WASH complex subunit 4

Overview
NameWASH complex subunit 4
Smed IDSMED30007824
Length (bp)4314
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WASH complex subunit 4 (SMED30007824) t-SNE clustered cells

Violin plots show distribution of expression levels for WASH complex subunit 4 (SMED30007824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WASH complex subunit 4 (SMED30007824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WASH complex subunit 4 (SMED30007824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007824SMESG000003631.1 dd_Smed_v4_4183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007824SMESG000003631.1 dd_Smed_v4_4183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WASH complex subunit 4 vs. Ensembl Human
Match: WASHC4 (WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:29174])

HSP 1 Score: 836.639 bits (2160), Expect = 0.000e+0
Identity = 450/1178 (38.20%), Postives = 698/1178 (59.25%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLA---SILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKIL--IIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + + Q+A LY        + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + ++K+ P E  L+ LEG+L+ G IF  C  Q FD   G V+  KNS+ A  F  +I++ F  + +K+   +  E ++R+++VG CGL+ L+  IF   DKK  K +L+   K+PA++L  N +W+P  FL   IP  +K +D K  +  K    T+LQ++   +  K++   Y  +  W + M++ L K+  + K    L    ++ I+G   A     + +T + L+  + + +T+T+   +CR +E  K IE +  ++++ ++D +  I   L  + L  I +   +VI     +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L+  +++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   L ++ +A+RD V  ++   HLE+  + L+ Y+K+IMEI+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L  F +  PIRFF+R I I+ YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FLK KF+ FS+F+YDE IK +LIK++  F+E     D  + +  AE+    IRK+ V  +G + LD+FR  I+++GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  +   +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    6 LSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVEAKLGEPS--EIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQK-AQSLTKDVQSYYVFVSSWMMKMESILSKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKKRVI----SDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQCDCCFLYWHR-AVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESYEILLDCYDKEIMEILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGVTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDI--VNFEELVKEEGLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTA 1140          
BLAST of WASH complex subunit 4 vs. Ensembl Human
Match: WASHC4 (WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:29174])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 450/1179 (38.17%), Postives = 698/1179 (59.20%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLA---SILIE-GLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKIL--IIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + + Q+A LY        + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + ++K+ P E  L+ LEG+L+ G IF  C  Q FD   G V+  KNS+ A  F  +I++ F  + +K+   +  E ++R+++VG CGL+ L+  IF   DKK  K +L+   K+PA++L  N +W+P  FL   IP  +K +D K  +  K    T+LQ++   +  K++   Y  +  W + M++ L K+  + K    L    ++ I+ G   A     + +T + L+  + + +T+T+   +CR +E  K IE +  ++++ ++D +  I   L  + L  I +   +VI     +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L+  +++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   L ++ +A+RD V  ++   HLE+  + L+ Y+K+IMEI+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L  F +  PIRFF+R I I+ YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FLK KF+ FS+F+YDE IK +LIK++  F+E     D  + +  AE+    IRK+ V  +G + LD+FR  I+++GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  +   +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    6 LSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVEAKLGEPS--EIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQK-AQSLTKDVQSYYVFVSSWMMKMESILSKEQRMDKFAEDLTNRCNVFIQVGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKKRVI----SDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQCDCCFLYWHR-AVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESYEILLDCYDKEIMEILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGVTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDI--VNFEELVKEEGLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTA 1141          
BLAST of WASH complex subunit 4 vs. Ensembl Human
Match: WASHC4 (WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:29174])

HSP 1 Score: 123.25 bits (308), Expect = 2.781e-31
Identity = 63/182 (34.62%), Postives = 96/182 (52.75%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFE 602
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + + Q+A LY        + +   +HF+
Sbjct:    6 LSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQ 187          
BLAST of WASH complex subunit 4 vs. Ensembl Human
Match: WASHC4 (WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:29174])

HSP 1 Score: 120.168 bits (300), Expect = 3.981e-31
Identity = 56/118 (47.46%), Postives = 84/118 (71.19%), Query Frame = 3
Query: 2913 MAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRK 3263
            M +VR +RSG LHC S +  F PD +D+  +NFEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+K
Sbjct:    1 MGYVRMIRSGGLHCSSNAIRFVPDLEDI--VNFEELVKEEGLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKK 116          
BLAST of WASH complex subunit 4 vs. Ensembl Human
Match: WASHC4 (WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:29174])

HSP 1 Score: 53.1434 bits (126), Expect = 2.048e-8
Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query: 2913 MAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSA 3059
            M +VR +RSG LHC S +  F PD +D+  +NFEELV++ GL+ ET  +A
Sbjct:    1 MGYVRMIRSGGLHCSSNAIRFVPDLEDI--VNFEELVKEEGLAEETLKAA 48          
BLAST of WASH complex subunit 4 vs. Ensembl Celegans
Match: Y53F4B.21 (pep chromosome:WBcel235:II:15090172:15109042:1 gene:WBGene00013167.1 transcript:Y53F4B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53F4B.21)

HSP 1 Score: 143.665 bits (361), Expect = 3.369e-34
Identity = 111/416 (26.68%), Postives = 208/416 (50.00%), Query Frame = 3
Query: 2307 IRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTD--KSFSY---VNAEQLRTAIRKMFVYSDGSNP------------------------LDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD----DDVMDINFEELV----RDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMF-VDVFAMEFRSK---KNVHCHNFF-VLLPALTLSFVDHIMECRDKFNRK-----NRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQ 3413
            + I + +   LE  +Y+L  +  ++ + Y  M+++A+ +Y + L  P+  LP   +++   ++++++   +F ++Y Y     +FIEK SD+K L+ + +     ++R HG GI+ T IN AY F+++K   F  FL +E ++ +++K LHE +   ++ D  K   Y     A  L+   R   V + G++                          D+FR  IT++GNA++ VR +   A   G    + FP      D ++ N   L+     D  ++S   H+A  +  ++K +     + ++Y KM  V+  ++  RSK     V   ++F  ++PALTLS ++++M   ++  +      N+D+ + +DDGFA GVAF+L + D +  F  L WF S   Y   K++E++
Sbjct:  694 VPIAESLRSWLEEHWYSLEILAPNNAKVYTRMQQIAKRKYGLVLLDPD--LPQSDIDETVAIMDLLQNFTHFVTNYCYFSQGYLFIEKASDSKKLHVIRLEDFKTALRKHGVGILPTAINAAYQFIRNKIQTFLSFLSEETVRCQVLKYLHEMEANKSSPDGKKKSQYKASWAANVLKNLARHQMVGAQGAHVGGGSTNGGSATASAAAANEMLYTYFDKFRLIITQIGNAISLVRMLCQAARENGLTRQDLFPQVKKYMDDLESNTRSLIFTNRPDCPINSTKMHAAYRL-GLVKEMFERVAEHRNYTKMMCVEFKSLLMRSKLPEDRVQVLDYFHGIIPALTLSHINYMMAHENRVKKTYALKHNKDL-VVTDDGFAAGVAFLLHIFDGWDSFFKLNWFDS---YAITKEHEIR 1102          
BLAST of WASH complex subunit 4 vs. Ensembl Fly
Match: SWIP (gene:FBgn0030739 transcript:FBtr0336975)

HSP 1 Score: 298.13 bits (762), Expect = 2.757e-83
Identity = 282/1115 (25.29%), Postives = 518/1115 (46.46%), Query Frame = 3
Query:  297 ILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGI-------MCFINRIYDVVKHAIQQMAGLYSK-ANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFG-NADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQ------ERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNV------RYACDCMFFYWAKD-SVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKE-RSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDD--DVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL------QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFR 3548
            + NK + TLA +C +  NLS++A+ +F   L+F    F  ++D+ L            L+G        M F  ++Y ++   I  +  L+ + A   S   D+  +H   ++ +++ LL H++ F+EL   +      W  YKK L +  +       A  ++  L + LM++E  + +   F    + N  +   Q      S +    N  I+ +   L    + +  L+  E  + +     + + V   G   + KL+K++++ + +   V L  +  W P  FL      L K     Q  QG     T L+      +RT      +LS        W I M         +  + +    +++ G   A++  ++   ++  H  L   +TR    ++ R L++ KVI+       +    F+  +I    +K++ ++   K   K  +   L +R+++ ++++ + +  + G  ++QR T + LA+       +L  +    ++  L + + ++D   N+        +   ++ +W  D SV   Y E               L     S++ L++ SH  +K +A+    +   +   + ++  +S  +E  LRV+  SH+ +++ +  PF  S                             ++    INA  +     +  IKD++E++    FYNLT I   DW++Y +MR LA     + L   + HLP+Q ++QG DVL IMR +  F+S Y YN+N QVF+E  S +K L+ +  RHVANSV+THG GIINTT+N  Y FL+ KF+ FS FL+DE+IK +L+KEL    E + + + +S+ Y  A+     IR++   S+G   +D FR  IT++GNA+ +VR      L  GS +ANF         D NF      + +   T+ S +  +  + ++   +    +YFK+ +  F     +  N H   F+++ PAL ++++D+ ++ + K  +K++      +DGFAIG+ +IL +L+   EF  LGW Q+I ++  A+++++      Q+  A  + DE L QT  ++ R +   + E+ LL   ++S+ IFF+
Sbjct:   68 VANKPLTTLANLCNQCRNLSRKAK-RF--QLAFLFSDF--RLDDTLPPHTHTSEGSAGLEGSLVRMSSSMDFFCQVYFLLNRMIVILQNLWRQIAASVSVPMDINEVHIFAVFDAMSELLEHIVVFNELANQS-KISTMWALYKKWLMNLSNSQS----ANLELNGLSTSLMDIENLITKD--FFRILLDNLMELKKQFGLNSVSPITQHSNAYIRRQL--LDVDANPSNELKNYEDPKHIIRLTTFVVVVHELGIQMEGKLVKNVIDLVARHKQVPLNRSVFWSPSGFLSLHAKTLMKSSARSQDGQGPKVHSTVLEKFRLSDQRTCRQLGVQLS-------LWSIQMQRVF--DVGVFGHLKTFLQLILNGHSYADQVNLLAVALINRHVALMTPMTRNDWIVVSRLLQYLKVIQKTFESNQINFVRFISSLIQWQKQKVIHLLHTTK---KKIVVLKLLQRKINFLATIKLAEKSIMGFPSKQRLTFVNLALGEFLDNRLLPADNQKLIKSILHRVNSISDIMRNIGGQLNTSESSSLVYNHWFLDTSVLKEYTE---------------LQRNPYSLQNLVSVSHHLDKIMAMFRGSRCPKQSANDLIIEFLSNHLEFFLRVEALSHLFQSQDQ--PFQQSA----------------------------LDYRLCINAVAVENDGDYNIIKDHLENYFTATFYNLTTIAPHDWKSYEKMRHLANKV--LQLQPIDDHLPNQIIDQGIDVLQIMRNIHTFASSYAYNMNLQVFVETNSRSKHLDIIGTRHVANSVQTHGTGIINTTVNFIYQFLRQKFYTFSTFLHDEQIKSRLLKELRFHTEHKHSKSYQSYPYERADSFLKKIRRLGCSSNGETYMDLFRKVITQVGNAVGYVR-----LLQAGSKNANFRNRSYKTRFDSNFS--CGGSKVHEATEGSIREYEKSLGHMKECYSDSTNYFKLLLQGFQPFLCNPHNHHLRTFYLITPALIMNYIDYRVKQKLKIYKKDQTKISLFEDGFAIGLVYILNMLNQQTEFHELGWSQTITQHLNAERSKVRDILAGQQRTAPEQLDEKLHQTVAITERHVNAYEHEYNLLYATLSSSEIFFQ 1102          
BLAST of WASH complex subunit 4 vs. Ensembl Zebrafish
Match: washc4 (WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-100427-4])

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 452/1188 (38.05%), Postives = 718/1188 (60.44%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDK 3599
            +  DW+FDRF DGS K   E  +K YE+FL E+   L    +A++       D+  DP  L    YE ++ L L+ +DNK+LNK++   A +C E+  L  EA  KF   L +YGEG +     + +  ++MGRF+  LQ + CF++R ++VV + + Q+A LY+ +   + + +   +HF+ +Y  +  LL  LIT DE+       ++ W+ YK++L S  H+P  +A+ ++K+ P E L+  LEG+L+   IF  C  Q FD+    V+  KNS+ A  F   I+  F  + SK+   +  E ++R+++ G CGL+ L+  IF   DKK+ K +L+   K+PAV+L  N +W+P  FL N +P  +K +D K  +  ++    +LQ++      K++   Y  +  W + M++ L K+ +  K    L++   I ++G+  A     + +T + ++  + + +T+T+   +CR +E  K +E    ++++ ++D +  I   L  + L+ I   K  + +  +K  S ++LD++S+L + +  LNG +T++RR ++ LA+S+       K+EE   L+  L++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   + ++ +A+RD V  +L   H+E+ +  LE Y+ +IMEI+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF + KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E    TD+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D+  +NFEELV++ GLS ETQ ++  +D V+ +L+    +  +YFKM V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQ++ E Y  + N +  ++++ +T  DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE   + K+DK
Sbjct:    6 LSPDWEFDRFDDGSQKIHTEVQVKNYERFLEEYIAQLQGIEEALDDSIGDVWDFTLDPITLKLLPYEQSSLLELIKTDNKVLNKVITVYAALCCEVKKLKHEAETKFYNGLLYYGEGVSDTSVVEGESQIQMGRFVSFLQELSCFVSRCFEVVVNMVHQLAALYNSSKGATKIIESTGVHFQTVYEHLGELLVVLITLDEIMENHATLKEHWKMYKRLLKSVHHNPAKFAIPEEKLKPFEKLIFKLEGQLLDSMIFQACVEQRFDNPGENVSVSKNSAFAEEFAYNIRTIFANVESKLGEPS--EIDQRDKYTGVCGLFVLHFHIFRAVDKKIYKSLLDVCKKVPAVTLAANIIWFPDTFLINKVPAAAKLMDKKSLQSIRSSRDVFLQQK-AQTLMKDMQSYYIFVTSWMMKMESILSKEPKPDKLSEDLSNRCNIFVQGILYAYSISTIIKTTMNMYMSMQRPMTKTSVKALCRLVELLKAVEHTFHRRSLVVADSVSHITQQLQSQALVSISMAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTKERRLIMSLALSVGTQMKTFKDEELLPLQLVLKKLDLISELRERVKVQCDCSFLYWHR-TVFPIYLDDVYENAVDAARIHYMFSALRDCVPTMLHAKHMESCDQLLECYDTEIMEILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LAHFFSLKPIRFFNRFIDIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRFFRETKDQTDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDI--VNFEELVKEEGLSEETQKASSQLDCVLSDLTSNSAEGTEYFKMLVGVFAPEFRSIKNMHLRNFYMIVPPLTVNFVEHSISCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQAVREKYVKEMNAVVKEQNVQSTSQDEKLMQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTAAEE--TQEKKDK 1150          
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Match: mmp24 (matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-GENE-1009940])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 444/1177 (37.72%), Postives = 692/1177 (58.79%), Query Frame = 3
Query:   54 IMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFT-GSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            ++D  W    F  G ++      +K Y +FL E++  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + + Q+AGLY+   ++  + +   +HF  +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + +DK+ P E LL+ LE +L+ G +F  C  Q FD   G V+  KN + A  F   I+  F  +  K+   +  E ++RE +VG CGL+ LY  IF   DKK  K +L    K+PA++L  N +WY   FL   +P  +K ID K  +  KT+  +YLQ +   + +K++   Y  +  W + M++ L K+ + +K    L +   + ++G   A     + +T + L+  + + +T+T+   + R +E  K IE    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L   +++ DL+++  + VR  C+C F YW + +VFP YL+++ + A +   L ++ +A+   V  ++   HLE+  + LE+Y+K+IM ++   LL  + K IE DLR+ +++H+     E NPF  G  D                             L HF + KPIRFF R I IK +V H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T P  HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI++TT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E     D+ + +  AE+    IRK+ +  DG + LD+FR  I+ +GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM VDVF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++  +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    5 LLDPPWSLSVFL-GKFQ------LKNYGKFLEEYTSQLRRIENALDDSIGDVWDFSLDPIALKLVPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGAAESSIVEGDSQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAGLYTSNRNEPKIIETTGVHFLTMYEHLGELLTVLLTMDEIIENHATLKDHWTMYKRLLKSVHHNPGKFGIQEDKLKPFEKLLLKLESQLLDGMLFQGCVEQQFDSLNGGVSVSKNGTFAEEFAHNIRTIFSNVEVKLGKPS--EIDQRERYVGLCGLFVLYFQIFRTVDKKFYKSLLEACKKVPAITLTANIIWYADHFLIQKVPAAAKLIDKKSLQAIKTQRDSYLQTK-AQSLSKDVQSYYVFVSAWMMKMESILSKEQKAEKFAEDLTNRCNVFVQGFLYACGLSNIIKTTMNLYMSMQKPMTKTSVKALLRLVELLKAIEHTFHRRSMVVADSVSHITQHLQHQALAAIAVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRQRRLIVSLALSVGTQMKTFKDEELLPLLLVMKKLDLISELRERVRSQCNCCFLYWHR-AVFPIYLDDVYENAVDASRLHYMFSALWSCVPDMMQARHLESYEVLLESYDKEIMAVMTEHLLDILCKEIEKDLRLSVHTHLQ--LDERNPFKIGMKD-----------------------------LAHFFSVKPIRFFHRFIDIKAFVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLTMTEP--HLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMSTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRYFREVKDQNDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISHIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQKAARQLDSVLSDLTRNSAEGTEYFKMLVDVFSPEFRSAKNIHLRNFYIIVPPLTLNFVEHSINCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYVKEKRAVSKQQNVQSNNQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA 1133          
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Match: mmp24 (matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-GENE-1009940])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 439/1182 (37.14%), Postives = 684/1182 (57.87%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTL------QGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFT-GSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  E  +   P   ++              PV               Q + CF+ R Y+VV + + Q+AGLY+   ++  + +   +HF  +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + +DK+ P E LL+ LE +L+ G +F  C  Q FD   G V+  KN + A  F   I+  F  +  K+   +  E ++RE +VG CGL+ LY  IF   DKK  K +L    K+PA++L  N +WY   FL   +P  +K ID K  +  KT+  +YLQ +   + +K++   Y  +  W + M++ L K+ + +K    L +   + ++G   A     + +T + L+  + + +T+T+   + R +E  K IE    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L   +++ DL+++  + VR  C+C F YW + +VFP YL+++ + A +   L ++ +A+   V  ++   HLE+  + LE+Y+K+IM ++   LL  + K IE DLR+ +++H+     E NPF  G  D                             L HF + KPIRFF R I IK +V H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T P  HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI++TT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E     D+ + +  AE+    IRK+ +  DG + LD+FR  I+ +GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM VDVF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++  +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    8 ISPDWEFDRIDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIENALDDSIGDVWDFSLDPIALKLVPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEVSSFSYPCYMYF--------------PVFCSSIFFFFCFTFLFQELSCFVTRCYEVVMNVVHQLAGLYTSNRNEPKIIETTGVHFLTMYEHLGELLTVLLTMDEIIENHATLKDHWTMYKRLLKSVHHNPGKFGIQEDKLKPFEKLLLKLESQLLDGMLFQGCVEQQFDSLNGGVSVSKNGTFAEEFAHNIRTIFSNVEVKLGKPS--EIDQRERYVGLCGLFVLYFQIFRTVDKKFYKSLLEACKKVPAITLTANIIWYADHFLIQKVPAAAKLIDKKSLQAIKTQRDSYLQTK-AQSLSKDVQSYYVFVSAWMMKMESILSKEQKAEKFAEDLTNRCNVFVQGFLYACGLSNIIKTTMNLYMSMQKPMTKTSVKALLRLVELLKAIEHTFHRRSMVVADSVSHITQHLQHQALAAIAVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRQRRLIVSLALSVGTQMKTFKDEELLPLLLVMKKLDLISELRERVRSQCNCCFLYWHR-AVFPIYLDDVYENAVDASRLHYMFSALWSCVPDMMQARHLESYEVLLESYDKEIMAVMTEHLLDILCKEIEKDLRLSVHTHLQ--LDERNPFKIGMKD-----------------------------LAHFFSVKPIRFFHRFIDIKAFVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLTMTEP--HLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMSTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRYFREVKDQNDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISHIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQKAARQLDSVLSDLTRNSAEGTEYFKMLVDVFSPEFRSAKNIHLRNFYIIVPPLTLNFVEHSINCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYVKEKRAVSKQQNVQSNNQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA 1134          
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Match: mmp24 (matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-GENE-1009940])

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 441/1182 (37.31%), Postives = 687/1182 (58.12%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTL------QGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFT-GSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  E  + F   L ++   F       +  PV               Q + CF+ R Y+VV + + Q+AGLY+   ++  + +   +HF  +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + +DK+ P E LL+ LE +L+ G +F  C  Q FD   G V+  KN + A  F   I+  F  +  K+   +  E ++RE +VG CGL+ LY  IF   DKK  K +L    K+PA++L  N +WY   FL   +P  +K ID K  +  KT+  +YLQ +   + +K++   Y  +  W + M++ L K+ + +K    L +   + ++G   A     + +T + L+  + + +T+T+   + R +E  K IE    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L   +++ DL+++  + VR  C+C F YW + +VFP YL+++ + A +   L ++ +A+   V  ++   HLE+  + LE+Y+K+IM ++   LL  + K IE DLR+ +++H+     E NPF  G  D                             L HF + KPIRFF R I IK +V H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T P  HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI++TT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E     D+ + +  AE+    IRK+ +  DG + LD+FR  I+ +GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM VDVF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++  +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    8 ISPDWEFDRIDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIENALDDSIGDVWDFSLDPIALKLVPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEV-SSFSYVLLYFHVTFLKPC--YMYFPVFCSSIFFFFCFTFLFQELSCFVTRCYEVVMNVVHQLAGLYTSNRNEPKIIETTGVHFLTMYEHLGELLTVLLTMDEIIENHATLKDHWTMYKRLLKSVHHNPGKFGIQEDKLKPFEKLLLKLESQLLDGMLFQGCVEQQFDSLNGGVSVSKNGTFAEEFAHNIRTIFSNVEVKLGKPS--EIDQRERYVGLCGLFVLYFQIFRTVDKKFYKSLLEACKKVPAITLTANIIWYADHFLIQKVPAAAKLIDKKSLQAIKTQRDSYLQTK-AQSLSKDVQSYYVFVSAWMMKMESILSKEQKAEKFAEDLTNRCNVFVQGFLYACGLSNIIKTTMNLYMSMQKPMTKTSVKALLRLVELLKAIEHTFHRRSMVVADSVSHITQHLQHQALAAIAVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRQRRLIVSLALSVGTQMKTFKDEELLPLLLVMKKLDLISELRERVRSQCNCCFLYWHR-AVFPIYLDDVYENAVDASRLHYMFSALWSCVPDMMQARHLESYEVLLESYDKEIMAVMTEHLLDILCKEIEKDLRLSVHTHLQ--LDERNPFKIGMKD-----------------------------LAHFFSVKPIRFFHRFIDIKAFVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLTMTEP--HLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMSTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRYFREVKDQNDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISHIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQKAARQLDSVLSDLTRNSAEGTEYFKMLVDVFSPEFRSAKNIHLRNFYIIVPPLTLNFVEHSINCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYVKEKRAVSKQQNVQSNNQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA 1145          
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Match: mmp24 (matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-GENE-1009940])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 426/1183 (36.01%), Postives = 659/1183 (55.71%), Query Frame = 3
Query:   54 IMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTL------QGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFT-GSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            ++D  W    F  G ++      +K Y +FL E++  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  E  +   P   ++              PV               Q + CF+ R Y+VV + + Q+AGLY+   ++  + +   +HF  +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + +DK+ P E LL+ LE +L+ G +F  C  Q FD   G V+  KN + A  F   I+  F  +  K+   +  E ++RE +VG CGL+ LY  IF   DKK  K +L    K+PA++L  N +WY   FL   +P  +K ID K  +  KT+  +YLQ +   + +K++   Y  +  W + M++ L K+ + +K    L +   + ++G   A     + +T + L+  + + +T+T+   + R +E  K IE    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE            LL     NV+        Y       P YL       DN     ++ +A+   V  ++   HLE+  + LE+Y+K+IM ++   LL  + K IE DLR+ +++H+     E NPF  G  D                             L HF + KPIRFF R I IK +V H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T P  HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI++TT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E     D+ + +  AE+    IRK+ +  DG + LD+FR  I+ +GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM VDVF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++  +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    5 LLDPPWSLSVFL-GKFQ------LKNYGKFLEEYTSQLRRIENALDDSIGDVWDFSLDPIALKLVPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEVSSFSYPCYMYF--------------PVFCSSIFFFFCFTFLFQELSCFVTRCYEVVMNVVHQLAGLYTSNRNEPKIIETTGVHFLTMYEHLGELLTVLLTMDEIIENHATLKDHWTMYKRLLKSVHHNPGKFGIQEDKLKPFEKLLLKLESQLLDGMLFQGCVEQQFDSLNGGVSVSKNGTFAEEFAHNIRTIFSNVEVKLGKPS--EIDQRERYVGLCGLFVLYFQIFRTVDKKFYKSLLEACKKVPAITLTANIIWYADHFLIQKVPAAAKLIDKKSLQAIKTQRDSYLQTK-AQSLSKDVQSYYVFVSAWMMKMESILSKEQKAEKFAEDLTNRCNVFVQGFLYACGLSNIIKTTMNLYMSMQKPMTKTSVKALLRLVELLKAIEHTFHRRSMVVADSVSHITQHLQHQALAAIAVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRQRRLIVSLALSVGTQMKTFKDEE------------LLPLLLTNVK------LLYRNT----PVYLH------DNCC---YMFSALWSCVPDMMQARHLESYEVLLESYDKEIMAVMTEHLLDILCKEIEKDLRLSVHTHLQ--LDERNPFKIGMKD-----------------------------LAHFFSVKPIRFFHRFIDIKAFVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLTMTEP--HLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMSTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRYFREVKDQNDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISHIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQKAARQLDSVLSDLTRNSAEGTEYFKMLVDVFSPEFRSAKNIHLRNFYIIVPPLTLNFVEHSINCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYVKEKRAVSKQQNVQSNNQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA 1095          
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Match: mmp24 (matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-GENE-1009940])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 363/922 (39.37%), Postives = 558/922 (60.52%), Query Frame = 3
Query:  819 IFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFT-GSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +F  C  Q FD   G V+  KN + A  F   I+  F  +  K+  A+  E ++RE +VG CGL+ LY  IF   DKK  K +L    K+PA++L  N +WY   FL   +P  +K ID K  +  KT+  +YLQ +   + +K++   Y  +  W + M++ L K+ + +K    L +   + ++G   A     + +T + L+  + + +T+T+   + R +E  K IE    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L   +++ DL+++  + VR  C+C F YW + +VFP YL+++ + A +   L ++ +A+   V  ++   HLE+  + LE+Y+K+IM ++   LL  + K IE DLR+ +++H+     E NPF  G  D                             L HF + KPIRFF R I IK +V H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T P  HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI++TT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E     D+ + +  AE+    IRK+ +  DG + LD+FR  I+ +GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM VDVF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++  +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    2 LFQGCVEQQFDSLNGGVSVSKNGTFAEEFAHNIRTIFSNVEVKLGEAS--EIDQRERYVGLCGLFVLYFQIFRTVDKKFYKSLLEACKKVPAITLTANIIWYADHFLIQKVPAAAKLIDKKSLQAIKTQRDSYLQTK-AQSLSKDVQSYYVFVSAWMMKMESILSKEQKAEKFAEDLTNRCNVFVQGFLYACGLSNIIKTTMNLYMSMQKPMTKTSVKALLRLVELLKAIEHTFHRRSMVVADSVSHITQHLQHQALAAIAVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRQRRLIVSLALSVGTQMKTFKDEELLPLLLVMKKLDLISELRERVRSQCNCCFLYWHR-AVFPIYLDDVYENAVDASRLHYMFSALWSCVPDMMQARHLESYEVLLESYDKEIMAVMTEHLLDILCKEIEKDLRLSVHTHLQ--LDERNPFKIGMKD-----------------------------LAHFFSVKPIRFFHRFIDIKAFVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLTMTEP--HLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMSTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRYFREVKDQNDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISHIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQKAARQLDSVLSDLTRNSAEGTEYFKMLVDVFSPEFRSAKNIHLRNFYIIVPPLTLNFVEHSINCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYVKEKRAVSKQQNVQSNNQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA 882          
BLAST of WASH complex subunit 4 vs. Ensembl Mouse
Match: Washc4 (WASH complex subunit 4 [Source:MGI Symbol;Acc:MGI:2441787])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 445/1178 (37.78%), Postives = 698/1178 (59.25%), Query Frame = 3
Query:   51 NIMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLA---SILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            + +  DW FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + I Q+A LY        + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + ++K+ P E  L+ LEG+L+ G IF  C  Q FD   G ++  KNS+ A  F  +I++ F  + +K+   +  E ++R+++VG CGL+ L+  IF   DKK  K +L+   K+PA++L  N +W+P  FL + +P  +K +D K  +  K    T+LQ++   +  K++   Y  +  W + M++ L K+  +      L    ++ I+G   A     + +T + L+  + + +T+T+   +CR +E  K IE +  ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L+  +++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   L ++ +A+RD V  ++ + HLE+  L L+ Y+K+IM+I+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L  F +  PIRFF+R I I+ YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FLK KF+ FS+F+YDE IK +LIK++  F+E     D  + +  AE+    IRK+ +  +G + LD+FR  I+++GNAM ++R +RSG LHC S +  F PD +D+  ++FEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ LK+LD Y+EFDSL WFQS+ E Y  +   +  Q+++ +T  DE L QT  L+ +RLE    EF+LL + ++SARIFFRAD TA
Sbjct:    4 DTLSPDWDFDRVDDGSQKIHAEVQLKNYGRFLEEYTSQLRRIEDALDDLIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDSSMVEGDCQIQMGRFVSFLQELSCFVTRCYEVVMNVIHQLAALYISNKIGPKIIETTGVHFQTMYEHLGELLTVLLTLDEIVDNHVTLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGISVSKNSTFAEEFAHSIRSIFANVEAKLGEPS--EIDQRDKYVGICGLFVLHFQIFRTVDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIHKMPAAAKLLDRKSLQAIKIHRDTFLQQK-AQSLNKDVQSYYVFVSSWMMKMESMLSKEQRMDTFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLIELLKAIEHMFYRRSMVVADSVSHITQHLQHQALSSISVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQAQCDCCFLYWHR-AVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHSRHLESHELLLDCYDKEIMDILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGRKD-----------------------------LALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGITPEGQSYLDQFRQLISQIGNAMGYIRMIRSGGLHCSSNAIRFVPDLEDI--VSFEELVKEEGLAEETLRAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKLGAAFTDDGFAMGVAYTLKLLDQYQEFDSLHWFQSVREKYIKEIRAVAKQQNVQSTSQDEKLLQTMNLTQKRLEVYLQEFELLYFSLSSARIFFRADKTA 1140          
BLAST of WASH complex subunit 4 vs. Ensembl Mouse
Match: Washc4 (WASH complex subunit 4 [Source:MGI Symbol;Acc:MGI:2441787])

HSP 1 Score: 124.79 bits (312), Expect = 5.289e-32
Identity = 65/184 (35.33%), Postives = 99/184 (53.80%), Query Frame = 3
Query:   51 NIMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFE 602
            + +  DW FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG +  ++   +I  +MGRF+  LQ + CF+ R Y+VV + I Q+A LY        + +   +HF+
Sbjct:    4 DTLSPDWDFDRVDDGSQKIHAEVQLKNYGRFLEEYTSQLRRIEDALDDLIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGDSSMVEGDCQI--QMGRFVSFLQELSCFVTRCYEVVMNVIHQLAALYISNKIGPKIIETTGVHFQ 185          
BLAST of WASH complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q2M389|WASC4_HUMAN (WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2)

HSP 1 Score: 836.639 bits (2160), Expect = 0.000e+0
Identity = 450/1178 (38.20%), Postives = 698/1178 (59.25%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLA---SILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKIL--IIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            +  DW+FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + + Q+A LY        + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + ++K+ P E  L+ LEG+L+ G IF  C  Q FD   G V+  KNS+ A  F  +I++ F  + +K+   +  E ++R+++VG CGL+ L+  IF   DKK  K +L+   K+PA++L  N +W+P  FL   IP  +K +D K  +  K    T+LQ++   +  K++   Y  +  W + M++ L K+  + K    L    ++ I+G   A     + +T + L+  + + +T+T+   +CR +E  K IE +  ++++ ++D +  I   L  + L  I +   +VI     +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L+  +++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   L ++ +A+RD V  ++   HLE+  + L+ Y+K+IMEI+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L  F +  PIRFF+R I I+ YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FLK KF+ FS+F+YDE IK +LIK++  F+E     D  + +  AE+    IRK+ V  +G + LD+FR  I+++GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  +   +  Q+++ +   DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA
Sbjct:    6 LSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVEAKLGEPS--EIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQK-AQSLTKDVQSYYVFVSSWMMKMESILSKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKKRVI----SDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQCDCCFLYWHR-AVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESYEILLDCYDKEIMEILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGVTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDI--VNFEELVKEEGLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTA 1140          
BLAST of WASH complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q3UMB9|WASC4_MOUSE (WASH complex subunit 4 OS=Mus musculus OX=10090 GN=Washc4 PE=1 SV=2)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 445/1178 (37.78%), Postives = 698/1178 (59.25%), Query Frame = 3
Query:   51 NIMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLA---SILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTA 3563
            + +  DW FDR  DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C E+  L  EA  KF   L FYGEG       +    ++MGRF+  LQ + CF+ R Y+VV + I Q+A LY        + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + + ++K+ P E  L+ LEG+L+ G IF  C  Q FD   G ++  KNS+ A  F  +I++ F  + +K+   +  E ++R+++VG CGL+ L+  IF   DKK  K +L+   K+PA++L  N +W+P  FL + +P  +K +D K  +  K    T+LQ++   +  K++   Y  +  W + M++ L K+  +      L    ++ I+G   A     + +T + L+  + + +T+T+   +CR +E  K IE +  ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T+QRR ++ LA+S+       K+EE   L+  +++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   L ++ +A+RD V  ++ + HLE+  L L+ Y+K+IM+I+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L  F +  PIRFF+R I I+ YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FLK KF+ FS+F+YDE IK +LIK++  F+E     D  + +  AE+    IRK+ +  +G + LD+FR  I+++GNAM ++R +RSG LHC S +  F PD +D+  ++FEELV++ GL+ ET  +A+ +D V+ + +R   +  +YFKM VDVFA EFR  KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ LK+LD Y+EFDSL WFQS+ E Y  +   +  Q+++ +T  DE L QT  L+ +RLE    EF+LL + ++SARIFFRAD TA
Sbjct:    4 DTLSPDWDFDRVDDGSQKIHAEVQLKNYGRFLEEYTSQLRRIEDALDDLIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDSSMVEGDCQIQMGRFVSFLQELSCFVTRCYEVVMNVIHQLAALYISNKIGPKIIETTGVHFQTMYEHLGELLTVLLTLDEIVDNHVTLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGISVSKNSTFAEEFAHSIRSIFANVEAKLGEPS--EIDQRDKYVGICGLFVLHFQIFRTVDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIHKMPAAAKLLDRKSLQAIKIHRDTFLQQK-AQSLNKDVQSYYVFVSSWMMKMESMLSKEQRMDTFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLIELLKAIEHMFYRRSMVVADSVSHITQHLQHQALSSISVAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQAQCDCCFLYWHR-AVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHSRHLESHELLLDCYDKEIMDILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGRKD-----------------------------LALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGITPEGQSYLDQFRQLISQIGNAMGYIRMIRSGGLHCSSNAIRFVPDLEDI--VSFEELVKEEGLAEETLRAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKLGAAFTDDGFAMGVAYTLKLLDQYQEFDSLHWFQSVREKYIKEIRAVAKQQNVQSTSQDEKLLQTMNLTQKRLEVYLQEFELLYFSLSSARIFFRADKTA 1140          
BLAST of WASH complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q54R74|WASC4_DICDI (WASH complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=washc4 PE=1 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 379/1185 (31.98%), Postives = 637/1185 (53.76%), Query Frame = 3
Query:   51 NIMDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGE--GFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALA--KDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVK-NSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGN-ADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSG----LYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKS-LSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLEN-KNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNR----DVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFR 3548
            N  + ++ FD F DGS K   E  + K  QF  +++Q +    +A++       D   DP  +  + +E    + LV +D+KI NK+++  ++IC +   L + A +KF   L+ +GE  G + + D    + +E+G+ LP +  +  F+NR Y ++++ I Q A +Y ++  + +     N+H + +Y S+  +   LI  D + T        W  Y +++ S K +P+ Y+++  +DK+  LE LL++L+G+L++G IF +C  Q FD     V +VK N  L   F   +K  +    +KI  ++  E N RE F G+ GLY  Y+ +F +  DK   K +     ++P VS+  N  W+P  F++  +P + K +       G T     ++     N  KE SG     Y ++  W + M+++  +   +          +I+G+ L+     + +T++ LH  L   +  +    + +  E  K IE+   +++  IS  + +++  L +   II E + V+      +S  S  +LD++ +LS+   +L G AT +R TV++L ++++   +ILKE +  +LR  +++ + ++D    V+ +CDC   +W++D +FP YL+ L +       LQ+ LT ++D V  L    H++N K   ++ Y  ++ E+++  ++ P+ K +E DLR+ +  H      E +PF TG  +                                F+  KP+RFFDR I IK  + H+L+  FYNL  + L DW+ Y+EMR +A  +Y + L   E+HLP  +LEQG DVL IMR +  F S Y YNLN Q+FI++ S++K LNT+NI H++NS+RTHG GI+NTTIN AY FL  KF  FSEFL+D++IK KL K +  F+E     +  +      +L   IR++ V   G   LD FR  IT +GNAM ++R VRSG LH  S +  F PD   +   F++L     LS ET  ++  +D +I NLS    +  +YFKM V+VFA EFR+  N H  NF++++PAL  +++DH++  +DK  +K++    +  +F+DDGFAIG+A+ILK+LD  K+FDSL WF  I       Q  +  + +    K D+N      L++++++  + E++L +Y  + +RIFF+
Sbjct:    9 NGQNEEYTFDAFEDGSSKLVGEQQLTKLNQFAVDYAQQIWKIEEALDETLNEVWDINIDPVSIYNKPHEQLDLIELVKTDHKIFNKVILVFSSICNQTRILKETAESKFYSPLTVFGEITGESSEGD----VQIEVGKLLPFMIDLSAFVNRCYSLIRNIISQFASIY-QSQKNIHTQFFKNVHLQAVYYSMIDIFSVLINLDSIITQNTALDSSWGRYLRMVKSVKQEPNKYSVSGEEDKLWQLEKLLLSLKGQLLEGFIFQSCIQQEFDFPG--VIDVKGNKVLKAEFQYNVKVLWSMFGTKIMDSS--ELNLRERFPGFMGLYAFYIALFKDITDKSFFKQVWEVTKRVPMVSINVNVFWFPADFIQQLMPGMIKIV-------GSTFNHMEIRRDYLRNVDKEFSGRVKSYYLQVSRWMVRMESSQTRGGTLWDVSLSKVGQIIQGVQLSYHISHLLKTMIGLHMHLTAPLKSSDVRKLFQCAEMLKSIENTFHRRSAMISAHISMMVQQLTD---IINEKLNVVRSKYAGRSNYSEIELDVIVALSLCSDLLCGVATNERITVVRLCLNVIYQSNILKENDIEELRLHIKRLEFISDIGKIVKASCDCSILFWSRD-LFPTYLQFLYQNPSQATSLQYTLTGLKDVVSVLDKAIHVDNAKQRLIDVYRNEMEEMIDKNIIQPLGKDVETDLRLHI--HAFLNIEEKDPFKTGIKEFG-----------------------------KFLELKPLRFFDRTIDIKSRISHYLDQTFYNLNTVALFDWKTYSEMRNMAFYKYGLQLL--EVHLPGSTLEQGLDVLEIMRNIHIFVSRYNYNLNNQIFIQRSSNSKTLNTINITHISNSIRTHGSGIMNTTINFAYRFLVQKFSIFSEFLFDDQIKSKLYKNIKYFRENKEQLNNMYPSELVTELERDIRQLGVSETGLTFLDHFRLLITHIGNAMGYIRLVRSGGLHYCSNAIKFVPDLKKIP-KFQDLTSKDALSPETIQASTNLDSIIHNLSNNLSEGTEYFKMLVNVFATEFRNIANQHLKNFYIIVPALASNYIDHMINSKDKLFKKSKAIGAEALLFTDDGFAIGLAYILKLLDQNKDFDSLHWFDRIQLKCETDQKRMLAEANAKGIKEDQN-----HLAIKKIQNFQQEYELFKYSFSGSRIFFK 1134          
BLAST of WASH complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q9VXH9|WASC4_DROME (WASH complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=SWIP PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 2.764e-82
Identity = 282/1115 (25.29%), Postives = 518/1115 (46.46%), Query Frame = 3
Query:  297 ILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGI-------MCFINRIYDVVKHAIQQMAGLYSK-ANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFG-NADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQ------ERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNV------RYACDCMFFYWAKD-SVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKE-RSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDD--DVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL------QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFR 3548
            + NK + TLA +C +  NLS++A+ +F   L+F    F  ++D+ L            L+G        M F  ++Y ++   I  +  L+ + A   S   D+  +H   ++ +++ LL H++ F+EL   +      W  YKK L +  +       A  ++  L + LM++E  + +   F    + N  +   Q      S +    N  I+ +   L    + +  L+  E  + +     + + V   G   + KL+K++++ + +   V L  +  W P  FL      L K     Q  QG     T L+      +RT      +LS        W I M         +  + +    +++ G   A++  ++   ++  H  L   +TR    ++ R L++ KVI+       +    F+  +I    +K++ ++   K   K  +   L +R+++ ++++ + +  + G  ++QR T + LA+       +L  +    ++  L + + ++D   N+        +   ++ +W  D SV   Y E               L     S++ L++ SH  +K +A+    +   +   + ++  +S  +E  LRV+  SH+ +++ +  PF  S                             ++    INA  +     +  IKD++E++    FYNLT I   DW++Y +MR LA     + L   + HLP+Q ++QG DVL IMR +  F+S Y YN+N QVF+E  S +K L+ +  RHVANSV+THG GIINTT+N  Y FL+ KF+ FS FL+DE+IK +L+KEL    E + + + +S+ Y  A+     IR++   S+G   +D FR  IT++GNA+ +VR      L  GS +ANF         D NF      + +   T+ S +  +  + ++   +    +YFK+ +  F     +  N H   F+++ PAL ++++D+ ++ + K  +K++      +DGFAIG+ +IL +L+   EF  LGW Q+I ++  A+++++      Q+  A  + DE L QT  ++ R +   + E+ LL   ++S+ IFF+
Sbjct:   68 VANKPLTTLANLCNQCRNLSRKAK-RF--QLAFLFSDF--RLDDTLPPHTHTSEGSAGLEGSLVRMSSSMDFFCQVYFLLNRMIVILQNLWRQIAASVSVPMDINEVHIFAVFDAMSELLEHIVVFNELANQS-KISTMWALYKKWLMNLSNSQS----ANLELNGLSTSLMDIENLITKD--FFRILLDNLMELKKQFGLNSVSPITQHSNAYIRRQL--LDVDANPSNELKNYEDPKHIIRLTTFVVVVHELGIQMEGKLVKNVIDLVARHKQVPLNRSVFWSPSGFLSLHAKTLMKSSARSQDGQGPKVHSTVLEKFRLSDQRTCRQLGVQLS-------LWSIQMQRVF--DVGVFGHLKTFLQLILNGHSYADQVNLLAVALINRHVALMTPMTRNDWIVVSRLLQYLKVIQKTFESNQINFVRFISSLIQWQKQKVIHLLHTTK---KKIVVLKLLQRKINFLATIKLAEKSIMGFPSKQRLTFVNLALGEFLDNRLLPADNQKLIKSILHRVNSISDIMRNIGGQLNTSESSSLVYNHWFLDTSVLKEYTE---------------LQRNPYSLQNLVSVSHHLDKIMAMFRGSRCPKQSANDLIIEFLSNHLEFFLRVEALSHLFQSQDQ--PFQQSA----------------------------LDYRLCINAVAVENDGDYNIIKDHLENYFTATFYNLTTIAPHDWKSYEKMRHLANKV--LQLQPIDDHLPNQIIDQGIDVLQIMRNIHTFASSYAYNMNLQVFVETNSRSKHLDIIGTRHVANSVQTHGTGIINTTVNFIYQFLRQKFYTFSTFLHDEQIKSRLLKELRFHTEHKHSKSYQSYPYERADSFLKKIRRLGCSSNGETYMDLFRKVITQVGNAVGYVR-----LLQAGSKNANFRNRSYKTRFDSNFS--CGGSKVHEATEGSIREYEKSLGHMKECYSDSTNYFKLLLQGFQPFLCNPHNHHLRTFYLITPALIMNYIDYRVKQKLKIYKKDQTKISLFEDGFAIGLVYILNMLNQQTEFHELGWSQTITQHLNAERSKVRDILAGQQRTAPEQLDEKLHQTVAITERHVNAYEHEYNLLYATLSSSEIFFQ 1102          
BLAST of WASH complex subunit 4 vs. TrEMBL
Match: A0A210QJ49 (WASH complex subunit 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11984 PE=4 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 475/1202 (39.52%), Postives = 716/1202 (59.57%), Query Frame = 3
Query:   66 DWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLA--TTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAK-------------LKQDKLNQLEQQ 3620
            DW+FD+F DGS K   E  +KKY QFL E++  L     A++     + D   DP  L    YE T  L L+ +DNKI NKI+  LA++C EM  L  EA+ KF  AL FYGEG       + +  ++MGR +P LQ + CF+NR Y+VV++ I Q A LYS +     L DV ++HF+ ++  +  +L  LIT DE+     + +D W  YK++L S  HDP  +++  DK+   E L+M LEG+L+ G IF NC  Q+FD     VT  KNS     FN  I+     L S+I  A   E ++R +FVG CGL+ L+  IF   D+K+ K + +   K+P V L GN VW+P  FL N +P ++K +D K     KT+ +T+LQ R     ++++   +  +  W + M++ + +   + ++      + I+GL  A     + +TV+ LH  L + +T+T    +CR  E  K IE    ++ + I++ +  II  L+  IL  I   K  I +  +K  S R+LD++S+L + +T +NG  T++RR + KL++++       +++E   L   L++ +++ D  + VR ACDC F YW +  +FP YL ++++ A +   + +++ A+RD V  + A  HL +    L+ + K+I   +E  LL P+ + IE DLR+ ++SH+     + NPF  G  D                             L + +   PIR FDR+I IK YVEH+L   FYNLT + L DW+ Y EM+ +A+ +Y + +   E HLPSQ+LEQG DVL IMR +  F S ++YNLN Q+F+E+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KFF FS+F+YDE IK +LIK+   FKE    TD+ + +  A++    IRK+ +  DG + LD+FR  I+++GNAM ++R +RSG LHC S +  F PD +D+  +NFEEL ++ GLS E Q +AK +D+V+ NL+R F +  +YFK+ VDVFA EFR  KN+H  NFFV+LP L L+FVDH + C++K +RKN+    F+DDGFA+GVA+ILK+LD Y EFDSL WFQS+ + Y A+++++ K     +T+ DE L+QT +L+++RL+  + E++LL Y ++SAR+FFRAD TA EE   K             ++Q + NQL+ Q
Sbjct:    7 DWEFDKFDDGSLKIVGELQLKKYGQFLEEYASQLKEIEGALDESIGDSWDMTLDPIALQLLPYEQTNLLQLIKTDNKIFNKIITVLASLCCEMQALQHEAQTKFYNALLFYGEGEPENGLGEGEAQLQMGRLMPLLQELSCFVNRCYEVVRNVIHQFACLYSLSQGGPKLIDVTDVHFKAVFEELGEVLGVLITLDEIVENHASLKDHWTLYKRMLKSVHHDPGKFSIPGDKLRQFEKLIMKLEGELLDGLIFQNCVEQSFDSRTVSVT--KNSVFLDEFNINIREYLMDLESRIGEAN--EMDQRYKFVGLCGLFILHFQIFRVIDRKVFKSLWDIYKKVPGVHLLGNIVWFPTSFLLNKLPQMAKVLDKKAQTMVKTQYQTWLQSRNQM-LSRDVQNFHTSVSAWMVEMESAMGRSKTLMEDLNNRCVLFIQGLLYAYNINHLIRTVMNLHVALQKPMTKTAVLCLCRLTELLKAIEHTFHRRTMLIAESVSHIIQHLSFLILSSIGTAKKRIMS--DKKYSERRLDVLSALVLAETAMNGPGTKERRLIAKLSLAVGTKMRTFRDDEIQILYSNLKKLEMICDLRERVRLACDCSFVYWHR-VIFPIYLTDIIENAVDTHRIHYMVGALRDCVPSMTAVRHLTSPQELLDIFNKEIYGNMEEHLLDPLCRVIETDLRLHIHSHL--QLDDRNPFKVGFKD-----------------------------LSNLLKVHPIRLFDRYISIKRYVEHYLNMTFYNLTTVALHDWKTYGEMKNMAEQKYGLAMV--ESHLPSQTLEQGLDVLEIMRNIHVFVSKFLYNLNNQIFVERSSNNKHLNTINIRHIANSIRTHGIGIMNTTVNFTYQFLRKKFFIFSQFMYDEHIKSRLIKDWKYFKEHHMQTDQKYPFEKADKFNKGIRKLGLLPDGDSYLDQFRVTISQIGNAMGYIRMIRSGGLHCCSNAIRFIPDLEDI--VNFEELCKEEGLSQECQVAAKNLDNVVGNLARNFAEGTEYFKLLVDVFAPEFRDPKNMHLRNFFVILPPLILNFVDHSISCKEKMSRKNKVGAAFTDDGFAMGVAYILKLLDQYHEFDSLHWFQSVRDRYRAEKDKVGKQTQSMSTRPDEKLQQTMSLTVKRLDGCQQEYELLYYSLSSARVFFRADQTAAEENEEKDKGKRKLGRQVRLMEQLQPNQLQHQ 1165          
BLAST of WASH complex subunit 4 vs. TrEMBL
Match: R7UQC0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221991 PE=4 SV=1)

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 459/1179 (38.93%), Postives = 705/1179 (59.80%), Query Frame = 3
Query:   66 DWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDK 3599
            +W FD+F DGS K   E  ++KY +FL +F+  L    +A+      + D   DP  L    YE T+ L L+ +DNKILNK++  LA +CTE+++L  EA NKF PAL FYGEG         +  ++MGR +P LQ + CF+ R YDVV+H + Q++ LYS       + DV N+HF+ +Y  +  +L  LIT DE+       ++ W  YK++L S KH+P  + +  +K+ P E LLM LEG+L+ G IF NC  Q FD   GQ+   KNS  A  F   I++    L  ++      E N R   VG   LY L+  ++   DKK+ K   +   K+P V L G+ +WYP +FL   +P+++K +D K  +        +LQ++   N   E    Y  +  W + M+++      +  +      + I+GL  A   + + +TV+ LH DL + +TRT+   +CR  E  K IE    ++++ +++ +  II  L+   L  ++  K  I    ++  + ++LD++S+L + +  L+G  T++RR +I+LA+++     + K+EE + L+  L + D++ D  + +R ACDC FFYW +  + P Y  +L +TA ++  + ++   +RD V+ +  T H EN  + LE++++++M+ +   LL P+ + IE DLR+ ++ H+     + NPF                                 +L  F+  +PIRFFDR+I IK +VEH+L+  FYNL  + L DW+ Y EMR LA  +Y + L   E+HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+F+E+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  + FL+ KFF FS+F+YDE IK +LIK+   FKE    TD+ + +  A++    IRK+ +  DGS  LD+FR  I ++GNAM ++R +RSG LHC S +  F PD +D+  I FEEL ++ GLS+E Q +A+ +D++I NLS+ F +  +YFKM VDVF+ EFR  KN+H  +FFV+LPALTL++V++++  ++K N+KN+   +F+DDG A+G+A+ILK+LD Y EFDSL WFQS+ E Y  ++N+L     + K DE L+QT TL+L+RL+  + EF LL Y ++SARIFFRAD TA EE   + +++K
Sbjct:    8 EWTFDKFDDGSLKIVGEVQLRKYGKFLEDFAGQLKEIDEALGESIGDSWDLTLDPISLQVLPYEQTSVLQLIKTDNKILNKVITVLAALCTELDSLKHEAENKFYPALLFYGEGEIEGESPDGRAQIQMGRMMPFLQELSCFVIRCYDVVRHVLHQLSALYSNGKSSPIVMDVSNVHFQSVYEHLGEILTVLITLDEIIDNQNMLKEHWTLYKRMLKSVKHNPQRFNIPDEKLRPFEKLLMTLEGQLLDGFIFQNCVEQIFDQ--GQMLVTKNSLFAEEFALNIRSYLSQLEPRLGETN--EVNHRHSLVGTIALYVLHFQLYRVIDKKIFKQFWDLYKKIPGVWLIGSIIWYPNEFLFQKLPHMAKALDKKALQTAGQARLNWLQQK---NLVSEAQSWYVSVTSWMVKMESSFSGTGALVDDLNHRCLLFIQGLLYAYNLQHLLKTVMNLHIDLRKPMTRTSVLALCRIAELLKAIEHTFHRRSMLVAESVNHIIQHLSFIALSTVQTAKKRIVA--DRKYNEKKLDVLSALFMAENCLHGPGTKERRLIIQLALAVAMQLKVFKDEELASLQGVLLKLDVICDIRERLREACDCSFFYWHQ-VILPIYFNDLFETAVDIHKIHYMFGVLRDCVQPMTRTKHHENPKILLESFDREVMKNLNEHLLSPLCRDIETDLRLHIHLHL--QLDDRNPFKTK----------------------------VKDLTSFLRMRPIRFFDRNINIKAHVEHYLDETFYNLNTVALHDWKTYGEMRALAHRKYGLDLM--EVHLPSQTLEQGLDVLEIMRNIHVFVSKYLYNLNNQIFVERSSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTFQFLRKKFFTFSQFMYDEHIKSRLIKDWRFFKENHLQTDQKYPFDRADKFNRGIRKLGLTPDGSTYLDQFRLLIGQIGNAMGYIRMIRSGGLHCCSNAIRFIPDLEDI--IAFEELCKEDGLSTECQKAARQLDEIISNLSKNFAEGTEYFKMLVDVFSPEFRDAKNMHLSHFFVILPALTLNYVEYMIASKEKLNKKNKIGAVFTDDGVAMGIAYILKLLDQYHEFDSLHWFQSVKEKYLKEKNQLVSQANSGKVDEKLKQTMTLTLKRLDMYQKEFDLLYYSLSSARIFFRADQTAAEEEKDRQEKEK 1142          
BLAST of WASH complex subunit 4 vs. TrEMBL
Match: A0A4W3HME9 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=washc4 PE=4 SV=1)

HSP 1 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 461/1182 (39.00%), Postives = 713/1182 (60.32%), Query Frame = 3
Query:   57 MDS---DWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEE 3572
            MDS   DW+FDRF DGS K   E  +K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C+E+  L  EA  KF   L FYGEG       + +  ++MGRF+  LQ   CF+ R Y+VV + +QQ+A LY+ + +   + +   +HF+ +Y  +  LL  L+T DE+       +D W  YK++L S  H+P  + +A++K+ P E LL  LEG+L+ G IF  C  Q FD     ++  KNS+ A  F   I+  F  + SK+   +  E ++R+++VG C L+ L+  IF   DKKL K +L+   K+PA++L  N +W+P  FL N +   +K ++ K  +  K + + +LQ++     +K++   Y  +  W + M++ L K+  + K    L++   I I+G+  AN    + +T + L+  + + +T+T+   +CR +E  K IE  V ++ + I+D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T++RR VI LA+S+       ++EE   L+  L++ DL+ +  + VR  CDC F YW + ++FP YL+++   A +   + ++ +A+RD V  +    HLE+  L LE ++K+IM+++   LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF + KPIRFF+R I  K YV H+L+  FYNLT + L DW  Y+EMR LA  +Y++ +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRHVANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  FKE     D+ + +  A++    IRK+ +  +G + LD+FR  I+++GNAM +VR +RSG LHC S +  F PD +D+  +NFEELV++ GLS ETQ +A+ +D V+ +L+R   +  +YFKM V+VF+ EFRS KN+H  NF++++P LTL+FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQS+ E Y  ++N +  Q+++ +T  DE L QT  L+ +RL+    EF+LL + ++SARIFFR D TA EE
Sbjct:    1 MDSLSPDWEFDRFDDGSQKIHAEVQLKNYGKFLEEYTNQLKGIEDALDDSVGDVWDFTLDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCSEIKKLKYEAETKFYNGLLFYGEGVTDSSMVEGESQIQMGRFISFLQEFSCFVTRCYEVVVNVVQQLASLYTSSKNAPKIIETSGVHFQTVYEHLGELLAALLTLDEIIGNHVTLKDHWTMYKRLLKSVHHNPSKFGIAEEKLKPFEKLLFKLEGQLLDGMIFQACVEQQFDTRNEPISVSKNSTFAEEFGHNIRTIFSNVESKLGEPS--EIDQRDKYVGVCALFVLHFLIFRTLDKKLYKSLLDVCKKVPAITLTANIIWFPDHFLLNKLAPAAKVVEKKNLQAIKIQREMFLQQK-AQTLSKDVQSYYLFVSSWMMKMESILSKKQSMDKFAEDLSNRCGIFIQGILYANSLSNIIRTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHTVHRRTMVIADSVCHIAQYLQHQALNSIATAKKRVIS--DKKYSEQRLDVLSALVLAENALNGPSTKERRLVIALALSVGTQMKTFRDEELLPLQVVLKKLDLVTELRERVRVLCDCSFLYWHR-TIFPIYLDDVYDNAVDAARVHYMFSALRDCVPPMKHARHLESTQLLLECFDKEIMDVLNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGIKD-----------------------------LTHFFSIKPIRFFNRFIDAKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYSLMMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHVANSIRTHGTGIMNTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRFFKETKDQNDQKYPFDRADKFNRGIRKLGLTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSNAIRFVPDLEDI--VNFEELVKEEGLSEETQIAARQLDSVLSDLTRNSAEGTEYFKMLVEVFSPEFRSPKNMHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKYMTEKNAVVKQQNVQSTNQDEKLMQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRGDKTAAEE 1141          
BLAST of WASH complex subunit 4 vs. TrEMBL
Match: A0A060WJQ2 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00073374001 PE=4 SV=1)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 457/1179 (38.76%), Postives = 705/1179 (59.80%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEE 3572
            +  DW+FDRF DGS K   E   K Y +FL E++  L    DA++       D+  DP  L    YE ++ L L+ +DNK+LNK++   A +C+E+  L  E   KF   L +YGEG +     + +  V+MGRF+   Q + CF++R ++VV + + Q+A LY+     + + +   +HF+ +Y  +  LL  L+T DE+    G  +D W+ YK++L S  H+P  +A+ ++K+ P E LL  LEG+L+ G IF  C  Q FDD    V+  KNS+ A  F   I+  F  + SKI   +  E ++R+++ G CGLY L+  IF   DKKL K +L+   K+PAV+L  N +W+P  FL   +P  +K +D K  +  + +   YLQ+R      K++   Y  +  W + M+A   K+    K    L+S   + ++G+  A     + +T + L+  + + +T+ +   +CR +E  K +E    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++SSL + +  LNG +T++RR V+ LA+S+       K+EE   L+  L++ DL+++  + V+  CDC F YW + +VFP YL+++   A +   + ++ +A+RDSV  +L   H+E+ +  LE+Y+ +IM++    LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF   KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIEK S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E    +D+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D+  +NFEELV++ GLS ETQ +A ++D V+ +L+    +  +YFKM V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y EFDSL WFQ++ E Y  + + +  ++++  T  DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE
Sbjct:    6 ISPDWEFDRFDDGSTKIHTEVQQKNYGKFLEEYTSQLKGIEDALDDSIGDVWDFTLDPIALKLLPYEQSSLLELIKTDNKVLNKVITVYAALCSEVKKLKYEGEIKFYNGLLYYGEGVSDSCVVEGESQVQMGRFISFFQELSCFVSRCFEVVVNVVHQLAALYNSNKGVTKIIESSGVHFQTVYEHLGELLVVLLTLDEIMENHGTLKDHWKMYKRLLKSVHHNPGKFAIPEEKLKPFEKLLFKLEGQLLDGMIFQACVEQRFDDPGEGVSVSKNSAFAEEFALNIRTIFTNVESKIGEPS--EIDQRDKYAGVCGLYVLHFHIFRTVDKKLYKALLDICKKVPAVTLTSNIIWFPDTFLMAKVPAAAKLMDKKSVQSVRAQRDAYLQQR-AQTLTKDVQSYYVFVTSWMMKMEAISSKEQRNDKLSEDLSSRCNVFVQGILYAYSIGTIIKTTMNLYMSMQRPMTKASVKALCRLVELLKAVEHTFHRRSMVVADSVSHITQHLQSQALNSIGTAKKRVIS--DKKYSEQRLDVLSSLVMAENALNGPSTKERRLVVSLALSVGTQMKTFKDEELLPLQLVLKKLDLISELKERVKVQCDCSFLYWHR-AVFPIYLDDVYDHAVDAARIHYMFSALRDSVPTMLHAKHMESCDQLLESYDTEIMQVFNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LAHFFYLKPIRFFNRFIHIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLMMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIEKTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRFFRETKDQSDQKYPFERAEKFNRGIRKLGITPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDI--VNFEELVKEEGLSEETQKAASLLDSVLGDLTSNSAEGTEYFKMLVGVFAPEFRSIKNMHLRNFYMIVPPLTVNFVEHSIGCKEKLNKKNKGGAAFTDDGFAMGVAYILKLLDQYLEFDSLHWFQAVREKYMKEMSAVVKEQNVQATSQDEKLLQTMNLTQKRLDIYLQEFELLNFSLSSARIFFRADKTAAEE 1143          
BLAST of WASH complex subunit 4 vs. TrEMBL
Match: E7F4L4 (WASH complex subunit 4 OS=Danio rerio OX=7955 GN=washc4 PE=1 SV=1)

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 452/1188 (38.05%), Postives = 718/1188 (60.44%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDK 3599
            +  DW+FDRF DGS K   E  +K YE+FL E+   L    +A++       D+  DP  L    YE ++ L L+ +DNK+LNK++   A +C E+  L  EA  KF   L +YGEG +     + +  ++MGRF+  LQ + CF++R ++VV + + Q+A LY+ +   + + +   +HF+ +Y  +  LL  LIT DE+       ++ W+ YK++L S  H+P  +A+ ++K+ P E L+  LEG+L+   IF  C  Q FD+    V+  KNS+ A  F   I+  F  + SK+   +  E ++R+++ G CGL+ L+  IF   DKK+ K +L+   K+PAV+L  N +W+P  FL N +P  +K +D K  +  ++    +LQ++      K++   Y  +  W + M++ L K+ +  K    L++   I ++G+  A     + +T + ++  + + +T+T+   +CR +E  K +E    ++++ ++D +  I   L  + L+ I   K  + +  +K  S ++LD++S+L + +  LNG +T++RR ++ LA+S+       K+EE   L+  L++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   + ++ +A+RD V  +L   H+E+ +  LE Y+ +IMEI+   LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF + KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E    TD+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D+  +NFEELV++ GLS ETQ ++  +D V+ +L+    +  +YFKM V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y+EFDSL WFQ++ E Y  + N +  ++++ +T  DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE   + K+DK
Sbjct:    6 LSPDWEFDRFDDGSQKIHTEVQVKNYERFLEEYIAQLQGIEEALDDSIGDVWDFTLDPITLKLLPYEQSSLLELIKTDNKVLNKVITVYAALCCEVKKLKHEAETKFYNGLLYYGEGVSDTSVVEGESQIQMGRFVSFLQELSCFVSRCFEVVVNMVHQLAALYNSSKGATKIIESTGVHFQTVYEHLGELLVVLITLDEIMENHATLKEHWKMYKRLLKSVHHNPAKFAIPEEKLKPFEKLIFKLEGQLLDSMIFQACVEQRFDNPGENVSVSKNSAFAEEFAYNIRTIFANVESKLGEPS--EIDQRDKYTGVCGLFVLHFHIFRAVDKKIYKSLLDVCKKVPAVTLAANIIWFPDTFLINKVPAAAKLMDKKSLQSIRSSRDVFLQQK-AQTLMKDMQSYYIFVTSWMMKMESILSKEPKPDKLSEDLSNRCNIFVQGILYAYSISTIIKTTMNMYMSMQRPMTKTSVKALCRLVELLKAVEHTFHRRSLVVADSVSHITQQLQSQALVSISMAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTKERRLIMSLALSVGTQMKTFKDEELLPLQLVLKKLDLISELRERVKVQCDCSFLYWHR-TVFPIYLDDVYENAVDAARIHYMFSALRDCVPTMLHAKHMESCDQLLECYDTEIMEILNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LAHFFSLKPIRFFNRFIDIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRFFRETKDQTDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDI--VNFEELVKEEGLSEETQKASSQLDCVLSDLTSNSAEGTEYFKMLVGVFAPEFRSIKNMHLRNFYMIVPPLTVNFVEHSISCKEKLNKKNKVGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQAVREKYVKEMNAVVKEQNVQSTSQDEKLMQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTAAEE--TQEKKDK 1150          
BLAST of WASH complex subunit 4 vs. Ensembl Cavefish
Match: washc4 (WASH complex subunit 4 [Source:NCBI gene;Acc:103029800])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 453/1179 (38.42%), Postives = 713/1179 (60.47%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEE 3572
            + +DW+FDRF DGS K   E  +K Y +FL E+S  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C+E+  L  EA  KF   L +YGEG +     + +  V+MGRF+  LQ + CF++R ++VV + + Q+A LY+     + + +   +HF+ +Y  +  LL  LIT DE+       RD W+ YK++L S  H+P  +A+ ++K+ P E LL+ LEG+L+   IF  C  Q FD+    V+  KNS+ A  F   I+  F  + SK+   +  E ++R+++ G CGL+ L+  IF   DKKL K +L+   K+PAV+L  N +W+P  FL N +P  +K +D K  +  ++    +LQ++      K++   Y  +  W + M+A L K+    K    L++   + ++G+  A     + +T + L+  + + +T+T+   +CR +E  K +E    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T++RR V+ LA+S+       K+EE   L+  L++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   + ++ +A+RDSV  +L   H+E+    LE Y+K+IM++    LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF + KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E    +D+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D+  +NFEELV++  LS ETQ +A ++D V+ +L+    +  +YFKM V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN++   F+DDGFA+GVA+ILK+LD Y+EFDSL WFQ++ E Y  + + +  ++++  T  DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE
Sbjct:    6 ISADWEFDRFDDGSQKIHTEVQLKNYTKFLEEYSSQLKAIEEALDDSIGDVWDFTLDPIALQLIPYEQSSLLELIKTENKVLNKVITVYAALCSEVKKLKYEAETKFYNGLLYYGEGVSDTSVVEGECQVQMGRFISFLQELSCFVSRCFEVVVNIVHQLAALYNSNKAATKIIESSGVHFQTVYEHLGELLVVLITLDEIMENHATLRDHWKMYKRLLKSVHHNPSKFAILEEKLKPFEKLLLKLEGQLLDSMIFQACVDQRFDNPGEGVSVSKNSAFAEEFAHNIRTIFANVESKLGEPS--EIDQRDKYAGVCGLFVLHFHIFRTVDKKLYKSLLDVCKKVPAVTLTANIIWFPDTFLINKVPAAAKLMDKKSLQAIRSSRDAFLQQK-AQTLTKDVQSYYVFVTSWMMKMEAILSKEQRPDKLAEDLSNRCNVFVQGILYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAVEHTFHRRSLVVADSVTHITQQLHSQALTSISTAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRERRLVVSLALSVGTQMKTFKDEELLPLQLVLKKLDLISELRERVKVQCDCSFLYWHR-AVFPIYLDDVYENAVDAARIHYMFSALRDSVPTMLHAKHMESCEQLLECYDKEIMDVFNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LAHFFSLKPIRFFNRFIDIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLQKKFYIFSQFMYDEHIKSRLIKDIRFFRETKDQSDQKYPFERAEKFNRGIRKLGITPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDI--VNFEELVKEESLSDETQKAASVLDSVLSDLTTNSAEGTEYFKMLVGVFAPEFRSLKNMHLRNFYMIVPPLTVNFVEHSIGCKEKLNKKNKNGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQAVREKYMKEMSAVVKEQNVQATSQDEKLMQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTAAEE 1143          
BLAST of WASH complex subunit 4 vs. Ensembl Cavefish
Match: washc4 (WASH complex subunit 4 [Source:NCBI gene;Acc:103029800])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 363/927 (39.16%), Postives = 567/927 (61.17%), Query Frame = 3
Query:  813 GHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEE 3572
            G  F  C  Q FD+    V+  KNS+ A  F   I+  F  + SK+   +  E ++R+++ G CGL+ L+  IF   DKKL K +L+   K+PAV+L  N +W+P  FL N +P  +K +D K  +  ++    +LQ++      K++   Y  +  W + M+A L K+    K    L++   + ++G+  A     + +T + L+  + + +T+T+   +CR +E  K +E    ++++ ++D +  I   L  + L  I   K  + +  +K  S ++LD++S+L + +  LNG +T++RR V+ LA+S+       K+EE   L+  L++ DL+++  + V+  CDC F YW + +VFP YL+++ + A +   + ++ +A+RDSV  +L   H+E+    LE Y+K+IM++    LL  + K IE DLR+ +++H+     + NPF  G  D                             L HF + KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y + +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+FIE+ S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  F+E    +D+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D+  +NFEELV++  LS ETQ +A ++D V+ +L+    +  +YFKM V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN++   F+DDGFA+GVA+ILK+LD Y+EFDSL WFQ++ E Y  + + +  ++++  T  DE L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE
Sbjct:  183 GVHFQACVDQRFDNPGEGVSVSKNSAFAEEFAHNIRTIFANVESKLGEPS--EIDQRDKYAGVCGLFVLHFHIFRTVDKKLYKSLLDVCKKVPAVTLTANIIWFPDTFLINKVPAAAKLMDKKSLQAIRSSRDAFLQQK-AQTLTKDVQSYYVFVTSWMMKMEAILSKEQRPDKLAEDLSNRCNVFVQGILYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAVEHTFHRRSLVVADSVTHITQQLHSQALTSISTAKKRVIS--DKKYSEQRLDVLSALVLAENTLNGPSTRERRLVVSLALSVGTQMKTFKDEELLPLQLVLKKLDLISELRERVKVQCDCSFLYWHR-AVFPIYLDDVYENAVDAARIHYMFSALRDSVPTMLHAKHMESCEQLLECYDKEIMDVFNEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------LAHFFSLKPIRFFNRFIDIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLQKKFYIFSQFMYDEHIKSRLIKDIRFFRETKDQSDQKYPFERAEKFNRGIRKLGITPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDI--VNFEELVKEESLSDETQKAASVLDSVLSDLTTNSAEGTEYFKMLVGVFAPEFRSLKNMHLRNFYMIVPPLTVNFVEHSIGCKEKLNKKNKNGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQAVREKYMKEMSAVVKEQNVQATSQDEKLMQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTAAEE 1068          

HSP 2 Score: 127.872 bits (320), Expect = 3.459e-29
Identity = 63/182 (34.62%), Postives = 104/182 (57.14%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFE 602
            + +DW+FDRF DGS K   E  +K Y +FL E+S  L    +A++       D+  DP  L    YE ++ L L+ ++NK+LNK++   A +C+E+  L  EA  KF   L +YGEG +     + +  V+MGRF+  LQ + CF++R ++VV + + Q+A LY+     + + +   +HF+
Sbjct:    6 ISADWEFDRFDDGSQKIHTEVQLKNYTKFLEEYSSQLKAIEEALDDSIGDVWDFTLDPIALQLIPYEQSSLLELIKTENKVLNKVITVYAALCSEVKKLKYEAETKFYNGLLYYGEGVSDTSVVEGECQVQMGRFISFLQELSCFVSRCFEVVVNIVHQLAALYNSNKAATKIIESSGVHFQ 187          
BLAST of WASH complex subunit 4 vs. Ensembl Sea Lamprey
Match: washc4 (WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-100427-4])

HSP 1 Score: 251.136 bits (640), Expect = 1.172e-72
Identity = 155/510 (30.39%), Postives = 261/510 (51.18%), Query Frame = 3
Query:  384 ALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCI-PYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENL 1910
             L FYGEG      E+    ++MGR +  LQ + CF+NR Y+VV + + QMA LYS +    +L+ +  +    +Y  +  LL  L+T DE+       +D W  YK++L S  H+   + +  DK+ PLE LLM LE +L+ G I  NC  Q FD+  G V   KNS+ A  F + I+N F  L SK+              V    +  L   IF   DKK  + +L+   K+PAV+L  N VW+  +FL   + P   + ++ K  +    +   +LQ++      K++   Y  +  W   M++ + K  ++  +     S+ I+G+  A     + +T + LH+ L + +T+TT   +CR +E  K IE    ++ + +++ +  I   L  + L  I + K  + +  +K  S R+LD++S+L + +  LNG  T++RR +  LA+SI     I +E+E   L+  +++ DL++D  + +   CDC F YW + SV P YL+++
Sbjct:    3 GLLFYGEGCPEGGMEEGDAQIQMGRMIAFLQELSCFVNRCYEVVMNVVHQMASLYSYSK--VFLNRIAILKCTTVYEHLGDLLMVLVTLDEIIENQSTLKDHWTMYKRLLKSVHHNSSRFEVHVDKLRPLEKLLMKLEAQLLDGLILQNCIEQPFDN--GTVLVSKNSAFAEEFTQNIRNMFAALESKLVFVRINRVVNSLRVVVLSCVAVLNFQIFRTVDKKFFRSLLDVYKKMPAVTLVANVVWFADKFLLLRVQPADKQLVEKKTLQAVPVQRDAHLQQK-AQTLPKDVQSYYLIVSAWMTKMESVMSK-GQVSSDLTNRCSLFIQGILYAFNLSNIVRTTMNLHATLQKPMTKTTVKALCRLVELLKAIEFTFHRRTMMVAECVSHITQHLQYQALTAIASAKKRVVS--DKKYSERRLDVLSALVLAENALNGPGTKERRLITALALSIGTQMKIFREDELLSLQLVMKKLDLISDLRERLHSLCDCSFLYWHR-SVIPIYLDDV 503          
BLAST of WASH complex subunit 4 vs. Ensembl Sea Lamprey
Match: washc4 (WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-100427-4])

HSP 1 Score: 132.494 bits (332), Expect = 1.850e-35
Identity = 67/178 (37.64%), Postives = 100/178 (56.18%), Query Frame = 3
Query:   69 WKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFE 602
            W+FDRF DGS +   E  +KK+ +FL ++   L    DA++     + D+  DP  L    YE  + L L+ +DNK+LNK++   A IC E+N L  EA   F   L FYGEG      E+    ++MGR +  LQ + CF+NR Y+VV + + QMA LYS +     + +V ++HF+
Sbjct:   10 WEFDRFDDGSTEVLGEVQVKKFGRFLEDYVSQLKGIEDALDDSIGDSWDFTLDPVALQLLPYEQASLLELIKTDNKVLNKVITVFAAICCEINKLRHEAETTFYNGLLFYGEGCPEGGMEEGDAQIQMGRMIAFLQELSCFVNRCYEVVMNVVHQMASLYSYSKTAPKIINVSSVHFQ 187          
BLAST of WASH complex subunit 4 vs. Ensembl Nematostella
Match: EDO43986 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX82])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 386/1086 (35.54%), Postives = 622/1086 (57.27%), Query Frame = 3
Query:  342 MNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMG----NAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAK 3584
            M+ L  EA  KF   L  Y E  + Q  E+ +  V +GR LP LQ I  F+ R YDVVK  +QQ+  L++K      + DV  +HF  ++  +  +L  LIT DE+  A+   +D W+ Y++++ S  ++   + + +DK+ P E LLM+LEG+L+ G I  NC  Q FDD   +V   +N  L+  F   IK  ++ L  K+   +  E ++R+ FVG  GL+ L+  I+   DKKL K I     K+PA+ L G+ +++P +FL   +P+L+K +D KQ        + YL      N AK+    Y R+  W ++M++ L K   + ++      + ++G+  A     + +T++ +H  +++ +T+T    +CR  E  K IE     +++ I++ +  I+  L    L  IE  K   +  ++K  + ++LD++++L ++ T LNG  T++RR ++ L + +       KE+E ++L   L++ D++   +  ++ A DC F +W +  + P YL++L + A +V  L +++ A+RD V  L    H  +  + L+++EK+I E ++   L P+ + IE +LR+ ++ H+     + NPF  G  D                             L HF+  +PIRFFD  I IK +V H+L+T FYNLT + L DW+ YAEMR +A+ +Y++ +T  E HLPSQ+LEQG DVL IMR +  F S Y+YNLN Q+F+E+ S+NK LNT+NIR++ANS+RTHG GI+NTT+N  Y FL+ KFF FS+FLYDE IK +L+K++  FK+      + + +  AE+    IRK+ +  DG   LD+FR  I ++G    N M  ++   +        S  +         ++ + + + G+         I+D  I NL++ F    +YFK+ VDVFA EFR  KN+H  NF++++P LTL+FV++++ C++K N+KN+    F+DDGF +GVA+ILK+LD Y EFDSL WFQS+ E Y  ++N+++ +L+    DE L+QT  L+L+RL   + EF+L+ + + SARIFFRAD TA EE+  K
Sbjct:    1 MDELCHEAVTKFYTPLLLYEEAGSEQELEEGEAQVRLGRMLPLLQEISSFVTRCYDVVKSVLQQLGSLHNKGGPK--VIDVNGVHFTTVFEHLGKVLTVLITLDEILDASHTLKDHWKLYRRMVKSVYNNTGMFGVEEDKLRPFEKLLMSLEGQLLDGVIMQNCVEQMFDDGPARVA--RNPELSEEFLYNIKAIYYTLEPKLGEIS--EVDQRQRFVGLLGLFILHFQIYRGLDKKLFKQIWEVYKKVPAIHLVGDIMFFPNEFLLRKVPHLNKTMDRKQLSAVNASREAYLSN-CNQNLAKDAQAYYIRISSWMVHMESALNKGGSLVEDLNTRCMLFVQGILYAYNISHLVRTMMNMHLVMSKPMTKTAVLSLCRLTELLKAIEHTFHGRSMLIAESVNHIMQHLTFLALSAIETAKK--RINVDKKYTDKRLDVLAALVLVQTALNGPGTKERRLIVNLGLHVGTQMKAFKEDEMNNLDNVLKKLDIIGSLNAKIKAASDCGFIHWHR-VILPIYLDDLYENALDVHRLHYMMGALRDCVPILRQVKHEASPQVMLQSFEKEIDEALQEHFLRPLCRDIETELRLHIHQHL--QLDDRNPFKVGMRD-----------------------------LSHFLKLRPIRFFDNFIDIKAHVTHYLDTTFYNLTTVALHDWKTYAEMRNMAKQKYDLDMT--EAHLPSQTLEQGLDVLEIMRNIHVFVSRYLYNLNNQIFVERASNNKHLNTINIRNIANSIRTHGAGIMNTTVNFTYQFLRKKFFIFSQFLYDEHIKARLVKDIRFFKDAKEELSQKYPFERAEKFNKGIRKLGLSPDGLTYLDQFRILIGQIGDVYHNGMIILKEYITMVFSYQHISPWY---------DYFKRINNHGV-----FIPAILDLAIDNLAKNFAGATEYFKLLVDVFAPEFRDVKNMHLRNFYIIVPPLTLNFVEYMLSCKEKLNKKNKVGAAFTDDGFVMGVAYILKLLDQYHEFDSLHWFQSVQEKYNKEKNDVRAALSKGVKDEKLQQTMNLTLKRLSTYQREFELVYFSLNSARIFFRADKTASEEKEEK 1029          
BLAST of WASH complex subunit 4 vs. Ensembl Medaka
Match: washc4 (WASH complex subunit 4 [Source:NCBI gene;Acc:101162287])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 450/1185 (37.97%), Postives = 709/1185 (59.83%), Query Frame = 3
Query:   66 DWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLAS---ILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF-TGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPD-DDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNEL--QKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDK 3599
            DW+FDRF DGS K   E  +K Y +FL E++  L    +A++       D+  DP  L    YE ++ L L+ +DNK+LNK++   A +C+E+  L  EA  KF   L FYGEG +     + +  ++MGRF+  LQ + CF++R Y+VV   + Q+A +Y+ +     + +   +HF+ +Y  +  LL  L+T DE+    G  +D W+ YK++L S  H+   + + ++K+ P E LL+ LEG+L+ G I   C  Q FDD    V+  KN + A  F   I++ F  L SKI     LE ++R+++ G C L+ L+  IF + DKKL K +L+   K+PA++L  N +W+P  FL   +P  +K +D K  +  + +  +YLQ+R      K++   Y  +  W + MD+   K+ +  K    L+S   + ++G+  A     + +T + ++  + + +T+T    +CR +E  K +E    ++A+ I+D +  I   L  + L  I   K  + +  ++  S ++LD++SSL + +  L+G +T++RR V+ LA+ +       K+EE   L+  L++ DL+++  + V+  CDC F +W + +VFP YL+++   A +   + ++ +A+RDSV  +L   H+E+ +  LE+Y+K+IM++    LL  + K IE DLR+ +++H+     + NPF  G  D                             + HF   KPIRFF+R I IK YV H+L+  FYNLT + L DW  Y+EMR LA  +Y   LT  E HLPSQ+LEQG DVL IMR +  F S ++YNLN Q+F+EK S+NK LNT+NIRH+ANS+RTHG GI+NTT+N  Y FL+ KF+ FS+F+YDE IK +LIK++  FKE    +D+ + +  AE+    IRK+ +  DG + LD+FR  I+++GNAM +VR +RSG LHC S++  F PD +D++D  FEELV++ GLS ET+ +A + D V+ +L+    +  +YF+M V VFA EFRS KN+H  NF++++P LT++FV+H + C++K N+KN+    F+DDGFA+GVA+ILK+LD Y EFDSL WFQ++ E Y  + + +  ++++ +   D+ L QT  L+ +RL+    EF+LL + ++SARIFFRAD TA EE   + K+DK
Sbjct:    9 DWEFDRFDDGSQKIHTEVQLKSYSRFLEEYTSQLKGIEEALDDSIGDVWDFTLDPIALKLVPYEQSSLLELIKTDNKVLNKVITVYAALCSEVKKLKYEAETKFYNGLLFYGEGVSESSVVEGESQIQMGRFISFLQELSCFVSRCYEVVVGIVHQLAAVYNSSKVAPKVIETSGVHFQTVYEHLGELLVVLLTLDEIMENHGTLKDHWKMYKRLLKSVHHNLGKFHIPEEKLKPFEKLLLRLEGQLLDGMILQACVEQRFDDSGEGVSVAKNGAFAEEFAFNIRSIFTNLESKIGEP--LEIDQRDKYAGVCCLFVLHFHIFRSVDKKLYKALLDVCKKVPAITLSANIIWFPDTFLVAKVPAAAKLMDKKSLQSIRAQRDSYLQQR-ALMLTKDVQSYYVFVTSWMMKMDSIPSKEPKGDKLAEDLSSRCNVFVQGILYAYSIGAIIKTTMNMYMSMQRPMTKTAVKALCRLVELLKAVEHTFHRRAMVIADSVSHISQQLQSQALCAINVAKKRVVS--DRKYSEQRLDVLSSLVLAENALSGPSTKERRLVVSLALCVGTQLKTFKDEELLPLQLVLKKLDLISELSERVKLQCDCSFLFWHR-AVFPIYLDDVYDNAVDAARMHYMFSALRDSVPSMLHAKHMESCDRLLESYDKEIMDVFHEHLLDKLCKEIEKDLRLSVHTHL--KLDDRNPFKVGMKD-----------------------------MAHFFTIKPIRFFNRFIDIKAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYG--LTMAEAHLPSQTLEQGLDVLEIMRNIHVFVSRFLYNLNNQIFVEKASNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQFLRKKFYIFSQFMYDEHIKSRLIKDIRFFKETKDQSDQKYPFERAEKFNRGIRKLGLTPDGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCCSSAIRFVPDLEDIVD--FEELVKEEGLSEETRRAAGVFDSVLSDLTSNSAEGTEYFRMLVTVFAPEFRSAKNMHLRNFYMIVPPLTVNFVEHSISCKEKLNKKNKSGAAFTDDGFAMGVAYILKLLDQYLEFDSLHWFQAVREKYKKEMSAVVKEQNVPSAGQDQKLLQTMNLTQKRLDVYLQEFELLHFSLSSARIFFRADKTAAEE--TQEKKDK 1150          
BLAST of WASH complex subunit 4 vs. Planmine SMEST
Match: SMESG000003631.1 (SMESG000003631.1)

HSP 1 Score: 2365.5 bits (6129), Expect = 0.000e+0
Identity = 1183/1188 (99.58%), Postives = 1184/1188 (99.66%), Query Frame = 3
Query:   57 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIXXXXXXXXXXXXXXXXXXXXXXXXXXVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLATTKSDENXXXXXXXXXXXXXXXKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDKLNQLEQQ 3620
            MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMD TLRKQSEIQKNPR LASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEK+LSRRQLDIMSSLSVID MLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIVSSSALGNASSSVGSSASLKSSTFLSVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVY DGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLATTKSDENLRQTQTLSLRRLEQRKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDKLNQLEQQ
Sbjct:    1 MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTTNIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLSKEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIYDVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDELFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKLMQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDTATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLPGNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKELSGLYQRLIPWCINMDETLRKQSEIQKNPRRLASILIEGLFLANKSRIMCQTVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVIIHTLAEKILIIIENMKVIIKTQIEKNLSRRQLDIMSSLSVIDAMLNGAATQQRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDCMFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLENKNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPFTGSGDIVSSSALGNASSSVGSSASLKSSTFLSVNLVHFINAKPIRFFDRHIRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMHLPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNIRHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKELHEFKERSATTDKSFSYVNAEQLRTAIRKMFVYPDGSNPLDRFRNHITRMGNAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHSAKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPALTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDSLGWFQSIYEYYYAKQNELQKSLATTKSDENLRQTQTLSLRRLEQRKTEFQLLEYGITSARIFFRADLTAEEERLAKLKQDKLNQLEQQ 1188          
The following BLAST results are available for this feature:
BLAST of WASH complex subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WASHC40.000e+038.20WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC40.000e+038.17WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC42.781e-3134.62WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC43.981e-3147.46WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC42.048e-850.00WASH complex subunit 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y53F4B.213.369e-3426.68pep chromosome:WBcel235:II:15090172:15109042:1 gen... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SWIP2.757e-8325.29gene:FBgn0030739 transcript:FBtr0336975[more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
washc40.000e+038.05WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp240.000e+037.72matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-... [more]
mmp240.000e+037.14matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-... [more]
mmp240.000e+037.31matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-... [more]
mmp240.000e+036.01matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-... [more]
mmp240.000e+039.37matrix metallopeptidase 24 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Washc40.000e+037.78WASH complex subunit 4 [Source:MGI Symbol;Acc:MGI:... [more]
Washc45.289e-3235.33WASH complex subunit 4 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of WASH complex subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q2M389|WASC4_HUMAN0.000e+038.20WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q3UMB9|WASC4_MOUSE0.000e+037.78WASH complex subunit 4 OS=Mus musculus OX=10090 GN... [more]
sp|Q54R74|WASC4_DICDI0.000e+031.98WASH complex subunit 4 OS=Dictyostelium discoideum... [more]
sp|Q9VXH9|WASC4_DROME2.764e-8225.29WASH complex subunit 4 OS=Drosophila melanogaster ... [more]
back to top
BLAST of WASH complex subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QJ490.000e+039.52WASH complex subunit 7 OS=Mizuhopecten yessoensis ... [more]
R7UQC00.000e+038.93Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A4W3HME90.000e+039.00Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A060WJQ20.000e+038.76Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
E7F4L40.000e+038.05WASH complex subunit 4 OS=Danio rerio OX=7955 GN=w... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
washc40.000e+038.42WASH complex subunit 4 [Source:NCBI gene;Acc:10302... [more]
washc43.459e-2939.16WASH complex subunit 4 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
washc41.172e-7230.39WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
washc41.850e-3537.64WASH complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO439860.000e+035.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WASH complex subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
washc40.000e+037.97WASH complex subunit 4 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of WASH complex subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000003631.10.000e+099.58SMESG000003631.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007824 ID=SMED30007824|Name=WASH complex subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=4314bp
CTTCCTTAGATAAATTATAACTTGAATTTTTAAATTTTATTTTATTTCGG
AATATTATGGATTCTGACTGGAAGTTCGATAGATTCCATGATGGGTCTTA
CAAAAGTGCTGAAGAAAATGTTATAAAAAAATATGAGCAGTTTTTAACTG
AATTTTCTCAGCATTTAGATCTGCAAGTCGATGCTATGGAAGGTTACGGA
ACTACAAATATCGATTATTTTTTTGATCCTTTTGAGTTGACATGTCGACA
CTATGAATCAACGACATATCTAGCTTTAGTAAATTCGGATAATAAAATTC
TTAATAAAATTGTTGTAACTTTGGCAACAATTTGCACAGAAATGAATAAT
CTATCTAAGGAAGCTCGAAATAAATTTATTCCAGCGCTGTCATTTTATGG
AGAAGGATTTAATCACCAAATTGATGAGAAGTTGAAAATTCCCGTAGAAA
TGGGGCGCTTTTTACCAACTTTACAGGGCATCATGTGTTTCATTAACCGT
ATCTACGACGTTGTCAAGCATGCCATTCAGCAAATGGCCGGGCTATATTC
AAAAGCCAACGACGACTCCTATCTGTCTGATGTGGTAAACATCCATTTCG
AGGAATTGTATACATCGATTGCCCACTTGCTCTGCCACCTCATCACATTT
GATGAATTGTTCACCGCGGCCGGCAATTTCCGCGACGATTGGGAGGCATA
CAAGAAGATTCTGACTTCTGCCAAGCACGATCCCGATACATATGCACTGG
CAAAAGATAAGATTGCTCCACTTGAAAGCCTCCTCATGAATCTCGAAGGA
AAGCTTATGCAAGGCCACATTTTCATTAACTGCTGCATTCAGAACTTTGA
TGATGAAGCTGGACAAGTGACTAATGTTAAGAATAGCTCTCTTGCTGTCA
TTTTCAACAAAGCCATCAAAAACAGATTTTTTTGGCTGAGTTCGAAAATT
GACACCGCAACATATTTGGAAACAAATGAACGGGAGGAATTTGTAGGCTG
GTGTGGATTATATGGATTATACGTAACGATATTCGGGAACGCCGACAAAA
AACTACTAAAGGACATACTGAACTTTCTCAATAAATTGCCAGCTGTCTCC
TTGCCCGGAAATAGAGTTTGGTATCCACTACAATTCCTGAAAAACTGCAT
TCCATACTTGTCGAAATTTATCGATCCTAAACAATCTGAACAAGGGAAAA
CTAGGCCTAAAACCTATCTACAAGAAAGAACCGGAGCAAATTTTGCAAAA
GAATTGTCCGGATTATACCAACGATTAATTCCCTGGTGTATCAATATGGA
CGCGACTCTCCGTAAGCAATCCGAAATCCAGAAGAATCCTCGTCTTCTTG
CATCGATACTCATCGAGGGTCTCTTTCTGGCTAACAAGAGCAGGATTATG
TGTCAAACGGTCCTCCAGCTCCATTCCGACCTCAACCAGTCAATTACTCG
TACGACTAGTGGTTTGATCTGTCGTGGGCTTGAATTCACAAAGGTCATCG
AATCTGTTGTACGGAAACAAGCAGTTTTCATTTCGGATTTCCTTGAGGTG
ATCATCCATACATTAGCAGAGAAAATCTTGATCATAATTGAGAATATGAA
GGTCATTATTAAGACTCAGATAGAAAAAAGCCTGTCCCGTCGACAGCTTG
ATATAATGTCATCCCTCTCCGTGATTGATACAATGCTTAATGGGGCAGCA
ACACAACAAAGAAGAACTGTTATTAAATTGGCAATATCAATTGTCAGACC
CGAGGATATTCTCAAGGAAGAAGAGTGTTCCGATTTACGATACCAACTTA
GACAATATGATCTTCTTGCAGATTACCATGATAACGTTCGGTATGCTTGC
GATTGCATGTTTTTCTATTGGGCCAAAGATTCCGTGTTTCCATGTTATTT
GGAAAATTTGTTGAAGACTGCAGACAACGTGGGTCACTTACAGTTTATCC
TGACAGCAATAAGGGACAGTGTAAAGGGCCTTTTAGCGACGTCTCATCTG
GAAAATAAAAACCTCGCCTTAGAGAACTATGAAAAACAAATCATGGAAAT
TGTGGAAAATAAACTATTAATACCGATCAGTAAATGTATAGAAAATGATT
TGCGAGTACAAATGTACAGTCACATAATGAAAACCCGATCGGAGCTCAAC
CCATTCACCGGAAGTGGGGATATCGTATCTTCGTCAGCTTTAGGCAATGC
CAGCTCATCTGTTGGCAGTAGTGCTTCATTGAAATCCTCTACTTTTCTTT
CCGTCAATCTCGTACATTTTATCAATGCTAAGCCAATCAGATTCTTTGAC
CGACATATCAGAATTAAAGATTACGTCGAGCATCATTTGGAAACCGTATT
TTACAACCTGACTGCCATATACCTGAGTGATTGGCGGAATTACGCAGAAA
TGCGTAGACTGGCCCAGAATCAATATAATATTTGCCTCACTACTCCGGAA
ATGCATTTGCCCAGTCAAAGTCTAGAACAAGGGAAAGATGTTCTCAATAT
CATGCGAGGAATGGCAAATTTCTCTTCACACTACGTTTACAATCTTAATA
CTCAGGTTTTCATCGAAAAACAGTCGGATAATAAATTCCTCAACACGGTC
AACATCAGGCACGTCGCCAATTCTGTCAGAACTCATGGATGGGGGATCAT
CAATACAACCATTAATAACGCTTATATTTTCCTGAAGGATAAATTCTTCC
AATTCTCCGAGTTTCTTTATGATGAAAGAATTAAGGGGAAACTCATTAAA
GAACTTCATGAATTCAAAGAAAGAAGTGCAACTACTGACAAATCATTCTC
ATATGTAAATGCTGAACAATTGCGCACAGCTATAAGGAAAATGTTTGTCT
ATTCCGATGGGAGTAACCCATTGGACCGTTTCAGGAATCACATTACTAGA
ATGGGTAATGCTATGGCGTTTGTCAGGTCGGTTCGTTCTGGCGCCCTCCA
TTGCGGTAGTGCTTCAGCGAATTTTTTCCCCGATGATGATGTAATGGATA
TAAACTTTGAGGAATTAGTCAGGGATACTGGACTGTCCTCGGAAACCCAA
CATAGCGCCAAAATTGTCGATGATGTTATAAAAAATCTGTCCCGATTCTT
TGTGAAGGACAAGGACTATTTCAAGATGTTCGTTGACGTATTCGCTATGG
AATTCAGGTCAAAGAAAAATGTGCATTGTCATAATTTCTTTGTTTTACTG
CCAGCTTTGACATTGAGTTTTGTTGATCATATCATGGAGTGTCGGGATAA
ATTCAACAGGAAGAACCGAGATGTTTTCATATTTTCTGATGATGGATTTG
CTATAGGAGTTGCATTTATCTTGAAAGTCCTTGATCTATATAAAGAATTC
GATTCTTTGGGATGGTTCCAGTCGATCTATGAATATTACTATGCTAAACA
AAACGAATTACAAAAAAGTTTGGCTACAACGAAAAGCGATGAAAATCTGC
GTCAAACGCAAACTTTAAGCTTGCGTAGACTTGAGCAAAGGAAAACCGAA
TTCCAATTGCTGGAATACGGAATTACGAGTGCTCGGATTTTCTTCCGTGC
CGACTTAACGGCAGAGGAGGAGAGATTGGCAAAACTGAAACAAGATAAAT
TAAATCAGTTGGAGCAACAAACTACGGTTGTGGTTTCAAACTAATCAATA
TTTATATTTATATTGATTTTTACGGTGCCATTCACCTTTCTAATAATTGA
TTTCTTATATCGAATTGTGAGCCTTGTTGCCTTTATTGATTACGGGAAAT
TGATTTATGATATTTGCATAGTCTACTGCACCTTGAATGCATTTCTGATT
TGATAATAATTTCCTTTATTTCCATTCGTTGAATTTTTTATTGATCTTCC
AATCAGAATATCCCTGGAATCAGAATATTTTTCCAATGCCGTGTTGCTTG
ACAAATGTATTCTCATTGATCAAATACCCAATATTGTGTTTGTGCATGGT
GTTGCGTAACGGAATTACATAATCGATAAAAAATCGTAAGTTATTCCGAG
TTTCAAAACTTGATTTTAACTGGATACAAAATCGTGGTTTTTCATATTTT
TGACCATCTTCCAATAAAATTTCAAACATGTCATCGTCAGTAAAGTCTTG
CATTTCTCGATATTTTGGAGAAAGAAAATTTCAAAAATGTTTTTTTCTCT
AGAAAAATCTTGGATATATGAGAAAAGCCAGCAAATTTCAAATCTCCGGG
CTATAGCTCGATAAAACAAAAAAGTAAAATTTCACTTAAAAATCAATATT
TGCACTTTTTAATCAATAATTTCACATTTAAAACAATCAGTTCCCTCAAC
GTTTCGAACATGTT
back to top

protein sequence of SMED30007824-orf-1

>SMED30007824-orf-1 ID=SMED30007824-orf-1|Name=SMED30007824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1196bp
MDSDWKFDRFHDGSYKSAEENVIKKYEQFLTEFSQHLDLQVDAMEGYGTT
NIDYFFDPFELTCRHYESTTYLALVNSDNKILNKIVVTLATICTEMNNLS
KEARNKFIPALSFYGEGFNHQIDEKLKIPVEMGRFLPTLQGIMCFINRIY
DVVKHAIQQMAGLYSKANDDSYLSDVVNIHFEELYTSIAHLLCHLITFDE
LFTAAGNFRDDWEAYKKILTSAKHDPDTYALAKDKIAPLESLLMNLEGKL
MQGHIFINCCIQNFDDEAGQVTNVKNSSLAVIFNKAIKNRFFWLSSKIDT
ATYLETNEREEFVGWCGLYGLYVTIFGNADKKLLKDILNFLNKLPAVSLP
GNRVWYPLQFLKNCIPYLSKFIDPKQSEQGKTRPKTYLQERTGANFAKEL
SGLYQRLIPWCINMDATLRKQSEIQKNPRLLASILIEGLFLANKSRIMCQ
TVLQLHSDLNQSITRTTSGLICRGLEFTKVIESVVRKQAVFISDFLEVII
HTLAEKILIIIENMKVIIKTQIEKSLSRRQLDIMSSLSVIDTMLNGAATQ
QRRTVIKLAISIVRPEDILKEEECSDLRYQLRQYDLLADYHDNVRYACDC
MFFYWAKDSVFPCYLENLLKTADNVGHLQFILTAIRDSVKGLLATSHLEN
KNLALENYEKQIMEIVENKLLIPISKCIENDLRVQMYSHIMKTRSELNPF
TGSGDIVSSSALGNASSSVGSSASLKSSTFLSVNLVHFINAKPIRFFDRH
IRIKDYVEHHLETVFYNLTAIYLSDWRNYAEMRRLAQNQYNICLTTPEMH
LPSQSLEQGKDVLNIMRGMANFSSHYVYNLNTQVFIEKQSDNKFLNTVNI
RHVANSVRTHGWGIINTTINNAYIFLKDKFFQFSEFLYDERIKGKLIKEL
HEFKERSATTDKSFSYVNAEQLRTAIRKMFVYSDGSNPLDRFRNHITRMG
NAMAFVRSVRSGALHCGSASANFFPDDDVMDINFEELVRDTGLSSETQHS
AKIVDDVIKNLSRFFVKDKDYFKMFVDVFAMEFRSKKNVHCHNFFVLLPA
LTLSFVDHIMECRDKFNRKNRDVFIFSDDGFAIGVAFILKVLDLYKEFDS
LGWFQSIYEYYYAKQNELQKSLATTKSDENLRQTQTLSLRRLEQRKTEFQ
LLEYGITSARIFFRADLTAEEERLAKLKQDKLNQLEQQTTVVVSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0010506regulation of autophagy
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027307WASH7
IPR028283WASH-7_C
IPR028191WASH-7_N
IPR028282WASH-7_central
Vocabulary: cellular component
TermDefinition
GO:0071203WASH complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 648..668
NoneNo IPR availableCOILSCoilCoilcoord: 1167..1188
IPR028282WASH complex subunit 7, central domainPFAMPF14744WASH-7_midcoord: 602..976
e-value: 3.0E-108
score: 362.0
IPR028191WASH complex subunit 7, N-terminalPFAMPF14745WASH-7_Ncoord: 28..600
e-value: 1.5E-136
score: 456.2
IPR028283WASH complex subunit 7, C-terminalPFAMPF14746WASH-7_Ccoord: 997..1164
e-value: 3.5E-52
score: 176.6
IPR027307WASH complex subunit 7PANTHERPTHR31409FAMILY NOT NAMEDcoord: 3..701
coord: 733..1165