SMED30007838
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30007838 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Alignments
SMED30007838 aligns in the following genomic locations:
Homology
BLAST of SMED30007838 vs. Ensembl Xenopus
Match: ENSXETT00000024080.1 (ribosomal biogenesis protein LAS1L-like [Source:NCBI gene;Acc:100495727]) HSP 1 Score: 48.9062 bits (115), Expect = 3.081e-7 Identity = 15/78 (19.23%), Postives = 46/78 (58.97%), Query Frame = 3 Query: 213 AYAISKFITLTFQNMVKKNPDFCSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAFEDIIHWIKKNFWNKYL 446 A+ +F+ L + ++ + P++ + +E+G+P ++++LR+++ HG P + ++ ++ W+++ +W++ L Sbjct: 81 GLALVRFVNL----ITERKQKTVAIPLRRLANEVGIPEWVVNLRHDLTHGKLPKLSMCRKGWDCVMEWLRREYWSRQL 154
BLAST of SMED30007838 vs. TrEMBL
Match: A0A2H1BST5 (Ribosomal L38e protein OS=Fasciola hepatica OX=6192 GN=D915_15188 PE=3 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 7.109e-8 Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3 Query: 165 TLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAFEDIIHWIKK---NFW 434 T +L+ AYL+NS S+A A+ +F++L ++ + + P+ + + G+P +++ LRN++ HGS P+ LL F HW K FW Sbjct: 57 TYHLLVAYLENSDQSLALALMRFVSLLSSEDQDRDRPYLAAPLLSLARQAGLPSWLVDLRNDVAHGSLPSPALLASGF----HWASKCLTEFW 145
BLAST of SMED30007838 vs. TrEMBL
Match: A0A4E0QVB1 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_010757 PE=3 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 7.172e-8 Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3 Query: 165 TLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAFEDIIHWIKK---NFW 434 T +L+ AYL+NS S+A A+ +F++L ++ + + P+ + + G+P +++ LRN++ HGS P+ LL F HW K FW Sbjct: 57 TYHLLVAYLENSDQSLALALMRFVSLLSSEDQDRDRPYLAAPLLSLARQAGLPSWLVDLRNDVAHGSLPSPALLASGF----HWASKCLTEFW 145
BLAST of SMED30007838 vs. TrEMBL
Match: A0A2B4SFC2 (Ribosomal biogenesis protein LAS1L OS=Stylophora pistillata OX=50429 GN=LAS1L PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 3.868e-7 Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 3 Query: 156 VNQTLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDF-CSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAFEDIIHWIKKNFWNKYL 446 V T NLISA+LD R ++A AI +F+ MV ++ ++ +Q + EIG+P +++ +R+E H + P+ + L + W++ +W L Sbjct: 54 VESTANLISAHLDQGRLTLAMAIVRFVN----GMVDQDQKGKFARSVQTIGEEIGLPKWLVDIRHESAHQNLPSLETLRCGVRASLSWLQSEYWEAQL 147
BLAST of SMED30007838 vs. TrEMBL
Match: A0A1W2WAK5 (uncharacterized protein LOC100183975 OS=Ciona intestinalis OX=7719 GN=LOC100183975 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 8.511e-7 Identity = 27/79 (34.18%), Postives = 47/79 (59.49%), Query Frame = 3 Query: 201 RYSMAYAISKFITLTFQNMVKKNPDFCSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAFEDIIHWIKKNFWN 437 R M+ A+++F+ L + +K N KP+ V ++G+P ++I+LR+E+ HG PA +L A I W+K+N W+ Sbjct: 73 RQMMSAAVTQFVGLLTEKGLKGN---VRKPIHHVGVDLGIPEWLINLRHEMAHGPLPALPMLHKAVTFAIDWLKENHWD 148
BLAST of SMED30007838 vs. TrEMBL
Match: A0A5J4N7V4 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002373 PE=4 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 4.744e-6 Identity = 23/76 (30.26%), Postives = 44/76 (57.89%), Query Frame = 3 Query: 171 NLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQDVLSEIGVPLYIISLRNEIVHGSCPAAQLLDLAF 398 NL+ AY ++S S+A A+ +F++L + + + ++ + + +G P ++ +RN+I HGS P A LL+ F Sbjct: 59 NLLVAYFEHSHQSLALALMRFVSLVSSDEQDREKPYSARSLLALTRRVGFPCWLADMRNDIAHGSIPCACLLERGF 134
BLAST of SMED30007838 vs. Planmine SMEST
Match: SMESG000017434.1 (SMESG000017434.1) HSP 1 Score: 169.474 bits (428), Expect = 1.151e-55 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 3 Query: 48 MEAISYNLSNFIINNELVNHIKEVNNSNIDNDSKFYVNQTLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQD 299 MEAISYNLSNFIINNELVNHIKEVNNSNIDNDSKFYVNQTLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQD Sbjct: 1 MEAISYNLSNFIINNELVNHIKEVNNSNIDNDSKFYVNQTLNLISAYLDNSRYSMAYAISKFITLTFQNMVKKNPDFCSKPMQD 84 The following BLAST results are available for this feature:
BLAST of SMED30007838 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of SMED30007838 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30007838 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30007838 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30007838 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30007838 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30007838 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30007838 ID=SMED30007838|Name=SMED30007838|organism=Schmidtea mediterranea sexual|type=transcript|length=458bpback to top protein sequence of SMED30007838-orf-1 >SMED30007838-orf-1 ID=SMED30007838-orf-1|Name=SMED30007838-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp MEAISYNLSNFIINNELVNHIKEVNNSNIDNDSKFYVNQTLNLISAYLDNback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|