Immunoglobulin-like domain-containing protein

Overview
NameImmunoglobulin-like domain-containing protein
Smed IDSMED30007804
Length (bp)1426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Immunoglobulin-like domain-containing protein (SMED30007804) t-SNE clustered cells

Violin plots show distribution of expression levels for Immunoglobulin-like domain-containing protein (SMED30007804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Immunoglobulin-like domain-containing protein (SMED30007804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Immunoglobulin-like domain-containing protein (SMED30007804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007804SMESG000010356.1 dd_Smed_v4_1827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007804SMESG000010356.1 dd_Smed_v4_1827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007804SMESG000010356.1 Contig39709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007804SMESG000010356.1 Contig39709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Match: NPTN (neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867])

HSP 1 Score: 60.8474 bits (146), Expect = 1.272e-9
Identity = 59/191 (30.89%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K        +E P    +  ++ N+  D+  LR RN
Sbjct:   97 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRK------RPDEVPDAGPMKTNSTNNHKDK-NLRQRN 276          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Match: NPTN (neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867])

HSP 1 Score: 59.6918 bits (143), Expect = 2.873e-9
Identity = 58/191 (30.37%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:   97 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 280          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Match: NPTN (neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867])

HSP 1 Score: 60.077 bits (144), Expect = 4.227e-9
Identity = 59/191 (30.89%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K        +E P    +  ++ N+  D+  LR RN
Sbjct:  213 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRK------RPDEVPDAGPMKTNSTNNHKDK-NLRQRN 392          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Match: NPTN (neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867])

HSP 1 Score: 58.9214 bits (141), Expect = 9.019e-9
Identity = 58/191 (30.37%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:  213 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 396          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Match: NPTN (neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867])

HSP 1 Score: 57.7658 bits (138), Expect = 1.590e-8
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPF 747
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF
Sbjct:  176 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPF 306          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Zebrafish
Match: nptna (neuroplastin a [Source:ZFIN;Acc:ZDB-GENE-030804-7])

HSP 1 Score: 48.521 bits (114), Expect = 7.700e-6
Identity = 53/195 (27.18%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNN--YRRARSNNVTKF--------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            AGEY      D     NAT  I + P +   + S+   EG R  + C    +P+        ++  RK++N        N+  +F         ++ + +    +D G Y+C A N   + S    LRV+  LAPLWP +G++ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:   91 AGEYMCVYTFDSAPQANATIEIKAGPEITTHKHSENKNEGERAILFCKSVGYPYP-------QWSWRKIDNGASMEMMDNSSGRFFIISKDGYTELSIINLDINSDPGEYECNATNFISSTSKKWILRVRSHLAPLWPLLGVLAEIIILVLIIVIYEKRKKPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 275          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Zebrafish
Match: nptnb (neuroplastin b [Source:ZFIN;Acc:ZDB-GENE-040426-1821])

HSP 1 Score: 47.3654 bits (111), Expect = 9.344e-6
Identity = 54/192 (28.12%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKV-----NNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY          + NA+  + + P +   + S+   EG    + C   G+ HP       W +   R       N+  R    N   F ++ + D   + D G Y C A N  G  +    LRV+  LAPLWPF+G++ E+IIL+ +I+ YE++K  ++  E +E  T  ++  ++ N+  D+  +R RN
Sbjct:   10 SGEYMCVYTFKSAPNANASIEVKACPEIIGHKRSENKKEGENATLYCKSAGYPHPV----WTWRKKVGRDSYMDIDNSTGRFFIVNRENFTELSILDLDIRTDPGEYFCNASNIIGFTNSSTILRVRSHLAPLWPFLGVLAEIIILVVIIVVYEKRKKPDEVLEDDEPVT--TMKTNSTNNHKDK-NVRQRN 194          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Mouse
Match: Nptn (neuroplastin [Source:MGI Symbol;Acc:MGI:108077])

HSP 1 Score: 51.6026 bits (122), Expect = 7.629e-7
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF--------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    + +W     +K N      SN+  +F         ++ + +     D G Y+C A N  G+ SV   LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K        +E P    +  ++ N+  D+  LR RN
Sbjct:   96 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHP----EWIWR----KKENGVFEEISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRK------RPDEVPDAGPMKTNSTNNHKDK-NLRQRN 275          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Mouse
Match: Nptn (neuroplastin [Source:MGI Symbol;Acc:MGI:108077])

HSP 1 Score: 50.447 bits (119), Expect = 1.799e-6
Identity = 56/195 (28.72%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF--------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    + +W     +K N      SN+  +F         ++ + +     D G Y+C A N  G+ SV   LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:   96 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHP----EWIWR----KKENGVFEEISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 279          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Mouse
Match: Nptn (neuroplastin [Source:MGI Symbol;Acc:MGI:108077])

HSP 1 Score: 50.447 bits (119), Expect = 1.975e-6
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF--------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    + +W     +K N      SN+  +F         ++ + +     D G Y+C A N  G+ SV   LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K
Sbjct:   96 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHP----EWIWR----KKENGVFEEISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRK 247          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Mouse
Match: Nptn (neuroplastin [Source:MGI Symbol;Acc:MGI:108077])

HSP 1 Score: 50.0618 bits (118), Expect = 4.518e-6
Identity = 56/195 (28.72%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF--------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    + +W     +K N      SN+  +F         ++ + +     D G Y+C A N  G+ SV   LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:  212 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHP----EWIWR----KKENGVFEEISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 395          
BLAST of Immunoglobulin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y639|NPTN_HUMAN (Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 4.331e-8
Identity = 58/191 (30.37%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVW----NEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY            NAT  + + P +   + S+   EG    + C   G+ HP    D +W    N  P   VN   R    N   + ++ + +     D G Y+C A N  G+ SV+  LRV+  LAPLWPF+GI+ E+IIL+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:  213 SGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHP----DWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 396          
BLAST of Immunoglobulin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P26453|BASI_RAT (Basigin OS=Rattus norvegicus OX=10116 GN=Bsg PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 8.025e-7
Identity = 53/193 (27.46%), Postives = 100/193 (51.81%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC-TGFSHPFELHDLVW---NEFPTRKVNNYRRARSNNV----TKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +GEY+   + +     N   N+  PP ++  ++S+ + EG  ++++C +  SHP  + + VW   ++   + ++N   A S  V     +  ++I+ D     D G Y C A N  G+    + LRV+ +LA LWPF+GIV EV++L+ +I  YE+++  ++  + E++P    L     +    +  +R RN
Sbjct:  198 SGEYSCIFLPEPVGRGNI--NVEGPPRIKVGKKSEHASEGEFVKLICKSEASHP-PVDEWVWFKTSDTGDQTISNGTEANSKYVIISTPELSELIISDLDMNVDPGTYVCNATNSQGSARETISLRVRSRLAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLD-EDDPGAAPLKGSGSHLNDKDKNVRQRN 386          
BLAST of Immunoglobulin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28740|BASI_RABIT (Basigin OS=Oryctolagus cuniculus OX=9986 GN=BSG PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.544e-6
Identity = 45/154 (29.22%), Postives = 83/154 (53.90%), Query Frame = 1
Query:  364 GEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVW---NEFPTRKVNNYRRAR--SNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            G+Y+   +  D  +  AT  +  PP ++  ++S+ + EG  + +LC   S PF +   VW    +   + + N  ++R   ++     ++ + D    +D G Y C   +  G D+ ++ LRV+ +LA LWPF+GIV EV++L+ VI  YE+++
Sbjct:   83 GKYSCLFLPKD--TGEATLTVDGPPRIKAVKKSEHANEGDSVTLLCKSESFPF-VTAWVWYKVADSGDQVIQNGSQSRFFISHSEAQSELHIKDLDLTSDPGEYACNGTSLQGTDAAVVTLRVRSRLAALWPFLGIVAEVLVLVTVIFIYEKRR 233          
BLAST of Immunoglobulin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99PA3|BASI_CRIGR (Basigin (Fragment) OS=Cricetulus griseus OX=10029 GN=BSG PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 3.342e-6
Identity = 48/172 (27.91%), Postives = 89/172 (51.74%), Query Frame = 1
Query:  424 IFSPPFLQEFQESKRSVEGGRIEVLC-TGFSHPFELHDLVWNEFPT-----RKVNNYRRARSNNVTKFD--DVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            +  PP ++  ++S+ S EG  + ++C +  SHP       W+ F T     + + N   ++   ++  D  ++ + +    +D G Y C A N  G+   IM LRV+ +LA LWPF+GIV EV++L+ +I  YE+++  ++  + E++P    L     +    +  +R RN
Sbjct:   80 VEGPPRIKVGKKSEHSSEGENVRLICKSESSHPPVTE---WSWFKTSDSGDQLITNSSESKYVVISTADRSELTISNLDINSDPGTYMCNATNTQGSVQEIMTLRVRSRLAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLD-EDDPGAAPLKGSGHHMNDKDKNVRQRN 247          
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Match: A0A0X3P0K3 (Basigin OS=Schistocephalus solidus OX=70667 GN=BASI PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.494e-10
Identity = 80/274 (29.20%), Postives = 129/274 (47.08%), Query Frame = 1
Query:  127 KSKYVDMMKFDKLVVND-TELILTFNFQALNNLKEDKTFYYFNGKEIDFSK--RKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHP-------FELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNP 918
            +++ +  + F+K VV+  T + +TF       +K+ K  + FN   ID     R  V Y   E   K    L+ +   +   GE+ +++    G+ IN T  + SPP +  F+E+ R+ EG  ++ +C   S P       F+L D        + VN    +  ++     D +++ ++ K+D G Y C      G DS    ++VK +LA LWPFIGI+ E+IILL  II YER K        E+ P    LL     S+++ GG    +P
Sbjct:   33 RTEKIGQVHFEKKVVDSKTPINMTFVIPGSREIKKIK--WRFNDGPIDVDNDGRPPVHYLLEENASKITVTLVLEAPRQHFIGEWLMELKDTGGNIINQTCQLTSPPLVHRFEETFRATEGYELKAVCRSASMPLPSSARWFKLDD----SLNLQPVN----SAPDSYEIPGDTLLFAEVHKSDTGIYFCNVTGIGGTDSAPAYIKVKSRLAALWPFIGILAELIILLLTIIIYERHKATKDKKAAEDFP----LLG----SQVNAGGDAKASP 288          
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Match: A0A0X3PCB3 (Basigin OS=Schistocephalus solidus OX=70667 GN=BASI PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.549e-10
Identity = 80/274 (29.20%), Postives = 129/274 (47.08%), Query Frame = 1
Query:  127 KSKYVDMMKFDKLVVND-TELILTFNFQALNNLKEDKTFYYFNGKEIDFSK--RKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHP-------FELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNP 918
            +++ +  + F+K VV+  T + +TF       +K+ K  + FN   ID     R  V Y   E   K    L+ +   +   GE+ +++    G+ IN T  + SPP +  F+E+ R+ EG  ++ +C   S P       F+L D        + VN    +  ++     D +++ ++ K+D G Y C      G DS    ++VK +LA LWPFIGI+ E+IILL  II YER K        E+ P    LL     S+++ GG    +P
Sbjct:   33 RTEKIGQVHFEKKVVDSKTPINMTFVIPGSREIKKIK--WRFNDGPIDVDNDGRPPVHYLLEENASKITVTLVLEAPRQHFIGEWLMELKDTGGNIINQTCQLTSPPLVHRFEETFRATEGYELKAVCRSASMPLPSSARWFKLDD----SLNLQPVN----SAPDSYEIPGDTLLFAEVHKSDTGIYFCNVTGIGGTDSAPAYIKVKSRLAALWPFIGILAELIILLLTIIIYERHKATKDKKAAEDFP----LLG----SQVNAGGDAKASP 288          
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Match: A0A183MEE9 (Ig-like domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.897e-10
Identity = 63/209 (30.14%), Postives = 102/209 (48.80%), Query Frame = 1
Query:  280 KDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCT--GFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF------------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYE-----RKKFINKAAEMEENPT 849
            +D+ YS+ +        L  K  T ++AG + L + A D S       I S P ++    + R  EG  + VLC   GF  P   + +VW     R + N   A  N +               D ++ W   S A  G+Y C A +  G+DS+++++R+K KLAPLWPFIGI+ E+++L  +I+ YE     R++   +   +++NPT
Sbjct:   75 QDIYYSTEKVSSGFTVTLHIKAPTSRVAGTWILTVNAKDNSKHVGFCYISSQPVIRSRFGAVRGHEGNPLSVLCEVDGFPEP---NQVVWR----RVIENEDDATKNRLVSVSNAMFKPHESTKDAIMEWTDASDA-TGFYMCTATSTLGSDSLLLEVRIKSKLAPLWPFIGIIAELVVLGIIILIYERTQAKRRREDERTTLLKQNPT 275          
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Match: A0A3P8AMN8 (Ig-like domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14424 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.227e-10
Identity = 63/209 (30.14%), Postives = 102/209 (48.80%), Query Frame = 1
Query:  280 KDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCT--GFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF------------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYE-----RKKFINKAAEMEENPT 849
            +D+ YS+ +        L  K  T ++AG + L + A D S       I S P ++    + R  EG  + VLC   GF  P   + +VW     R + N   A  N +               D ++ W   S A  G+Y C A +  G+DS+++++R+K KLAPLWPFIGI+ E+++L  +I+ YE     R++   +   +++NPT
Sbjct:   75 QDIYYSTEKVSSGFTVTLHIKAPTSRVAGTWILTVNAKDNSKHVGFCYISSQPVIRSRFGAVRGHEGNPLSVLCEVDGFPEP---NQVVWR----RVIENEDDATKNRLVSVSNAMFKPHESTKDAIMEWTDASDA-TGFYMCTATSTLGSDSLLLEVRIKSKLAPLWPFIGIIAELVVLGIIILIYERTQAKRRREDERTTLLKQNPT 275          
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Match: B5B7R3 (Ig-like domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.459e-9
Identity = 60/213 (28.17%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  259 EIDFSKRKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKF------------DDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYE-----RKKFINKAAEMEENP 846
            +I  S  +D+ YS+ E        L  K  T ++AG +TL +     +       + SPP ++    + R  EG  + VLC     P E  ++ W     R V N   +  N +               + ++ W   SK+  G+Y C A++  G+D++++++R+K KLAPLWPFIGI++E+++L  +I+ YE     R++   +A  +++NP
Sbjct:   80 KIGDSDSQDIYYSTEEASSGVTVTLHIKMPTSRVAGTWTLTVNTKTNTKHVGLCYVSSPPVIRSRFGAVRGHEGSPLSVLCEVDGFP-EADEVSWQ----RLVENDDESNKNKLVPVTNAVFKQHGKTKNGIMEWSDASKS-TGFYLCTARSSLGSDNLLLEVRIKSKLAPLWPFIGIIVELLVLGIIILIYERTQAKRRRDEERATLIKQNP 286          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Match: nptna (neuroplastin [Source:NCBI gene;Acc:103021510])

HSP 1 Score: 54.299 bits (129), Expect = 1.486e-7
Identity = 53/191 (27.75%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKV----NNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            AGEY      +     NA+  + S P +   + S+   EG R  + C   G+ HP       W +          N+  R   +N   + ++ + +   ++D G Y+C A N  GN ++   LRV+  LAPLWP +G++ E+I+L+ +I+ YE++K      + +E P    +  ++ N+  D+  LR RN
Sbjct:  209 AGEYMCVYTFELAPLANASIEVKSAPDITGHKRSENKNEGERAVLYCKSVGYPHPL----WTWRKLGEGASFDIDNSSGRFFISNKDNYTELSIINLDIESDPGEYECSANNMIGNSTMTSVLRVRSHLAPLWPLLGVLAEIIVLVLIIVIYEKRK------KPDEVPDAGPMKTNSTNNHKDK-NLRQRN 388          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Match: nptna (neuroplastin [Source:NCBI gene;Acc:103021510])

HSP 1 Score: 53.1434 bits (126), Expect = 1.604e-7
Identity = 52/191 (27.23%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKV----NNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            AGEY      +     NA+  + S P +   + S+   EG R  + C   G+ HP       W +          N+  R   +N   + ++ + +   ++D G Y+C A N  GN ++   LRV+  LAPLWP +G++ E+I+L+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:   74 AGEYMCVYTFELAPLANASIEVKSAPDITGHKRSENKNEGERAVLYCKSVGYPHPL----WTWRKLGEGASFDIDNSSGRFFISNKDNYTELSIINLDIESDPGEYECSANNMIGNSTMTSVLRVRSHLAPLWPLLGVLAEIIVLVLIIVIYEKRKKPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 257          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Match: bsg (basigin (Ok blood group) [Source:NCBI gene;Acc:103043475])

HSP 1 Score: 53.9138 bits (128), Expect = 1.700e-7
Identity = 50/173 (28.90%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  358 IAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNV----------TKFDDVIVWDKLS-KADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK---FINKAAEM 834
            ++G+YT   +++  +  +    +  PP +  +++S+ S E  +  ++C    +P+ + D  W +    + +N RR   + V          T  +  +  D L    D G Y+C  KN  G +S  + LRV+ +LA LWPF+GIV EVIIL+ +I  YE+++    IN   +M
Sbjct:  204 VSGKYTCVFMSEPEAKHDI--EVMVPPHVSPYKQSENSNEKDKAALVCVNHGYPY-IKDWEWYKL---EESNGRRLIVSGVNGTGKYVVKNTDHNSTLTIDDLDINGDMGTYECLGKNDLGENSGKVNLRVRSRLAALWPFLGIVAEVIILVTIIFIYEKRRKPDEINDGVQM 370          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Match: bsg (basigin (Ok blood group) [Source:NCBI gene;Acc:103043475])

HSP 1 Score: 53.1434 bits (126), Expect = 1.840e-7
Identity = 47/162 (29.01%), Postives = 84/162 (51.85%), Query Frame = 1
Query:  358 IAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNV----------TKFDDVIVWDKLS-KADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            ++G+YT   +++  +  +    +  PP +  +++S+ S E  +  ++C    +P+ + D  W +    + +N RR   + V          T  +  +  D L    D G Y+C  KN  G +S  + LRV+ +LA LWPF+GIV EVIIL+ +I  YE+++
Sbjct:   87 VSGKYTCVFMSEPEAKHDI--EVMVPPHVSPYKQSENSNEKDKAALVCVNHGYPY-IKDWEWYKL---EESNGRRLIVSGVNGTGKYVVKNTDHNSTLTIDDLDINGDMGTYECLGKNDLGENSGKVNLRVRSRLAALWPFLGIVAEVIILVTIIFIYEKRR 242          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Match: nptna (neuroplastin [Source:NCBI gene;Acc:103021510])

HSP 1 Score: 53.1434 bits (126), Expect = 1.887e-7
Identity = 52/191 (27.23%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKV----NNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRN 915
            AGEY      +     NA+  + S P +   + S+   EG R  + C   G+ HP       W +          N+  R   +N   + ++ + +   ++D G Y+C A N  GN ++   LRV+  LAPLWP +G++ E+I+L+ +I+ YE++K  ++  + +E      +  ++ N+  D+  LR RN
Sbjct:   93 AGEYMCVYTFELAPLANASIEVKSAPDITGHKRSENKNEGERAVLYCKSVGYPHPL----WTWRKLGEGASFDIDNSSGRFFISNKDNYTELSIINLDIESDPGEYECSANNMIGNSTMTSVLRVRSHLAPLWPLLGVLAEIIVLVLIIVIYEKRKKPDEVPDDDE--PAGPMKTNSTNNHKDK-NLRQRN 276          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Match: nptna (neuroplastin [Source:NCBI gene;Acc:101170837])

HSP 1 Score: 53.9138 bits (128), Expect = 9.795e-8
Identity = 49/152 (32.24%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCT--GFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            AG Y      D+    NAT  I S P +   + S+   EG R  + C   G+ HP      V N       N+  R   N+   + ++ + +    AD G Y C A N  G++     LRV+  LAPLWP +G++ E+IIL+ +I+ YE++K
Sbjct:   76 AGVYVCVYTFDNAPPANATIEIKSVPVITGHKRSENKNEGQRAVLHCKSLGYPHPIWTWHKVDNGGFKDIDNSTGRFFINSRDNYTELHIVNLDINADPGVYACNATNVIGSNKETSVLRVRSHLAPLWPLLGVLAEIIILIVIIVVYEKRK 227          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Match: nptna (neuroplastin [Source:NCBI gene;Acc:101170837])

HSP 1 Score: 53.5286 bits (127), Expect = 1.249e-7
Identity = 49/152 (32.24%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCT--GFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            AG Y      D+    NAT  I S P +   + S+   EG R  + C   G+ HP      V N       N+  R   N+   + ++ + +    AD G Y C A N  G++     LRV+  LAPLWP +G++ E+IIL+ +I+ YE++K
Sbjct:   99 AGVYVCVYTFDNAPPANATIEIKSVPVITGHKRSENKNEGQRAVLHCKSLGYPHPIWTWHKVDNGGFKDIDNSTGRFFINSRDNYTELHIVNLDINADPGVYACNATNVIGSNKETSVLRVRSHLAPLWPLLGVLAEIIILIVIIVVYEKRK 250          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Match: nptna (neuroplastin [Source:NCBI gene;Acc:101170837])

HSP 1 Score: 53.9138 bits (128), Expect = 1.287e-7
Identity = 49/152 (32.24%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCT--GFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            AG Y      D+    NAT  I S P +   + S+   EG R  + C   G+ HP      V N       N+  R   N+   + ++ + +    AD G Y C A N  G++     LRV+  LAPLWP +G++ E+IIL+ +I+ YE++K
Sbjct:   99 AGVYVCVYTFDNAPPANATIEIKSVPVITGHKRSENKNEGQRAVLHCKSLGYPHPIWTWHKVDNGGFKDIDNSTGRFFINSRDNYTELHIVNLDINADPGVYACNATNVIGSNKETSVLRVRSHLAPLWPLLGVLAEIIILIVIIVVYEKRK 250          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 48.1358 bits (113), Expect = 7.479e-6
Identity = 58/222 (26.13%), Postives = 101/222 (45.50%), Query Frame = 1
Query:  166 VVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYT--LKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVW---NEFPTRKVNNYRRARSN-NVTKFDDVIVWDKLS-KADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKK 810
            VVN T   L+ N  +  +L+   +F+  NGK ID SK    +  ++                +KI+   T   + + +    +     + + P +  ++ S+   E  +  + C G  +P    D VW    +     ++N    R     T    V+  + L+ + D G Y C   N+ G ++  + LRV+ +LA LWPF+GIV EVIIL+ +I  YE+++
Sbjct:   31 VVNQTSASLSCNLTS-TSLQSSGSFWTHNGKLIDGSKSASATNYAVH-------------RLDKISHAQTGMYECVFETEPQVKDVIEVKNAPHVSAYKHSEHGSENDKGVMTCVGHGYPLPT-DWVWFKQEDGEQTLISNGTSDRYEIKSTPNKTVLTINDLNIETDIGNYICAGTNEVGTNTDKIYLRVRSRLAALWPFLGIVAEVIILVTIIFIYEKRR 237          
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Match: nptnb (neuroplastin [Source:NCBI gene;Acc:101160640])

HSP 1 Score: 48.9062 bits (115), Expect = 8.222e-6
Identity = 52/188 (27.66%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLC--TGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNP 918
            +G Y      D   + NAT  + + P +   + S+   EG    + C   G+ HP  L   V         N   R        + ++ + +     D G Y+C A N+ GN +    LRV+  LAPLWPF+G++ E+IIL+ +I+ YE++K  +   + +E      +  ++ N+  D+  +R RNP
Sbjct:  209 SGMYMCVYTFDMAPNGNATIEVKARPEVISHKRSENKNEGENATLYCKSVGYPHPTWLWQKVDGALYKDIDNTTGRFFITTRDNYTELNILNLDITTDPGLYQCNATNRVGNTTKETILRVRSHLAPLWPFLGVLAEIIILVVIIVVYEKRKKPDDFVDDDE--PAGPMKTNSTNNHKDK-NIRQRNP 393          
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010356.1 (SMESG000010356.1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 300/300 (100.00%), Postives = 300/300 (100.00%), Query Frame = 1
Query:   25 MNFKIFLLISFQLICTCFAYLNLTVENIVLPTKIKSKYVDMMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD 924
            MNFKIFLLISFQLICTCFAYLNLTVENIVLPTKIKSKYVDMMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGKGKKKFNLIFKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD
Sbjct:    1 MNFKIFLLISFQLICTCFAYLNLTVENIVLPTKIKSKYVDMMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGKGKKKFNLIFKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD 300          
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010356.1 (SMESG000010356.1)

HSP 1 Score: 471.47 bits (1212), Expect = 5.077e-167
Identity = 260/260 (100.00%), Postives = 260/260 (100.00%), Query Frame = 1
Query:  145 MMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGXXXXXXXXXXXXXTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD 924
            MMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGKGKKKFNLIFKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD
Sbjct:    1 MMKFDKLVVNDTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGKGKKKFNLIFKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD 260          
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000042663.1 (SMESG000042663.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.595e-7
Identity = 37/147 (25.17%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  361 AGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWN-----EFPTRKVN-----------NYRRA--RSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPF 747
             G Y ++I   +   ++   +++S P + +F + K  +EG  + + C   ++P    ++ W      E+P +  N           N R       +  K +D +   KL K D G+YKC   +  G DS ++++ VKD+ A L+PF
Sbjct:  125 TGVYKMEITIRN-EKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYP-NATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPF 269          
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000039120.1 (SMESG000039120.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.020e-6
Identity = 53/188 (28.19%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  364 GEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAE-----MEENPTRQSLLADTKNSEIDEGGLRHR 912
            GEY  +     G+       I   P  ++   S R+ E   I + C  + +P     +VW    +  +      +SN        +V    ++AD G Y C  +N  G++     +RVK + A LWPFIGIV++VIIL  +II YE +K  +K  E     + ++  +Q ++  TK+S++ +  +R R
Sbjct:  207 GEYNCQCNVLTGAVKELKVPITVLPIFEDHVTSVRTTENQTITLNCRAWGYPEITEPIVWRFQNSSTLRKGIEVKSNKSMPGYSQLVIPMATQADRGVYTCHVENAVGSNVAGTMVRVKGRYAALWPFIGIVVQVIILAVIIIVYEWRKS-HKTQEDNSKFIYDSKNQQDVVVATKSSDVTD--VRQR 391          
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000039120.1 (SMESG000039120.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 53/188 (28.19%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  364 GEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFXXXXXXXXXXXXXXXFYERKKFINKAAE-----MEENPTRQSLLADTKNSEIDEGGLRHR 912
            GEY  +     G+       I   P  ++   S R+ E   I + C  + +P     +VW    +  +      +SN        +V    ++AD G Y C  +N  G++     +RVK + A LWPFIGIV++VIIL  +II YE +K  +K  E     + ++  +Q ++  TK+S++ +  +R R
Sbjct:  211 GEYNCQCNVLTGAVKELKVPITVLPIFEDHVTSVRTTENQTITLNCRAWGYPEITEPIVWRFQNSSTLRKGIEVKSNKSMPGYSQLVIPMATQADRGVYTCHVENAVGSNVAGTMVRVKGRYAALWPFIGIVVQVIILAVIIIVYEWRKS-HKTQEDNSKFIYDSKNQQDVVVATKSSDVTD--VRQR 395          
The following BLAST results are available for this feature:
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPTN1.272e-930.89neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867][more]
NPTN2.873e-930.37neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867][more]
NPTN4.227e-930.89neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867][more]
NPTN9.019e-930.37neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867][more]
NPTN1.590e-830.37neuroplastin [Source:HGNC Symbol;Acc:HGNC:17867][more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nptna7.700e-627.18neuroplastin a [Source:ZFIN;Acc:ZDB-GENE-030804-7][more]
nptnb9.344e-628.13neuroplastin b [Source:ZFIN;Acc:ZDB-GENE-040426-18... [more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nptn7.629e-729.23neuroplastin [Source:MGI Symbol;Acc:MGI:108077][more]
Nptn1.799e-628.72neuroplastin [Source:MGI Symbol;Acc:MGI:108077][more]
Nptn1.975e-630.63neuroplastin [Source:MGI Symbol;Acc:MGI:108077][more]
Nptn4.518e-628.72neuroplastin [Source:MGI Symbol;Acc:MGI:108077][more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9Y639|NPTN_HUMAN4.331e-830.37Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 ... [more]
sp|P26453|BASI_RAT8.025e-727.46Basigin OS=Rattus norvegicus OX=10116 GN=Bsg PE=1 ... [more]
sp|Q28740|BASI_RABIT1.544e-629.22Basigin OS=Oryctolagus cuniculus OX=9986 GN=BSG PE... [more]
sp|Q99PA3|BASI_CRIGR3.342e-627.91Basigin (Fragment) OS=Cricetulus griseus OX=10029 ... [more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P0K31.494e-1029.20Basigin OS=Schistocephalus solidus OX=70667 GN=BAS... [more]
A0A0X3PCB31.549e-1029.20Basigin OS=Schistocephalus solidus OX=70667 GN=BAS... [more]
A0A183MEE94.897e-1030.14Ig-like domain-containing protein OS=Schistosoma m... [more]
A0A3P8AMN85.227e-1030.14Ig-like domain-containing protein OS=Schistosoma m... [more]
B5B7R31.459e-928.17Ig-like domain-containing protein OS=Schistosoma j... [more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nptna1.486e-727.75neuroplastin [Source:NCBI gene;Acc:103021510][more]
nptna1.604e-727.23neuroplastin [Source:NCBI gene;Acc:103021510][more]
bsg1.700e-728.90basigin (Ok blood group) [Source:NCBI gene;Acc:103... [more]
bsg1.840e-729.01basigin (Ok blood group) [Source:NCBI gene;Acc:103... [more]
nptna1.887e-727.23neuroplastin [Source:NCBI gene;Acc:103021510][more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nptna9.795e-832.24neuroplastin [Source:NCBI gene;Acc:101170837][more]
nptna1.249e-732.24neuroplastin [Source:NCBI gene;Acc:101170837][more]
nptna1.287e-732.24neuroplastin [Source:NCBI gene;Acc:101170837][more]
RNF1267.479e-626.13ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
nptnb8.222e-627.66neuroplastin [Source:NCBI gene;Acc:101160640][more]
back to top
BLAST of Immunoglobulin-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010356.10.000e+0100.00SMESG000010356.1[more]
SMESG000010356.15.077e-167100.00SMESG000010356.1[more]
SMESG000042663.11.595e-725.17SMESG000042663.1[more]
SMESG000039120.11.020e-628.19SMESG000039120.1[more]
SMESG000039120.11.095e-628.19SMESG000039120.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007804 ID=SMED30007804|Name=Immunoglobulin-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1426bp
ATAGTAAATCATAATTGACATAAAATGAATTTTAAAATTTTCCTATTAAT
TTCATTTCAGTTAATTTGTACATGTTTCGCTTATTTAAATTTAACGGTCG
AAAACATTGTTTTGCCAACCAAAATCAAGTCTAAATATGTAGACATGATG
AAATTCGATAAATTGGTAGTGAATGACACAGAGTTAATTTTGACGTTTAA
CTTTCAAGCTTTAAACAATTTAAAAGAAGACAAGACGTTTTATTATTTCA
ATGGAAAAGAAATAGATTTCAGCAAAAGAAAAGATGTTTCATACTCCTCA
ATTGAGGGAAAGGGTAAAAAGAAGTTCAATTTGATTTTTAAAAAATTTAC
TGAAAAAATTGCCGGCGAATACACCCTGAAAATCATTGCTGACGACGGCT
CGTCGATTAATGCGACGGGAAATATATTTTCTCCACCGTTTCTTCAAGAA
TTCCAGGAATCGAAACGGTCCGTCGAGGGGGGTAGAATAGAGGTTCTATG
CACCGGGTTTTCTCATCCCTTCGAGCTTCACGATCTCGTTTGGAATGAAT
TTCCAACCCGAAAGGTCAACAATTACCGAAGGGCGCGTTCAAATAACGTT
ACGAAATTCGATGATGTCATCGTGTGGGATAAATTGAGCAAAGCAGATGC
TGGCTATTACAAATGCGAAGCGAAAAATAAATACGGCAACGATTCGGTTA
TTATGCAACTGCGAGTCAAAGATAAATTGGCGCCCCTTTGGCCTTTTATT
GGAATCGTCATTGAGGTGATTATTCTGCTCGCTGTTATCATATTTTACGA
GCGAAAGAAATTCATTAACAAAGCCGCAGAAATGGAAGAGAATCCAACTC
GCCAATCTTTACTCGCCGATACCAAAAATTCAGAAATCGATGAAGGGGGA
CTCCGTCACAGAAATCCAGTTGATTGATTGGATGGATTGTGTTAGTGACG
ACAACATTCCGCAAGAGCCACTTCTGCTGCAGTCATTCCTAACCTCCGTG
TTTGTGTTTTCTTTCTCTTCTCTGTGTGTCTGTGTGTGTGTGAATGACGC
TCAAAATGGCTGCGTATCAGATGATCAGACAATTCTGCATGCTCAAATTT
ATTTATGTTCATCTGCAATTGTCTGATCTTGTATTCTATTAAATAGCAAT
TATTTATGGAAATTCTTTCATTATTATTATTATTATCATTATCATTATTA
TACTATTATCAATATTATCATGGACAAGTGTGATGCTAGTATATTCCAAT
GTTATTATTATATTATTGAATGATCCGTAGTATTGTATATCAGTGATCCT
TTTTAGTTTCATAATTCTATTAAATCGTCAAGTCCAGTTAGAATATGATT
TACAAGGCAAATGTTACTTTGATAGAAAATAAATATTAAAACTTATTTAA
TTTTTCTTACTGCTTTTTATCCGGAG
back to top

protein sequence of SMED30007804-orf-1

>SMED30007804-orf-1 ID=SMED30007804-orf-1|Name=SMED30007804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
MNFKIFLLISFQLICTCFAYLNLTVENIVLPTKIKSKYVDMMKFDKLVVN
DTELILTFNFQALNNLKEDKTFYYFNGKEIDFSKRKDVSYSSIEGKGKKK
FNLIFKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSV
EGGRIEVLCTGFSHPFELHDLVWNEFPTRKVNNYRRARSNNVTKFDDVIV
WDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVII
LLAVIIFYERKKFINKAAEMEENPTRQSLLADTKNSEIDEGGLRHRNPVD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007411axon guidance
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR043204Basigin-like
IPR027112Neuroplastin/Basigin
IPR036179Ig-like_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 137..236
e-value: 2.0E-8
score: 36.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 275..300
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..19
score: 0.63
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
IPR043204Basigin-likePANTHERPTHR10075BASIGIN RELATEDcoord: 52..272
IPR027112Neuroplastin/BasiginPANTHERPTHR10075:SF5NEUROPLASTINcoord: 52..272
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 138..232
score: 7.921
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 137..234