ATP-dependent RNA helicase DBP2

Overview
NameATP-dependent RNA helicase DBP2
Smed IDSMED30007815
Length (bp)1402
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DBP2 (SMED30007815) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DBP2 (SMED30007815) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 425.631 bits (1093), Expect = 1.433e-143
Identity = 208/361 (57.62%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E+E YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 425.246 bits (1092), Expect = 1.962e-143
Identity = 208/361 (57.62%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E+E YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 419.083 bits (1076), Expect = 1.886e-139
Identity = 199/361 (55.12%), Postives = 263/361 (72.85%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:  122 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGL 482          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 419.083 bits (1076), Expect = 1.995e-139
Identity = 199/361 (55.12%), Postives = 263/361 (72.85%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:  122 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGL 482          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 418.698 bits (1075), Expect = 2.100e-139
Identity = 199/361 (55.12%), Postives = 263/361 (72.85%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:  122 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGL 482          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 376.326 bits (965), Expect = 2.191e-125
Identity = 177/365 (48.49%), Postives = 260/365 (71.23%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPND---KMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  VDW+++NL P EK+FY EN  VS R   EI+ +    ++T++G  + +P+F F+E  L  +I  ++   K+ +PT IQ+   P+A+SGR+++ +A+TGSGKT ++++PA+VH+  Q   +RG+GP  L+++PTRELAQQVQ V+ DF  S+G++  C++GGA+KG Q R L  G +I+VATPGRL+D L +  TN+ + +Y+VLDEADRMLDMGFEPQI+KI  Q+R DRQTLM+SATWPKEV+ LA DF      +N+GS EL AN NI Q+V+I++EHAK  +L+E+++   N    K I+F ETK+KAD +   +R   +    +HGDK+Q +RD++L+ F+     I++ATDVA+RGL
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLYG-KFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 376.326 bits (965), Expect = 2.191e-125
Identity = 177/365 (48.49%), Postives = 260/365 (71.23%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPND---KMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  VDW+++NL P EK+FY EN  VS R   EI+ +    ++T++G  + +P+F F+E  L  +I  ++   K+ +PT IQ+   P+A+SGR+++ +A+TGSGKT ++++PA+VH+  Q   +RG+GP  L+++PTRELAQQVQ V+ DF  S+G++  C++GGA+KG Q R L  G +I+VATPGRL+D L +  TN+ + +Y+VLDEADRMLDMGFEPQI+KI  Q+R DRQTLM+SATWPKEV+ LA DF      +N+GS EL AN NI Q+V+I++EHAK  +L+E+++   N    K I+F ETK+KAD +   +R   +    +HGDK+Q +RD++L+ F+     I++ATDVA+RGL
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLYG-KFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 376.326 bits (965), Expect = 2.191e-125
Identity = 177/365 (48.49%), Postives = 260/365 (71.23%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPND---KMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  VDW+++NL P EK+FY EN  VS R   EI+ +    ++T++G  + +P+F F+E  L  +I  ++   K+ +PT IQ+   P+A+SGR+++ +A+TGSGKT ++++PA+VH+  Q   +RG+GP  L+++PTRELAQQVQ V+ DF  S+G++  C++GGA+KG Q R L  G +I+VATPGRL+D L +  TN+ + +Y+VLDEADRMLDMGFEPQI+KI  Q+R DRQTLM+SATWPKEV+ LA DF      +N+GS EL AN NI Q+V+I++EHAK  +L+E+++   N    K I+F ETK+KAD +   +R   +    +HGDK+Q +RD++L+ F+     I++ATDVA+RGL
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLYG-KFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 376.326 bits (965), Expect = 2.191e-125
Identity = 177/365 (48.49%), Postives = 260/365 (71.23%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPND---KMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  VDW+++NL P EK+FY EN  VS R   EI+ +    ++T++G  + +P+F F+E  L  +I  ++   K+ +PT IQ+   P+A+SGR+++ +A+TGSGKT ++++PA+VH+  Q   +RG+GP  L+++PTRELAQQVQ V+ DF  S+G++  C++GGA+KG Q R L  G +I+VATPGRL+D L +  TN+ + +Y+VLDEADRMLDMGFEPQI+KI  Q+R DRQTLM+SATWPKEV+ LA DF      +N+GS EL AN NI Q+V+I++EHAK  +L+E+++   N    K I+F ETK+KAD +   +R   +    +HGDK+Q +RD++L+ F+     I++ATDVA+RGL
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLYG-KFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 376.326 bits (965), Expect = 2.191e-125
Identity = 177/365 (48.49%), Postives = 260/365 (71.23%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPND---KMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  VDW+++NL P EK+FY EN  VS R   EI+ +    ++T++G  + +P+F F+E  L  +I  ++   K+ +PT IQ+   P+A+SGR+++ +A+TGSGKT ++++PA+VH+  Q   +RG+GP  L+++PTRELAQQVQ V+ DF  S+G++  C++GGA+KG Q R L  G +I+VATPGRL+D L +  TN+ + +Y+VLDEADRMLDMGFEPQI+KI  Q+R DRQTLM+SATWPKEV+ LA DF      +N+GS EL AN NI Q+V+I++EHAK  +L+E+++   N    K I+F ETK+KAD +   +R   +    +HGDK+Q +RD++L+ F+     I++ATDVA+RGL
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLYG-KFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0309319)

HSP 1 Score: 439.884 bits (1130), Expect = 1.157e-151
Identity = 214/371 (57.68%), Postives = 279/371 (75.20%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMF 1333
            +  VD++  NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGLG F
Sbjct:   87 MRPVDFS--NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLGKF 453          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0309321)

HSP 1 Score: 435.647 bits (1119), Expect = 1.048e-149
Identity = 212/368 (57.61%), Postives = 277/368 (75.27%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +  VD++  NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGL
Sbjct:   87 MRPVDFS--NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGL 450          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0309320)

HSP 1 Score: 435.261 bits (1118), Expect = 2.334e-149
Identity = 210/359 (58.50%), Postives = 272/359 (75.77%), Query Frame = 2
Query:  266 NLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGL
Sbjct:   94 NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGL 450          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0309322)

HSP 1 Score: 434.491 bits (1116), Expect = 3.714e-149
Identity = 210/359 (58.50%), Postives = 272/359 (75.77%), Query Frame = 2
Query:  266 NLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGL
Sbjct:   94 NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGL 450          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0302597)

HSP 1 Score: 437.187 bits (1123), Expect = 8.625e-149
Identity = 212/368 (57.61%), Postives = 277/368 (75.27%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +  VD++  NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGL
Sbjct:   90 MRPVDFS--NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGL 453          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 437.958 bits (1125), Expect = 3.060e-150
Identity = 222/421 (52.73%), Postives = 290/421 (68.88%), Query Frame = 2
Query:   80 DRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMF 1333
            DRD  R DR  Y +   R+GG+R+     A +  +P +R              L    WN   L  FEKNFY+ENP V+ RS+ E+E+YRR KE+TVKG +  KPI  F E +  + +M VI    W +PTPIQAQG P+ALSG+++VG+A+TGSGKT SYL+PAIVH+  QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  I+S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +YIQ+N+G+ +L AN NI QIV++ ++  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDK+Q +RD++L  F+     IL+ATDVASRGLG+ 
Sbjct:    6 DRDRGR-DRGSYSSGPPRFGGSRNGPP-PAKKFGNPGDR--------------LRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLGLL 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 435.647 bits (1119), Expect = 2.531e-149
Identity = 221/418 (52.87%), Postives = 288/418 (68.90%), Query Frame = 2
Query:   80 DRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            DRD  R DR  Y +   R+GG+R+     A +  +P +R              L    WN   L  FEKNFY+ENP V+ RS+ E+E+YRR KE+TVKG +  KPI  F E +  + +M VI    W +PTPIQAQG P+ALSG+++VG+A+TGSGKT SYL+PAIVH+  QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  I+S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +YIQ+N+G+ +L AN NI QIV++ ++  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDK+Q +RD++L  F+     IL+ATDVASRGL
Sbjct:    6 DRDRGR-DRGSYSSGPPRFGGSRNGPP-PAKKFGNPGDR--------------LRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGL 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 436.032 bits (1120), Expect = 1.091e-147
Identity = 221/418 (52.87%), Postives = 288/418 (68.90%), Query Frame = 2
Query:   80 DRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            DRD  R DR  Y +   R+GG+R+     A +  +P +R              L    WN   L  FEKNFY+ENP V+ RS+ E+E+YRR KE+TVKG +  KPI  F E +  + +M VI    W +PTPIQAQG P+ALSG+++VG+A+TGSGKT SYL+PAIVH+  QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  I+S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +YIQ+N+G+ +L AN NI QIV++ ++  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDK+Q +RD++L  F+     IL+ATDVASRGL
Sbjct:    6 DRDRGR-DRGSYSSGPPRFGGSRNGPP-PAKKFGNPGDR--------------LRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGL 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: si:dkey-156n14.5 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 426.787 bits (1096), Expect = 5.319e-147
Identity = 206/365 (56.44%), Postives = 263/365 (72.05%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKS 1339
            W+   L  FEKNFY ENP V + S  ++E YRR +E+TV+G    KP+ +F +    + +M V+    + EPT IQAQG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA D+ +S  I+S CVYGGA KG QIR L  G EI +ATPGRLID L+   TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E+ KD +L++++ +      +K I+F ETKK+ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG   S
Sbjct:   47 WDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLGFLTS 411          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 426.787 bits (1096), Expect = 5.319e-147
Identity = 206/365 (56.44%), Postives = 263/365 (72.05%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKS 1339
            W+   L  FEKNFY ENP V + S  ++E YRR +E+TV+G    KP+ +F +    + +M V+    + EPT IQAQG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA D+ +S  I+S CVYGGA KG QIR L  G EI +ATPGRLID L+   TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E+ KD +L++++ +      +K I+F ETKK+ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG   S
Sbjct:   47 WDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLGFLTS 411          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 425.631 bits (1093), Expect = 3.043e-146
Identity = 199/363 (54.82%), Postives = 268/363 (73.83%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMF 1333
            W+   L  FEKNFY E+P V+  +  ++E  RR KE+T++G N  KPI+ F + +  + ++ V+ + ++ EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PA+VH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +S  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG++
Sbjct:   25 WDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLGLY 387          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 421.779 bits (1083), Expect = 1.646e-143
Identity = 198/360 (55.00%), Postives = 265/360 (73.61%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  ++E  RR KE+T++G N  KPI+ F + +  + ++ V+ + ++ EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PA+VH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +S  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   36 WDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGL 395          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 421.394 bits (1082), Expect = 2.741e-143
Identity = 198/360 (55.00%), Postives = 265/360 (73.61%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  ++E  RR KE+T++G N  KPI+ F + +  + ++ V+ + ++ EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PA+VH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +S  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   25 WDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGL 384          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 420.624 bits (1080), Expect = 5.143e-143
Identity = 198/360 (55.00%), Postives = 265/360 (73.61%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  ++E  RR KE+T++G N  KPI+ F + +  + ++ V+ + ++ EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PA+VH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +S  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   48 WDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGL 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 421.779 bits (1083), Expect = 4.108e-142
Identity = 198/360 (55.00%), Postives = 265/360 (73.61%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  ++E  RR KE+T++G N  KPI+ F + +  + ++ V+ + ++ EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PA+VH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +S  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   34 WDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGL 393          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 426.017 bits (1094), Expect = 8.253e-147
Identity = 208/362 (57.46%), Postives = 266/362 (73.48%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLG 1327
            WN   L  FEKNFY+E+P ++ R++ E++ YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGLG
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLG 406          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 422.55 bits (1085), Expect = 2.366e-145
Identity = 200/365 (54.79%), Postives = 267/365 (73.15%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFK 1336
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG+++
Sbjct:   43 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGLYR 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 419.083 bits (1076), Expect = 6.788e-144
Identity = 200/362 (55.25%), Postives = 264/362 (72.93%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLG 1327
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG
Sbjct:   43 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLG 404          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 424.476 bits (1090), Expect = 3.563e-143
Identity = 207/361 (57.34%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E++ YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 419.468 bits (1077), Expect = 8.247e-141
Identity = 199/361 (55.12%), Postives = 263/361 (72.85%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNIN-KPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+P V+  +  E++  RR KE+TV+G ++  KP+F+F   +  + +M V+ +  + EPTPIQ QG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA+D+ +   ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y Q+N+G+ EL AN NI QIV++  E  KD +L++++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   43 WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGL 403          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|P19109|DDX17_DROME (ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3)

HSP 1 Score: 437.573 bits (1124), Expect = 3.877e-146
Identity = 212/368 (57.61%), Postives = 277/368 (75.27%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV------SKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +  VD++  NL PF+KNFY+E+P V+NRS  E++ YR  +E+TV+G  +  PI  F E+ L   +M  IR   +  PT IQAQG P+A+SG N VG+A+TGSGKT  Y++PAIVH+  Q PL+RGDGPI L++ PTRELAQQ+Q VA +F  S  +R+ CV+GGA KG Q+R L+ G EI++ATPGRLID L +  TNL R TY+VLDEADRMLDMGFEPQIRKI SQ+R DRQTLMWSATWPKEV++LA+DFLG YIQ+NIGS EL AN NI Q+V++ DE +K+++L  ++      S++P  K+I+F ETK++ D +  F+RS   R GA+HGDKSQS+RD++L+ FR    NILVATDVA+RGL
Sbjct:  231 MRPVDFS--NLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPG-KIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGL 594          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|Q4PHU9|DBP2_USTMA (ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=DBP2 PE=3 SV=2)

HSP 1 Score: 426.017 bits (1094), Expect = 8.513e-144
Identity = 210/365 (57.53%), Postives = 263/365 (72.05%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRL---LEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L +VDWNS NL+PFEKNFY E+P VSNRS SE++ YR  K+MT++G N+ KP+ SFDE      I+S I+   ++EP+ IQ+Q  PMALSGR+LV +A TGSGKT  + +PA+VH+ AQP L+ GDGPI LI+ PTRELA Q+Q   N F  S  +R+  VYGG  KG QIR L+ GAEI +ATPGRLID++ +  TNL R TY+V+DEADRMLDMGFEPQIRKI  Q+R DRQTLM+SATWPKEVQRLA DFL  Y QVNIGS EL AN N++QI+E+  E  K  +L   LE +S   N K+I+F  TK+ AD +  FLR   +   A+HGDK Q +RD++L  F+     I+VAT VASRGL
Sbjct:   77 LGAVDWNSVNLVPFEKNFYVEDPRVSNRSDSEVQQYRASKQMTIQGQNVPKPVTSFDEAGFPDYILSEIKKMGFSEPSAIQSQAWPMALSGRDLVAIAETGSGKTIGFALPAMVHINAQPLLKPGDGPIALILAPTRELANQIQVECNRFGGSSRLRTCAVYGGVPKGPQIRDLQRGAEICIATPGRLIDMVDAGKTNLRRVTYLVMDEADRMLDMGFEPQIRKILQQIRPDRQTLMFSATWPKEVQRLAGDFLNNYAQVNIGSTELAANHNVKQIIEVCTEFEKKGKLIGHLETISAE-NGKVIIFTSTKRVADDLTKFLRQDGWPALAIHGDKQQQERDWVLAEFKSGRSPIMVATAVASRGL 440          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|P17844|DDX5_HUMAN (Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 6.882e-143
Identity = 208/361 (57.62%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E+E YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|Q61656|DDX5_MOUSE (Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus OX=10090 GN=Ddx5 PE=1 SV=2)

HSP 1 Score: 424.861 bits (1091), Expect = 1.469e-142
Identity = 207/361 (57.34%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E++ YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|Q4R6M5|DDX5_MACFA (Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis OX=9541 GN=DDX5 PE=2 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 6.069e-142
Identity = 207/361 (57.34%), Postives = 264/361 (73.13%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ R++ E+E YRR KE+TV+G N  KP+ +F E +    +M VI    + EPT IQAQG P+ALSG ++VGVA+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+   TNL RTTY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  YI +NIG+ EL AN NI QIV++  +  KD++L+    EI+S+  N K IVF ETK++ D +   +R   +    +HGDKSQ +R ++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKEN-KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERGWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A183A0V7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS592 PE=3 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 2.739e-158
Identity = 214/357 (59.94%), Postives = 277/357 (77.59%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN + L  F+K FY+E+P+ ++R  SE+  +R L +MT+ G NI +P+ SF+E+ L   + +VI  N W  PTPIQAQGLPMA++GR++VG+A+TGSGKTAS++IPA+VH+ AQP L RGDGPICL++VPTRELAQQV  VA +F+ + G+R++C YGG+ +G QIR+L+ GAEI +ATPGRLID ++S    + R TY+VLDEADRMLDMGFEPQIRKI + +R DRQTLMWSATWP+EVQ LA+DFL  YIQVNIGS  LHANPNI QIVE++DE  K++RL+E+++     + +VF ETK+K D I Y LR + F VGAMHGDK Q DR+  L  FR   +N+LVATDVASRGL
Sbjct:   10 WNLEELPKFQKCFYQEHPMSASRPESEVTAFRMLHKMTLSGTNIPRPVLSFEELALPDYVTNVIMRNGWQSPTPIQAQGLPMAMAGRDVVGIAQTGSGKTASFIIPAMVHIAAQPRLLRGDGPICLVLVPTRELAQQVLAVAQEFTSAAGMRTMCFYGGSPRGPQIRELQRGAEICIATPGRLIDFIRSERNLMGRVTYLVLDEADRMLDMGFEPQIRKIVAHIRPDRQTLMWSATWPREVQTLARDFLKNYIQVNIGSVALHANPNITQIVEVVDEWNKEQRLIELLTMFGRSRCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLSSFRDGRINVLVATDVASRGL 366          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A183TE80 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS14778 PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 2.865e-158
Identity = 227/392 (57.91%), Postives = 282/392 (71.94%), Query Frame = 2
Query:  161 YEASRSRSPHNRHSYRSRDNRRDEQT----LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +     R P    S+    N+R        L +  W+ +NL  FEK FYRE P VS+R   EI+N+R    MT+ G +I +PIF+F++++L   I+   +   W  PTPIQ+QG PM LSGR++VG+A+TGSGKTA YL+PAIVH+ AQP L R +GPICL++VPTRELAQQV TVA+ FS    +R+VC+YGGA+KG Q R L +GAEI VATPGRLID L+ + TNL R TY+VLDEADRMLDMGFEPQIRKI  QVR DRQT+MWSATWPKEVQ LA+ FL  YIQVNIGS  LHANPNI Q+V++IDE+ K+ RL E++      + +VFAETKKK D + YFLR + FRV AMHGDK+Q +RD  L  FR   + +LVATDVASRGL
Sbjct:   37 FRCLSCRMPFRSRSWGGPPNKRKHSCNFDDLKAPRWDLENLPRFEKVFYRELPSVSSRPQEEIDNFRAENRMTLSGRDIPRPIFNFNDLELPPHIVGAFQRAGWASPTPIQSQGWPMVLSGRDVVGIAQTGSGKTACYLVPAIVHILAQPRLLRDEGPICLVLVPTRELAQQVITVADQFSAPARLRTVCLYGGASKGPQQRALTHGAEICVATPGRLIDFLKGNATNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQVRPDRQTVMWSATWPKEVQALARSFLKDYIQVNIGSTSLHANPNITQVVDVIDEYDKENRLCELIQSFHGLRCLVFAETKKKTDQVAYFLRRRGFRVAAMHGDKAQRERDATLAAFRTAKITVLVATDVASRGL 428          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A4S2LF31 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007596 PE=3 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 5.313e-158
Identity = 224/388 (57.73%), Postives = 286/388 (73.71%), Query Frame = 2
Query:  173 RSRSPHNRHSYRSRDNRRDEQTLN----SVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            R RSP  R S     N+R +  +N    +  WN  +L  FEK FY E+P  + R   E++ +R   +MT+ G NI +P+ SF E++L   ++ VI NN W+ PTPIQAQGLPM LSGR++VG+A+TGSGKTAS++IPAIVH+ AQP L RG+GPICL++VPTRELAQQV +VA  F+ + G+R++C YGGA++G Q+R L+ G E+ +ATPGRLID ++S    L R TY+VLDEADRMLDMGFEPQIR I S +R DRQTLMWSATWP+EVQ LA+DFL  YIQVNIGS  LHANPNI QIVEIIDE  K++RL+++++    ++ +VF ETK+K D I Y LR + F VGAMHGDK Q DR+  L  FR   L++LVATDVASRGL
Sbjct:   11 RGRSPARRWSTSGPSNKRGKFDMNMDVPAPKWNLADLPKFEKCFYVEHPATTARPEPEVQAFRTEYKMTLSGPNIPRPVLSFGELNLPDHVLRVIANNGWHGPTPIQAQGLPMGLSGRDVVGIAQTGSGKTASFVIPAIVHILAQPRLLRGEGPICLVLVPTRELAQQVLSVAQQFATAAGLRTMCFYGGASRGPQLRDLQRGGEMCIATPGRLIDFIRSEKKLLSRVTYLVLDEADRMLDMGFEPQIRTIISNIRPDRQTLMWSATWPREVQGLARDFLTNYIQVNIGSVSLHANPNITQIVEIIDEWDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGL 398          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A4S2LFQ6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007596 PE=3 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 7.439e-155
Identity = 224/388 (57.73%), Postives = 286/388 (73.71%), Query Frame = 2
Query:  173 RSRSPHNRHSYRSRDNRRDEQTLN----SVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            R RSP  R S     N+R +  +N    +  WN  +L  FEK FY E+P  + R   E++ +R   +MT+ G NI +P+ SF E++L   ++ VI NN W+ PTPIQAQGLPM LSGR++VG+A+TGSGKTAS++IPAIVH+ AQP L RG+GPICL++VPTRELAQQV +VA  F+ + G+R++C YGGA++G Q+R L+ G E+ +ATPGRLID ++S    L R TY+VLDEADRMLDMGFEPQIR I S +R DRQTLMWSATWP+EVQ LA+DFL  YIQVNIGS  LHANPNI QIVEIIDE  K++RL+++++    ++ +VF ETK+K D I Y LR + F VGAMHGDK Q DR+  L  FR   L++LVATDVASRGL
Sbjct:   11 RGRSPARRWSTSGPSNKRGKFDMNMDVPAPKWNLADLPKFEKCFYVEHPATTARPEPEVQAFRTEYKMTLSGPNIPRPVLSFGELNLPDHVLRVIANNGWHGPTPIQAQGLPMGLSGRDVVGIAQTGSGKTASFVIPAIVHILAQPRLLRGEGPICLVLVPTRELAQQVLSVAQQFATAAGLRTMCFYGGASRGPQLRDLQRGGEMCIATPGRLIDFIRSEKKLLSRVTYLVLDEADRMLDMGFEPQIRTIISNIRPDRQTLMWSATWPREVQGLARDFLTNYIQVNIGSVSLHANPNITQIVEIIDEWDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGL 398          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A0X3NYM9 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR125121 PE=4 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 9.348e-155
Identity = 230/388 (59.28%), Postives = 284/388 (73.20%), Query Frame = 2
Query:  173 RSRSPHNRHSYRSRDNRRDEQT----LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            RSRSP  R  +    N+R        L +  W+ +NL  FEK FYRE P VS+R   EI+N+R    MT+ G +I +PIF+F++++L   I+   +   W  PTPIQ+QG PM LSGR++VG+A+TGSGKTA YL+PAIVH+ AQP L R +GPICL++VPTRELAQQV TVA+ FS    +R+VC+YGGA+KG Q R L +GAEI VATPGRLID L+ + TNL R TY+VLDEADRMLDMGFEPQIRKI  QVR DRQT+MWSATWPKEVQ LA+ FL  YIQVNIGS  LHANPNI Q+V++IDE+ K+ RL E++      + +VFAETKKK D + YFLR + FRV AMHGDK+Q +RD  L  FR   + +LVATDVASRGL
Sbjct:   32 RSRSPIRR--WGGPPNKRKHSCNFDDLKAPRWDLENLPRFEKVFYRELPSVSSRPQEEIDNFRAENRMTLSGRDIPRPIFNFNDLELPPHIVGAFQRAGWASPTPIQSQGWPMVLSGRDVVGIAQTGSGKTACYLVPAIVHILAQPRLLRDEGPICLVLVPTRELAQQVITVADQFSAPARLRTVCLYGGASKGPQQRALTHGAEICVATPGRLIDFLKGNATNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQVRPDRQTVMWSATWPKEVQALARSFLKDYIQVNIGSTSLHANPNITQVVDVIDEYDKENRLCELIQSFHGLRCLVFAETKKKTDQVAYFLRRRGFRVAAMHGDKAQRERDATLAAFRTAKITVLVATDVASRGL 417          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 432.565 bits (1111), Expect = 5.310e-149
Identity = 215/414 (51.93%), Postives = 285/414 (68.84%), Query Frame = 2
Query:  116 KNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL-GMFKSVP 1345
            + RD  YG +  +  + + RS  P ++            + L    WN   L  FEKNFY+E+P ++ RS  E+E YRR KE+TVKG +  KP+  F+E      +M VI    W+EPTPIQAQG P+ALSG+++VG+A+TGSGKT +YL+PAIVH+  QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +Y+Q+NIG+ +L AN NI QIV++ ++  KD    RLLE +     +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL G+F + P
Sbjct:    9 RGRDRGYGSSGPR--FGSGRSGPPTSKFGNPG-------ERLRKRHWNLDELPKFEKNFYKEHPDITRRSMQEVEQYRRAKEVTVKGRDCPKPVMKFNEATFPNYVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLGGVFVAGP 413          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 430.254 bits (1105), Expect = 1.816e-145
Identity = 204/360 (56.67%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P ++ RS  E+E YRR KE+TVKG +  KP+  F+E      +M VI    W+EPTPIQAQG P+ALSG+++VG+A+TGSGKT +YL+PAIVH+  QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +Y+Q+NIG+ +L AN NI QIV++ ++  KD    RLLE +     +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   46 WNLDELPKFEKNFYKEHPDITRRSMQEVEQYRRAKEVTVKGRDCPKPVMKFNEATFPNYVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103024726])

HSP 1 Score: 425.246 bits (1092), Expect = 1.446e-143
Identity = 205/361 (56.79%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL----EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+E+P V  R+  E+E YRR KE+TVKG    KP+  F E +    +M VI    W +PTPIQAQG P+ALSG+++VG+A+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +Y+Q+N+G+ +L AN NI QIV++ ++  K+ +LL    EI+S+  N K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   48 WNLDELPKFEKNFYQEHPDVGRRTPQEVEQYRRSKEITVKGRECPKPVMRFHESNFPSYVMDVISKQNWTDPTPIQAQGWPLALSGQDMVGIAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCNDGEKEDKLLRLLEEIMSEKEN-KTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGL 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:103044432])

HSP 1 Score: 307.375 bits (786), Expect = 7.447e-95
Identity = 156/371 (42.05%), Postives = 240/371 (64.69%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFL---GKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK------RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  +D +  +  PFEKNFY E+  +++ + +++   R+   + V G    KP  SF   +   ++M+ IR +++ +PTPIQ QG+P+AL GR+++G+A+TGSGKTA+++ P +VH+  Q  L +GDGPI +IV PTREL QQ+ T    F +  G+RSV VYGG +  +Q + L+ GAEI+V TPGRLID ++   T+L R TY+V DEADRM DMGFE Q+R I S +R DRQTL++SAT+ K++++LA+D L    + +Q +IG     AN ++ Q+VE++  +  DK      RL+E  S      +++F   K   D +   L+ + + +G +HGD  QS+R+ ++  F+ + L +LVATDVA+RGL
Sbjct:  198 LPPIDHSEIDYPPFEKNFYIEHEELNSLTGTQVVELRQKLNLRVSGAAPPKPCTSFAHFNFDEQLMNQIRKSEYTKPTPIQCQGVPIALGGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEQGDGPIAVIVCPTRELCQQIHTECKRFGKVYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHIRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIG----EANEDVTQLVEVL-PNGTDKWVWLTRRLVEFTSSG---SVLIFVTKKANCDELATNLQQEGYSLGLLHGDMDQSERNKVISDFKKKSLPVLVATDVAARGL 560          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:103044432])

HSP 1 Score: 307.375 bits (786), Expect = 7.900e-95
Identity = 156/371 (42.05%), Postives = 240/371 (64.69%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFL---GKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK------RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L  +D +  +  PFEKNFY E+  +++ + +++   R+   + V G    KP  SF   +   ++M+ IR +++ +PTPIQ QG+P+AL GR+++G+A+TGSGKTA+++ P +VH+  Q  L +GDGPI +IV PTREL QQ+ T    F +  G+RSV VYGG +  +Q + L+ GAEI+V TPGRLID ++   T+L R TY+V DEADRM DMGFE Q+R I S +R DRQTL++SAT+ K++++LA+D L    + +Q +IG     AN ++ Q+VE++  +  DK      RL+E  S      +++F   K   D +   L+ + + +G +HGD  QS+R+ ++  F+ + L +LVATDVA+RGL
Sbjct:  204 LPPIDHSEIDYPPFEKNFYIEHEELNSLTGTQVVELRQKLNLRVSGAAPPKPCTSFAHFNFDEQLMNQIRKSEYTKPTPIQCQGVPIALGGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEQGDGPIAVIVCPTRELCQQIHTECKRFGKVYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHIRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIG----EANEDVTQLVEVL-PNGTDKWVWLTRRLVEFTSSG---SVLIFVTKKANCDELATNLQQEGYSLGLLHGDMDQSERNKVISDFKKKSLPVLVATDVAARGL 566          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 297.36 bits (760), Expect = 2.423e-93
Identity = 156/367 (42.51%), Postives = 231/367 (62.94%), Query Frame = 2
Query:  239 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFL---GKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLL--EIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            L S+D +     PF+KNFY E+  +S+  +SE    +      V G    KP  SF       +++++IR +++ +PTPIQ QG+P+ALSGR+++G+A+TGSGKTAS++ P +VH+ AQ  L+ GDGPI LI VPTREL QQ+      F ++  + SV VYGG +  +Q + L+ GAEI+V TPGRLID ++   TNL R TY+V DEADRM DMGFE Q+R I + VR DRQT+++SAT+   V++LA+D L    + +Q +IG     AN ++ Q VEI    A     L   +V    +  +++F   K  ++ +   L  + F+VG +HGD  QS+R+ ++  F+ + + I+VATDVA+RGL
Sbjct:  200 LPSIDHSEIEYEPFDKNFYVEHEEISSLGASEAHELK----AQVSGAAPPKPCSSFGHFGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIG----EANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGL 558          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 301.982 bits (772), Expect = 7.472e-93
Identity = 150/364 (41.21%), Postives = 232/364 (63.74%), Query Frame = 2
Query:  248 VDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYR-RLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSS---ITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVS-KNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            VD +     PF +NFY E P ++  ++ E+  YR  ++ + VKG    KPI ++ +  +S +I++ ++   + +PTPIQAQ +P  +SGR+L+G+A+TGSGKT  +L+P   H+  Q PL  G+GPI +I+ PTRELA Q+      F++ + +R VCVYGG    +QI +L+ GAEIIV TPGR+ID+L ++   +TN  R TY+VLDEADRM DMGFEPQ+ +I    R DRQT+M+SAT+P+ ++ LA+  L K ++V +G + +  + ++EQ V +I+E  K  +LLE++        +IVF + ++ AD +   L    +   ++HG   Q DRD I+  F+     ++VAT VA+RGL
Sbjct:  318 VDHSKIAYEPFRRNFYVEVPELAKMTAEEVSAYRLEMEGVMVKGKGCPKPIKTWVQCGISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCS-DVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGL 680          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.447 bits (646), Expect = 1.395e-78
Identity = 144/351 (41.03%), Postives = 213/351 (60.68%), Query Frame = 2
Query:  341 NYRRLKEMTVK--GDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLR----------------RGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQ----VRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKM-IVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            N+ +  ++ V+  G++    I SF E++L   IMS +   ++  PTP+Q   +P+  + R+L+  A+TGSGKTA++L+P +  + +  P +                R   P+ L++ PTRELA Q+   A  F+    +R   VYGGA+ G+Q+R+L+ G  ++VATPGRL+D+++     L    Y+VLDEADRMLDMGFEPQIR+I  Q     + DRQTLM+SAT+PKE+Q LA+DFL  YI + +G     A+ NI Q V  ++E  K   LL++++    D + +VF ETKK AD +  FL S+ +   ++HGD+SQ DR+  L  FR     ILVAT VA+RGL
Sbjct:   38 NFEKYDDIPVEATGNDCPPHIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVG-SASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGL 387          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 251.136 bits (640), Expect = 8.031e-76
Identity = 140/353 (39.66%), Postives = 201/353 (56.94%), Query Frame = 2
Query:  362 MTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQV--------------------------RQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANP--NIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +T KG  I  PI  + E  L   I  VI    + +PTPIQ Q +P+ L  R+++G+A TGSGKTA++LIP +V +   P + R +    GP  +I+ PTRELAQQ++     F + +GIR+V V GG ++ DQ  +LR G +I++ATPGRLID+L++    L R TYVVLDEADRM+DMGFEP +++I   +                           + RQT+M++AT P  V+RLA+ +L +   V IGS      P   +EQ V I+ E  K K+LLE++S+     +I+F   KK  D++   L    F    +HG K Q  R++ L   +    +ILVATDVA RG+
Sbjct:  308 ITTKGGKIPNPIRLWKESILPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSV---GKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGI 657          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006773.1 (pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gene:ENSPMAG00000006112.1 transcript:ENSPMAT00000006773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.756 bits (517), Expect = 3.221e-62
Identity = 116/274 (42.34%), Postives = 169/274 (61.68%), Query Frame = 2
Query:  245 SVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRR------LKEMTVKGD-NINKPIFSF-DEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQP-PLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQEL 1039
            ++ WN  +  P +KNFY E+P V+      +   R+      + +M  +G  +I  P+ +F D  +   +I+  I    +  P+PIQ+Q  P+ L G +LVG+A+TG+GKT ++L P  +HL  QP P  + +GP  LI+ PTRELA Q+++  + +S   GI SVC+YGG N+ +QI     G +I++ATPGRL DL+ +   ++   TY+VLDEAD MLD+GFEPQI KI   VR DRQT M SATWP  V+RLA+ +L   + V +GS  L
Sbjct:   41 ALKWN--DCPPIKKNFYFESPSVTRMEPWPLLATRKSNNNISVVDMCEEGGRSIPNPVRTFADAFEHFPDILDNICRAGFTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIPREQREGPGMLILTPTRELALQIKSECSKYSYQ-GITSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 310          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 400.593 bits (1028), Expect = 8.781e-136
Identity = 211/418 (50.48%), Postives = 279/418 (66.75%), Query Frame = 2
Query:   92 KRFDRNEYKNR--DDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQ--NLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRL---LEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +++++  YK+R  D R G N D+  Y   R +  + R  +  R N    Q L   +W+ +   L  FEKNFY E+  V +RS SEI  +R+  EMT+ G +I KPI +FDE      +++ ++   +++PT IQ QG PMALSGR++VG+A TGSGKT SY +P IVH+ AQP L  GDGPI L++ PTRELA Q+QT  + F  S  IR+ CVYGG  K  QIR L  G+EI++ATPGRLID+L+   TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA D+L   IQV +GS EL A+ NI QIVE++ +  K  RL   LE  S++   K ++FA TK+  D I  +LR   +   A+HGDK Q +RD++L+ FR     I+VATDVA+RG+
Sbjct:    8 QQYNKTNYKSRGGDFRGGRNSDRNSYN-DRPQGGNYRGGFGGRSNYNQPQELIKPNWDEELPKLPTFEKNFYVEHESVRDRSDSEIAQFRKENEMTISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGI 424          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 262.307 bits (669), Expect = 1.705e-82
Identity = 153/378 (40.48%), Postives = 231/378 (61.11%), Query Frame = 2
Query:  290 FYRENPVVSNRSSSEIENYRRLKEMTVKG--DNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQV-RQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIG-SQELHANPNIEQIVEIIDEHAKDKRLLEIVSK-----NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKSVP*KNGLYDYSFYLVIPNY 1396
            FY ++  +++   S+I+ Y +  E+ V+   D   +P+ SFD + L   I + I  +K+ +PTPIQA   P  LSG+++VGVA TGSGKT ++ +PAI HL      ++  G   L++ PTRELA Q+       +  VG++  CVYGG  K +Q  QL+  ++++VATPGRL+DLLQ    +L +  Y+VLDEADRML+ GFE  I+ I  +     RQTLM++ATWPKEV+ LA  F+   I+V+IG + +L AN  I QIVE++D   K+++LLE++ K       N+K+++FA  KK+A  +   L+   + V A+HGD SQ  R   L  F+    N+L+ATDVA+RGL     +P    + + +F L + +Y
Sbjct:   76 FYVQSEALTSLPQSDIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEI--SKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMND---QKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLK-KSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGL----DIPNVKTVINLTFPLTVEDY 443          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 250.366 bits (638), Expect = 6.829e-77
Identity = 159/457 (34.79%), Postives = 241/457 (52.74%), Query Frame = 2
Query:   71 YQRDRDSKRFDRNEYKNRDDRYGGN----------RDKKYYEASRSR-----SPHNR---HSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVS-------NRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHL----------KAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVR----QDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            + R R    F+R+  K  D   GG+           +  ++  S+ R     + +NR    +Y+S  NR          W +   IP  KN   E  +         + S  + +NY  +  +   G ++ +PI  F    L   +M  I+   + +PTP+Q   +P+   GR+L+  A+TGSGKT  +L P    L          KAQ    R   P  L++ PTRELA Q+   A  F+    +R   VYGGA  G+Q+R++  G +++VATPGRL DLL+    +L    Y+VLDEADRMLDMGFEPQIR I  +      ++RQTLM+SAT+P ++Q LA+DFL  YI +++G +    + NI Q +  +D+  K   LL+++S       ++F ETK+ AD +  FL  + F+  A+HGD++Q++R+  L  F+    +ILVAT VA+RGL
Sbjct:   31 HLRSRGKPSFERSTPKQEDKVTGGDFFRRAGRQTGNNGGFFGFSKERNGGTSANYNRGGSSNYKSSGNR----------WVNGKHIPGPKNAKLEAELFGVHDDPDYHSSGIKFDNYDNIP-VDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVG-RVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGL 475          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 242.662 bits (618), Expect = 4.177e-74
Identity = 132/333 (39.64%), Postives = 198/333 (59.46%), Query Frame = 2
Query:  368 VKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVH-LKAQP-PLRRGDG--------PICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQ----DRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
              G ++ +PI  F    L   ++  I+  ++ +PTP+Q   +P+  +GR+L+  A+TGSGKT  +L P +    K  P P     G        P  +I+ PTRELA Q+   A  F+    +++  VYGG+  G+Q+R++  G +++VATPGRL DLL+    +L    Y+VLDEADRMLDMGFEPQIR I          +RQTLM+SAT+P ++Q LA+DFL  YI +++G +    + NI Q V  ++   K   LL+++S + +   ++F ETK+ AD +  FL  + FR  A+HGD++QS+R+  L  FR     +LVAT VA+RGL
Sbjct:  132 ASGKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVG-RVGSTSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGL 463          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: PRP5 (RNA helicase in the DEAD-box family; necessary for prespliceosome formation, bridges U1 and U2 snRNPs and enables stable U2 snRNP association with intron RNA [Source:SGD;Acc:S000000441])

HSP 1 Score: 245.358 bits (625), Expect = 3.185e-73
Identity = 144/393 (36.64%), Postives = 223/393 (56.74%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYR-RLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNN-KWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD-GPICLIVVPTRELAQQVQTVANDFSQS-VGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQ---SSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVS------------KNPND-----------KMIVFAETKKKADIICYFLRSKQFRVG----AMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGM 1330
            ++ + L PF+KNFY E+  VS+ S  E+E  R  L  + +KG    KP+  + ++ LS + M +I     +   TPIQ+Q LP  +SGR+++G+++TGSGKT SYL+P +  +KAQ PL + + GP+ LI+ PTRELA Q+      F+++   IRSVC  GG+    QI  L+ G EI+VATPGR ID+L      + +  R T+VV+DEADR+ D+GFEPQI +I   VR D+Q +++SAT+P +++  A   L   I + I S+ +  N N++Q   I   H++D++   +V             ++ ND           K I+F  ++     IC F+  K    G    A+H  K   +R   L+ F+ +  +IL+ T+V SRGL +
Sbjct:  206 YSPEELEPFQKNFYIESETVSSMSEMEVEELRLSLDNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGM-VNENVKQKFRIC--HSEDEKFDNLVQLIHERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQN----ICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNV 591          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 414.846 bits (1065), Expect = 2.760e-142
Identity = 200/360 (55.56%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+  +L  FEKNFYRE+PVV  R   E++ YRR K++TV G N+ KP+ +F+E      I S  +   + EPT IQAQG P+AL+GRNLVG+A+TGSGKT S+++P IVH+  QP L+ GDGPI L++ PTRELAQQVQ VA    +   +RS C+YGGA KG QIR+L  G EI +ATPGRLID+L+S  TNL R TY+VLDEADRMLDMGFEPQIR I  Q+R DRQTLMWSATWPKEVQ LA DFL  Y+ + +GS  L AN  I QIV++ ++H K+ +LL+++ +      +K ++F ETK++AD +   LRS  +    +HGDK+Q +RD++L  FR  H  ILVATDVASRGL
Sbjct:   10 WDMNSLQKFEKNFYREHPVVQARGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGL 369          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 320.087 bits (819), Expect = 2.477e-104
Identity = 167/367 (45.50%), Postives = 235/367 (64.03%), Query Frame = 2
Query:  233 QTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQEL-HANPNIEQIVEIIDEHAKDKRLLE--IVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            + L  VD +  +  PF KNFY E+P ++ +S  EI++ R+   + V G    +P  SF       ++M+ IR  ++ +PT IQ Q LP+ALSGR+++G+A+TGSGKTA++L PA+VH+  QP L+ GDGPI LI  PTREL QQ+ T A  F ++  I  V V+GG NK +Q + L+ GAEI+VATPGRLID +++  TNLHR TY+V DEADRM DMGFEPQ+R I + VR DRQTL++SAT+ K+V+ L +D L   ++V IG  EL  AN ++ QIV I +        L   +VS      +++F   K  ++ +   LR   F V  +HGD  Q +R  +L  F+ + + ILVATDVA+RGL
Sbjct:   51 EPLPRVDHSEIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIG--ELGEANEDVTQIVHIFNSMPSKWEWLTQNLVSFASAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGL 415          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 296.59 bits (758), Expect = 1.886e-92
Identity = 149/372 (40.05%), Postives = 236/372 (63.44%), Query Frame = 2
Query:  224 RDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYR-RLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSS---ITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAK-DKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            + ++ L  VD  +    PF K+FY E P ++  +  E + +R  L+ + V+G N  KP+ ++ +  +  +I+ V++ N + +PTPIQAQ +P+ +SGR+++G+A+TGSGKT ++LIP   H+K QPPL R +GPI +++ PTRELA Q+      F +   +R VCVYGG    +QI +L+ GAEIIV TPGR+ID+L ++   +TN  R TY+VLDEADRM DMGFEPQ+ +I   +R DRQT+M+SAT+P++++ LA+  L K I++ +G + +  + ++EQ V +I+E  K  K L  +        ++VF E +  AD +   L  + +   ++HG   Q DRD  +  F+     +++AT VA+RGL
Sbjct:   78 KKKKELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQPPLEREEGPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCS-DVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGL 448          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO39699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G4])

HSP 1 Score: 256.529 bits (654), Expect = 7.206e-81
Identity = 145/346 (41.91%), Postives = 210/346 (60.69%), Query Frame = 2
Query:  335 IENYRRLKEMTVKGDNINKPIFSFDE-IDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLR--RGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTY-----------VVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIV-SKNPNDKMIVFAETKKKADIICYFLRSKQF-RVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            +ENY      TV+   I  P+  F+E  +   EI+  I+   + +P+PIQ Q  P+ +SG +L+G+A+TG+GKT ++L+PA +H+  Q   R  RG GP  L++ PTRELA Q++     +    GIRSVC+YGG ++ DQI  +  G EI++ATPGRL DLL   I ++   TY           +VLDEADRMLDMGFEP+I+KI   +R DRQT+M SATWP  VQR+A  ++   ++V +G  +L+A  N+ Q+VE +D   K +R++E +    P +K+++F   K  AD +   L       V  +HGD+ Q DR+  L  F+     IL+ATDVASRGL
Sbjct:    6 VENYGE----TVQERAIPNPVTKFEEAFEQYPEILEEIKKAGFVKPSPIQCQAWPVVMSGMDLIGIAQTGTGKTLAFLLPAFLHIDGQELAREKRG-GPSVLVLSPTRELALQIEQEVKKYHYR-GIRSVCIYGGGSRKDQIGVVEKGVEIVIATPGRLNDLLMHDILSVRSVTYLVSMSGHNICSIVLDEADRMLDMGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDLNACENVTQLVEEVDGSLKKERVIEFIEGMAPGEKVLIFVGKKVLADDLSSDLMLHGIDGVQCIHGDREQYDREQALDDFKTGLARILIATDVASRGL 345          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 263.077 bits (671), Expect = 6.411e-80
Identity = 141/351 (40.17%), Postives = 213/351 (60.68%), Query Frame = 2
Query:  362 MTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIF-----SQVRQD-------------------RQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANP--NIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            ++ KG  I  PI  + E  +   I+ ++    + +PTPIQ Q +P+ L  R+++GVA TGSGKTA++ IP +V +   P + R +    GP  LI+ PTRELAQQ++     F + +GIR+V V GG ++ DQ  QLR G EI++ATPGRLID+L++    L+R +Y+V+DEADRM+DMGFEP+++KI      S V+ D                   RQT+M++AT P +V+RLA+++L +   V IGS      P   +EQ V +++E  K K+LLE+++K+    +I+F   KK AD++   L    FR   +HG ++Q  R++ L   +G   +ILVATDVA RG+
Sbjct:  338 ISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLGVEIVIATPGRLIDVLENRYLVLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMFTATMPPQVERLAKNYLRRPAVVYIGSV---GKPVERVEQRVYLVNEQQKRKKLLELLNKDLEPPIIIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGI 685          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 420.239 bits (1079), Expect = 7.199e-144
Identity = 202/361 (55.96%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLG 1327
            WN   L  F+KNFY+E+P V++RS  EIE YRR KE+TVKG +  KP+  F+E      +M +I    + +PTPIQ+QG P+ALSG+++VG+A+TGSGKT +YL+PAIVH++ QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+ + TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ +L AN NI QIV++ ++  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGLG
Sbjct:   52 WNLDELPKFQKNFYQEHPDVTHRSPQEIEQYRRSKEVTVKGRDCPKPMIKFNEASFPSYVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLG 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: si:dkey-156n14.5 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101158507])

HSP 1 Score: 423.32 bits (1087), Expect = 1.747e-142
Identity = 204/360 (56.67%), Postives = 263/360 (73.06%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY E+P V + S  E+E +RR KE+T++G    KP+ +F +    + +M V+    + EPT IQ+QG P+ALSG+++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA D+ +S  I+S CVYGGA KG QIR L  G EI +ATPGRLID L++  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +YIQ+NIG+ EL AN NI QIV++  E+ KD +LL+++ +      +K I+F ETKK+ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   48 WNLDELPKFEKNFYIEHPEVQHVSQFEVEEFRRKKEITIRGSGCPKPVTAFHQAHFPQYVMDVLMQQNFKEPTAIQSQGFPVALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAYDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLREYIQINIGALELSANHNILQIVDVCMENEKDNKLLQLMEEIMAEKENKTIIFVETKKRCDDLTRKMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGL 407          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101160075])

HSP 1 Score: 422.165 bits (1084), Expect = 2.204e-142
Identity = 203/360 (56.39%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  FEKNFY+++  V+ RS  E+E YRR K +TVKG     PI  F E      +M VI    W EPTPIQAQG P+ALSG+++VG+A+TGSGKT SYL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +Y+Q+N+G+ +L AN NI QIV++  +  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  F+     IL+ATDVASRGL
Sbjct:   54 WNLDELPKFEKNFYQQHADVARRSPQEVEQYRRTKVITVKGRECPNPITHFHEASFPSYVMEVINKQNWTEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGL 413          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: ENSORLT00000031911.1 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101171584])

HSP 1 Score: 419.468 bits (1077), Expect = 2.982e-141
Identity = 202/360 (56.11%), Postives = 261/360 (72.50%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK---NPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            W+   L  FEKNFY E+  V   S  ++E +RR KE+TV+G    KP+ SF +    + ++ V+    + EPT IQAQG P+ALSGR++VG+A+TGSGKT +YL+PAIVH+  QP L RGDGPICL++ PTRELAQQVQ VA D+ +S  I+S CVYGGA KG QIR L  G EI +ATPGRLID L+S  TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL +Y+Q+NIG+ EL AN NI QIV++  E  KD++L++++ +      +K I+F ETKK+ D +   +R   +    +HGDKSQ +RD++L  FR     +L+ATDVASRGL
Sbjct:   45 WDLDQLPKFEKNFYSEHAEVERMSQFDVEEFRRKKEITVRGSGCPKPLTSFHQAQFPQYVIDVLMQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLDRGDGPICLVLAPTRELAQQVQQVACDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALELSANHNILQIVDVCTESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPVLIATDVASRGL 404          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 418.698 bits (1075), Expect = 6.842e-141
Identity = 201/360 (55.83%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  254 WNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDK---RLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            WN   L  F+KNFY+E+P V++RS  EIE YRR KE+TVKG +  KP+  F+E      +M +I    + +PTPIQ+QG P+ALSG+++VG+A+TGSGKT +YL+PAIVH++ QP L  GDGPICL++ PTRELAQQVQ VA ++ ++  ++S C+YGGA KG QIR L  G EI +ATPGRLID L+ + TNL R TY+VLDEADRMLDMGFEPQIRKI  Q+R DRQTLMWSATWPKEV++LA+DFL  Y+Q+NIG+ +L AN NI QIV++ ++  K+    RLLE +     +K I+F ETK++ D +   +R   +    +HGDKSQ +RD++L  FR     IL+ATDVASRGL
Sbjct:   52 WNLDELPKFQKNFYQEHPDVTHRSPQEIEQYRRSKEVTVKGRDCPKPMIKFNEASFPSYVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGL 411          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 424/441 (96.15%), Postives = 435/441 (98.64%), Query Frame = 2
Query:    2 MPESRKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            MPESRKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSF+EIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDF +SVGIRSVCVYGGANKGDQIRQLR GAEIIVATPGRLIDLL+SSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEI+DE++KDKRLLE+VSK P DKMIVFAETKKKAD+IC FLRSKQFRVGAMHGDKSQSDR+YIL GFRG++LNILVATDVASRGL
Sbjct:    1 MPESRKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGL 441          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 383/443 (86.46%), Postives = 403/443 (90.97%), Query Frame = 2
Query:   14 RKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEAS------RSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGL 1324
            R  QR +  DY N +    Y  D++ K + +  Y   +DRY  NRD+K Y  S      RSRSP N +SYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSF+EIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDF +SVGIRSVCVYGGANKGDQIRQLR GAEIIVATPGRLIDLL+SSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEI+DE++KDKRLLE+VSK P DKMIVFAETKKKAD+IC FLRSKQFRVGAMHGDKSQSDR+YIL GFRG++LNILVATDVASRGL
Sbjct:   11 RNEQRGERWDYRNEK--NDYLSDKNDK-YSQGGY---NDRYSSNRDRKSYNGSSSRHNDRSRSPTNGNSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGL 447          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 378/454 (83.26%), Postives = 395/454 (87.00%), Query Frame = 2
Query:   47 LNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRD--EQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKSVP*KNGLYDYSFYLVIPNYKW 1402
             NS+  + Y R ++ K+++ NE  ++D  Y   R K +YE +   S  NR S    + + +  E   N V+ N QN IPF+KNFY+EN VVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRG                   LVIPNYKW
Sbjct:   71 FNSKNNDDYSRTQN-KKWEFNETNSKDQNYIPIR-KNHYEENIMVS--NRSSAEIENKKWEFIETGSNRVNSNDQNFIPFQKNFYQENRVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRG-------------------LVIPNYKW 501          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 739.569 bits (1908), Expect = 0.000e+0
Identity = 378/454 (83.26%), Postives = 395/454 (87.00%), Query Frame = 2
Query:   47 LNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEASRSRSPHNRHSYRSRDNRRD--EQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKSVP*KNGLYDYSFYLVIPNYKW 1402
             NS+  + Y R ++ K+++ NE  ++D  Y   R K +YE +   S  NR S    + + +  E   N V+ N QN IPF+KNFY+EN VVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRG                   LVIPNYKW
Sbjct:   64 FNSKNNDDYSRTQN-KKWEFNETNSKDQNYIPIR-KNHYEENIMVS--NRSSAEIENKKWEFIETGSNRVNSNDQNFIPFQKNFYQENRVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRG-------------------LVIPNYKW 494          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033907.1 (SMESG000033907.1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 341/422 (80.81%), Postives = 361/422 (85.55%), Query Frame = 2
Query:   14 RKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRDKKYYEAS------RSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYIL 1261
            R  QR +  DY N +    Y  D++ K + +  Y   +DRY  NRD+K Y  S      RSRSP N +SYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSF+EIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDF +SVGIRSVCVYGGANKGDQIRQLR GAEIIVATPGRLIDLL+SSIT    T  ++L                KIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEI+DE++KDKRLLE+VSK P DKMIVFAETKKKAD+IC FLRSKQFRVGAMHGDKSQSDR+YIL
Sbjct:   11 RNEQRGERWDYRNEK--NDYLSDKNDK-YSQGGY---NDRYSSNRDRKSYNGSSSRHNDRSRSPTNGNSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITIF--TELLML----------------KIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYIL 408          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX51.433e-14357.62DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX51.962e-14357.62DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX171.886e-13955.12DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX171.995e-13955.12DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX172.100e-13955.12DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-172.191e-12548.49DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-172.191e-12548.49DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-172.191e-12548.49DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-172.191e-12548.49DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-172.191e-12548.49DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rm621.157e-15157.68gene:FBgn0003261 transcript:FBtr0309319[more]
Rm621.048e-14957.61gene:FBgn0003261 transcript:FBtr0309321[more]
Rm622.334e-14958.50gene:FBgn0003261 transcript:FBtr0309320[more]
Rm623.714e-14958.50gene:FBgn0003261 transcript:FBtr0309322[more]
Rm628.625e-14957.61gene:FBgn0003261 transcript:FBtr0302597[more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx53.060e-15052.73DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx52.531e-14952.87DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx51.091e-14752.87DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
si:dkey-156n14.55.319e-14756.44si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
DDX175.319e-14756.44si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx173.043e-14654.82DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx171.646e-14355.00DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx172.741e-14355.00DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx175.143e-14355.00DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx174.108e-14255.00DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx58.253e-14757.46DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx172.366e-14554.79DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx176.788e-14455.25DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx53.563e-14357.34DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx178.247e-14155.12DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19109|DDX17_DROME3.877e-14657.61ATP-dependent RNA helicase p62 OS=Drosophila melan... [more]
sp|Q4PHU9|DBP2_USTMA8.513e-14457.53ATP-dependent RNA helicase DBP2 OS=Ustilago maydis... [more]
sp|P17844|DDX5_HUMAN6.882e-14357.62Probable ATP-dependent RNA helicase DDX5 OS=Homo s... [more]
sp|Q61656|DDX5_MOUSE1.469e-14257.34Probable ATP-dependent RNA helicase DDX5 OS=Mus mu... [more]
sp|Q4R6M5|DDX5_MACFA6.069e-14257.34Probable ATP-dependent RNA helicase DDX5 OS=Macaca... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A0V72.739e-15859.94Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183TE802.865e-15857.91Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4S2LF315.313e-15857.73Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LFQ67.439e-15557.73Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3NYM99.348e-15559.28Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX55.310e-14951.93probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
DDX51.816e-14556.67probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx51.446e-14356.79probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx427.447e-9542.05DEAD-box helicase 42 [Source:NCBI gene;Acc:1030444... [more]
ddx427.900e-9542.05DEAD-box helicase 42 [Source:NCBI gene;Acc:1030444... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx422.423e-9342.51DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx467.472e-9341.21DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ENSPMAT00000003898.11.395e-7841.03pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx238.031e-7639.66DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ENSPMAT00000006773.13.221e-6242.34pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gen... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP28.781e-13650.48ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP31.705e-8240.48RNA-Dependent ATPase, member of DExD/H-box family;... [more]
DBP16.829e-7734.79Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED14.177e-7439.64ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
PRP53.185e-7336.64RNA helicase in the DEAD-box family; necessary for... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380612.760e-14255.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435572.477e-10445.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428941.886e-9240.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396997.206e-8141.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436026.411e-8040.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX57.199e-14455.96probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
si:dkey-156n14.51.747e-14256.67probable ATP-dependent RNA helicase DDX17 [Source:... [more]
ddx52.204e-14256.39probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ENSORLT00000031911.12.982e-14156.11probable ATP-dependent RNA helicase DDX17 [Source:... [more]
DDX56.842e-14155.83probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033916.10.000e+096.15SMESG000033916.1[more]
SMESG000033908.10.000e+086.46SMESG000033908.1[more]
SMESG000033348.10.000e+083.26SMESG000033348.1[more]
SMESG000033348.10.000e+083.26SMESG000033348.1[more]
SMESG000033907.10.000e+080.81SMESG000033907.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007815 ID=SMED30007815|Name=ATP-dependent RNA helicase DBP2|organism=Schmidtea mediterranea sexual|type=transcript|length=1402bp
TATGCCAGAAAGCAGAAAAAGACAAAGAAGTGATGCAGATGATTATCTTA
ATAGCCGTCCTGCCGAAAAGTATCAAAGAGACAGAGACTCAAAAAGATTT
GATAGAAATGAATATAAGAATCGTGATGATAGATATGGTGGTAATAGAGA
TAAAAAGTACTACGAAGCAAGTAGATCAAGATCCCCTCACAATAGACATT
CATACAGAAGTAGAGATAACAGAAGAGATGAACAAACATTGAATAGTGTC
GATTGGAATAGTCAGAATCTTATTCCATTTGAGAAAAATTTCTATAGAGA
AAATCCAGTGGTTTCAAACAGAAGTTCGTCAGAAATTGAAAATTATCGTC
GATTGAAAGAAATGACCGTGAAAGGAGACAATATCAATAAGCCAATATTT
TCCTTCGACGAAATAGATCTTTCTCGCGAAATCATGTCAGTGATTCGAAA
TAATAAATGGAATGAACCAACGCCAATTCAAGCTCAAGGATTACCAATGG
CGTTGAGTGGAAGAAATTTAGTTGGTGTTGCTAGAACTGGATCTGGAAAA
ACTGCGAGCTATTTGATTCCCGCTATTGTACATTTAAAAGCTCAACCTCC
TTTGAGAAGAGGTGATGGACCGATTTGTTTAATAGTTGTTCCGACTCGTG
AATTAGCTCAACAAGTGCAGACTGTAGCAAATGATTTCAGTCAATCGGTG
GGGATTCGTTCTGTTTGTGTTTATGGAGGAGCAAATAAAGGAGATCAAAT
TAGACAATTGAGATATGGAGCAGAGATCATCGTTGCCACTCCGGGAAGAT
TGATAGATTTATTGCAATCATCAATCACAAATCTTCACAGAACTACTTAT
GTTGTACTTGATGAAGCTGACCGAATGTTAGATATGGGATTTGAACCTCA
AATCAGAAAAATATTCAGCCAAGTAAGACAGGATCGACAAACTCTGATGT
GGTCAGCTACTTGGCCAAAAGAAGTGCAGAGATTAGCTCAAGATTTCCTC
GGTAAATATATTCAAGTCAATATAGGATCACAGGAGTTGCATGCAAATCC
AAATATTGAACAGATTGTTGAGATTATTGATGAGCATGCAAAAGATAAAC
GATTGTTAGAAATTGTAAGCAAAAACCCAAATGACAAAATGATTGTGTTC
GCAGAGACGAAGAAGAAAGCTGATATTATTTGTTATTTCCTTCGTTCAAA
ACAGTTCAGAGTTGGTGCAATGCATGGAGATAAGTCACAGAGCGACAGAG
ATTATATATTGAAAGGATTTAGAGGTCAACATTTGAATATTTTAGTAGCT
ACTGATGTTGCAAGCAGAGGACTAGGTATGTTTAAATCCGTTCCATAAAA
GAATGGTCTTTATGACTATTCCTTTTATTTAGTGATTCCGAATTACAAAT
GG
back to top

protein sequence of SMED30007815-orf-1

>SMED30007815-orf-1 ID=SMED30007815-orf-1|Name=SMED30007815-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MPESRKRQRSDADDYLNSRPAEKYQRDRDSKRFDRNEYKNRDDRYGGNRD
KKYYEASRSRSPHNRHSYRSRDNRRDEQTLNSVDWNSQNLIPFEKNFYRE
NPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFDEIDLSREIMSVIRN
NKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPP
LRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQI
RQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQ
IRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANP
NIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSK
QFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLGMFKSVP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0008186RNA-dependent ATPase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR001650Helicase_C
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
GO:0071042nuclear polyadenylation-dependent mRNA catabolic process
GO:1990120messenger ribonucleoprotein complex assembly
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0006364rRNA processing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 32..235
e-value: 1.5E-65
score: 233.8
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 44..219
score: 31.716
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 244..321
e-value: 3.3E-14
score: 53.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 231..328
score: 12.033
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 37..208
e-value: 5.5E-49
score: 166.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 227..323
e-value: 3.1E-25
score: 90.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..226
e-value: 7.2E-85
score: 285.9
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 2..322
NoneNo IPR availablePANTHERPTHR24031:SF683coord: 2..322
NoneNo IPR availableCDDcd17966DEADc_DDX5_DDX17coord: 24..220
e-value: 1.14077E-127
score: 360.916
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 232..321
e-value: 2.29655E-27
score: 102.2
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 165..173
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 13..41
score: 10.865
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..221
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 229..321