = 123/393 (31.30%), Postives = 201/393 (51.15%), Query Frame = 1
Query:   82 EYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEKQNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLACNVDEYSSVVCSAKDKKARLRRGAVSGEVY--TEDDAASYVKKVVPKDYKTMSALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYIIDQGEVEIYVN-DELNCTVSE---GGSFGELALIYGTPRAATVRAATDVKLWGIDRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINFDDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGEIALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKY 1242
            E +      +LL+D  V +    P   + F  +YF+  + + L+    +SESE               ++D + EL                             + + RR  V+ E +   ++D  +  + V PK  +  + L+ A++  +LF  LDE++  D+ DAMF       E +I QG+DGDNFY+I+ G  +I V  + ++  V +    GSFGELAL+Y TPRAAT++   D  +W + R+++R I++    +KR  Y+  L  VP+L+EL  +E++ +ADAL +  ++    ++KQGE G + Y + EG  +V  + + S+ E EV  +    YFGE+ALL   PRAA+V      K   LD   FER++G C +I++R+I  Y
Sbjct:    5 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESE---------------NDDQMEELPPM-------------------------PRPQGRRRGVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 357          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR1B1.355e-17360.25protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1B1.355e-17360.25protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1B1.355e-17360.25protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1B1.355e-17360.25protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1B1.355e-17360.25protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-21.005e-12648.24cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.208e-12648.24cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.141e-11759.52cAMP-dependent protein kinase regulatory subunit ... [more]
egl-43.640e-3229.72cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-43.640e-3229.72cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R18.048e-17361.00gene:FBgn0259243 transcript:FBtr0300535[more]
Pka-R18.048e-17361.00gene:FBgn0259243 transcript:FBtr0300534[more]
Pka-R18.048e-17361.00gene:FBgn0259243 transcript:FBtr0300528[more]
Pka-R18.048e-17361.00gene:FBgn0259243 transcript:FBtr0300530[more]
Pka-R18.048e-17361.00gene:FBgn0259243 transcript:FBtr0299892[more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar1ab1.399e-17661.25protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1b1.206e-17360.50protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1b1.206e-17360.50protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1aa1.740e-16958.00protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1b7.708e-11573.83protein kinase, cAMP-dependent, regulatory, type I... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adarb15.116e-17460.50adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
adarb11.067e-17361.00adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
adarb13.158e-15873.45adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
prkar1a9.021e-11963.98protein kinase cAMP-dependent type I regulatory su... [more]
prkar1a1.426e-11863.98protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkar1b1.222e-17160.75protein kinase, cAMP dependent regulatory, type I ... [more]
Prkar1b1.222e-17160.75protein kinase, cAMP dependent regulatory, type I ... [more]
Prkar1a1.037e-17059.50protein kinase, cAMP dependent regulatory, type I,... [more]
Prkar1a1.037e-17059.50protein kinase, cAMP dependent regulatory, type I,... [more]
Prkar1b1.007e-13772.76protein kinase, cAMP dependent regulatory, type I ... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31319|KAPR_APLCA2.523e-17459.50cAMP-dependent protein kinase regulatory subunit O... [more]
sp|P31321|KAP1_HUMAN6.507e-17360.25cAMP-dependent protein kinase type I-beta regulato... [more]
sp|Q5ZM91|KAP0_CHICK9.772e-17360.61cAMP-dependent protein kinase type I-alpha regulat... [more]
sp|P16905|KAPR1_DROME8.067e-17261.00cAMP-dependent protein kinase type I regulatory su... [more]
sp|P09456|KAP0_RAT4.440e-17159.75cAMP-dependent protein kinase type I-alpha regulat... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J2X20.000e+063.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JK811.639e-18063.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HGN27.250e-17861.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H3F02.571e-17760.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S8WHE01.728e-17655.21Cyclic nucleotide-binding domain protein OS=Opisth... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar1ab7.184e-17561.00cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1aa1.459e-17058.50cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1b1.622e-16959.50protein kinase cAMP-dependent type I regulatory su... [more]
prkar2aa6.275e-6340.60protein kinase, cAMP-dependent, regulatory, type I... [more]
si:ch211-272n13.75.076e-6233.25protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa2.697e-4840.44protein kinase, cAMP-dependent, regulatory, type I... [more]
ENSPMAT00000008271.12.505e-4743.85pep scaffold:Pmarinus_7.0:GL478901:32972:39586:1 g... [more]
si:ch211-272n13.74.306e-4331.99protein kinase cAMP-dependent type II regulatory s... [more]
ENSPMAT00000005026.11.400e-3868.42pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
ENSPMAT00000006754.13.226e-3646.06pep scaffold:Pmarinus_7.0:GL480706:4401:8544:-1 ge... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY14.032e-5736.92Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484391.055e-15657.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382622.154e-6734.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495344.809e-5331.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411631.523e-5037.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383992.203e-3932.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar1b8.714e-17560.75protein kinase cAMP-dependent type I regulatory su... [more]
prkar1ab3.300e-17460.25protein kinase cAMP-dependent type I regulatory su... [more]
prkar1b1.554e-13756.90protein kinase cAMP-dependent type I regulatory su... [more]
prkar2aa2.713e-6440.00cAMP-dependent protein kinase type II-alpha regula... [more]
si:ch211-272n13.71.775e-6137.46protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074764.10.000e+099.51SMESG000074764.1[more]
SMESG000006310.17.168e-12172.05SMESG000006310.1[more]
SMESG000017499.16.171e-6332.39SMESG000017499.1[more]
SMESG000023850.11.199e-6033.93SMESG000023850.1[more]
SMESG000019065.15.006e-5731.30SMESG000019065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007839 ID=SMED30007839|Name=cAMP-dependent protein kinase type I-alpha regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1541bp
AAATTAAAATATTGAATTATCCTGATTTACTTTATTTATATTAACTGAAA
AATGAATGCAAGCTACCTTGAAGAGCTAGAAGAATATATTAAAGTACACA
ATATTCACCAGTTACTTAAGGATTGTGTAGTTAAGTTGTGTTTGTCGAAA
CCCAATTCACCGGTATCATTTATTCGTGAATACTTTCAAAATCTTGAGAA
GCAGAACCTGAAAGATAATTTAAATGAATCAGAATCTGAAATTACAAATA
ATGACATTCACAATAAAAAATGCTGTTCATTTTCTCACAACGATTCACTC
AATGAATTAGAAGACCACATGGCTGGAATGGAAATCATTGGATTAGCTTG
CAATGTAGATGAATACAGTAGTGTTGTTTGCTCTGCTAAAGATAAAAAAG
CAAGATTAAGACGAGGTGCGGTTAGTGGAGAGGTTTACACGGAAGATGAT
GCTGCATCATATGTTAAAAAGGTAGTTCCCAAAGATTACAAAACTATGTC
GGCTTTGTCAAAGGCTATTGAGAAAAATGTTTTATTTTCACACTTGGATG
AAAAAGAAAGAAGTGATATCTTTGATGCAATGTTTCCACTTCACAAGAAA
GCCAATGAAATTTTGATTCAACAAGGGGATGATGGGGACAACTTCTATAT
AATCGACCAAGGGGAAGTAGAAATATATGTGAATGATGAATTAAACTGCA
CTGTCAGTGAAGGTGGTAGCTTTGGTGAGCTGGCTCTGATCTACGGAACT
CCTCGAGCTGCCACTGTCAGGGCAGCTACTGATGTCAAACTGTGGGGAAT
TGACAGAGATTCATATCGAAGAATTTTAATGGGTAGTACAATCAAGAAAA
GAAAACTTTACCAGGAGTTTTTGTCTCGTGTTCCAATTTTGGAGGAACTC
GACAAATGGGAACAATTGACTGTCGCTGATGCTTTGGAGTCGATTAATTT
TGATGATGGGGAATATGTGGTGAAACAAGGCGAGGTCGGGGAAGATTTCT
ACATGATAATTGAGGGCGTAGCAAAAGTCTTTCAAAAACCATCAGATTCA
GAAAACGAAATCGAGGTCGGGGAATTATTGACATCAGATTATTTCGGAGA
GATTGCCCTGTTATTAAATCGACCTCGTGCTGCCACTGTGCAGGCATGTG
GACCCCTCAAATGCGTGAAACTTGACCGAAAACGATTCGAACGAGTCATG
GGAAGTTGTGCTGAAATTCTGAAGCGAAACATCAAAAAATACAACAGCTA
CATTTCTATAACTGTCTGAAGTTTTTATACCAATTTCATTGGAGTAATTA
ATTCCTATTTATGTGTGCGTGCAAATTAAATTTGTATTCGTGTGCGAAAT
CTATATAGATTATAAATTGCACACCGGCGATTTCTTTGGCCATTTGTTGA
ATTTTAGTGTGTCTATTTAAATTAATAACAAGATTTTTGTTTTTATTGTC
TTTTTGATTGATATTTTTCCTGCTCATGTTTGATTCAGCCAATGTAAAAA
CCGAAATTTTGTGCATAAATATACTTAATGGTCTATTAAAA
back to top

protein sequence of SMED30007839-orf-1

>SMED30007839-orf-1 ID=SMED30007839-orf-1|Name=SMED30007839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MNASYLEELEEYIKVHNIHQLLKDCVVKLCLSKPNSPVSFIREYFQNLEK
QNLKDNLNESESEITNNDIHNKKCCSFSHNDSLNELEDHMAGMEIIGLAC
NVDEYSSVVCSAKDKKARLRRGAVSGEVYTEDDAASYVKKVVPKDYKTMS
ALSKAIEKNVLFSHLDEKERSDIFDAMFPLHKKANEILIQQGDDGDNFYI
IDQGEVEIYVNDELNCTVSEGGSFGELALIYGTPRAATVRAATDVKLWGI
DRDSYRRILMGSTIKKRKLYQEFLSRVPILEELDKWEQLTVADALESINF
DDGEYVVKQGEVGEDFYMIIEGVAKVFQKPSDSENEIEVGELLTSDYFGE
IALLLNRPRAATVQACGPLKCVKLDRKRFERVMGSCAEILKRNIKKYNSY
ISITV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001772immunological synapse
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005930axoneme
GO:0016020membrane
GO:0031588nucleotide-activated protein kinase complex
GO:0032991macromolecular complex
GO:0044853plasma membrane raft
GO:0005952cAMP-dependent protein kinase complex
Vocabulary: molecular function
TermDefinition
GO:0004862cAMP-dependent protein kinase inhibitor activity
GO:0019904protein domain specific binding
GO:0031625ubiquitin protein ligase binding
GO:0034236protein kinase A catalytic subunit binding
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0000166nucleotide binding
GO:0030552cAMP binding
Vocabulary: biological process
TermDefinition
GO:0046007negative regulation of activated T cell proliferation
GO:2000480negative regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0007015actin filament organization
GO:0007274neuromuscular synaptic transmission
GO:0007419ventral cord development
GO:0007591molting cycle, chitin-based cuticle
GO:0008103oocyte microtubule cytoskeleton polarization
GO:0008355olfactory learning
GO:0019933cAMP-mediated signaling
GO:0045471response to ethanol
GO:0045859regulation of protein kinase activity
GO:2000253positive regulation of feeding behavior
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
IPR012198cAMP_dep_PK_reg_su
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 358..369
score: 60.56
coord: 182..196
score: 52.0
coord: 197..211
score: 56.89
coord: 379..391
score: 54.36
coord: 346..355
score: 76.67
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 5..54
e-value: 1.2E-20
score: 74.9
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 11..75
coord: 112..405
NoneNo IPR availablePANTHERPTHR11635:SF126CAMP-DEPENDENT PROTEIN KINASE TYPE I-BETA REGULATORY SUBUNITcoord: 112..405
NoneNo IPR availablePANTHERPTHR11635:SF126CAMP-DEPENDENT PROTEIN KINASE TYPE I-BETA REGULATORY SUBUNITcoord: 11..75
NoneNo IPR availableCDDcd12097DD_RI_PKAcoord: 10..52
e-value: 3.45821E-19
score: 78.4659
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 6..52
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 161..277
e-value: 8.9E-28
score: 108.3
coord: 279..398
e-value: 3.0E-28
score: 109.9
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 299..384
e-value: 8.9E-18
score: 64.2
coord: 182..260
e-value: 1.6E-19
score: 69.8
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 161..276
score: 42.302
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 279..400
score: 38.422
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 161..270
e-value: 2.7022E-32
score: 116.271
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 279..394
e-value: 1.27726E-29
score: 108.953
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainSMARTSM00394akam_3coord: 16..53
e-value: 2.8E-5
score: 33.5
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainPFAMPF02197RIIacoord: 16..52
e-value: 1.6E-7
score: 30.9
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 128..261
e-value: 1.5E-50
score: 172.2
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 262..402
e-value: 1.1E-51
score: 176.1
IPR012198cAMP-dependent protein kinase regulatory subunitPIRSFPIRSF000548PK_regulatorycoord: 10..404
e-value: 6.6E-118
score: 392.2
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 188..204
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 306..322
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 348..365
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 224..241
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 264..390
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 142..262