SMED30007802

Overview
NameSMED30007802
Smed IDSMED30007802
Length (bp)697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007802 (SMED30007802) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007802 (SMED30007802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007802 (SMED30007802) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007802 (SMED30007802) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007802

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007802h1SMcG0008470 Contig4597uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007802h1SMcG0008470 Contig4597newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007802h1SMcG0016518 Contig4597uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007802h1SMcG0016518 Contig4597newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30007802h1SMcG0016518 SmedASXL_010395SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007802h1SMcG0016518 SmedASXL_017468SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4596newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4596uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016488 Contig4596newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016488 Contig4596uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig10543uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig10543newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig27249uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig27249newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0008470 Contig4597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0008470 Contig4597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0001380 Contig4595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0001380 Contig4595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4024GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0021932 Contig4024GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0002113 Contig4598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0002113 Contig4598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007802h1SMcG0016518 Contig4598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30007802h1SMcG0016518 dd_Smed_v4_5103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30007802h1SMcG0004057 Contig736uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30007802h1SMcG0004057 Contig736newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30007802h1SMcG0016518 Contig736uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30007802h1SMcG0016518 Contig736newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007802 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000175:76186..93633 -3286
Homology
BLAST of SMED30007802 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 58.151 bits (139), Expect = 1.563e-10
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   16 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 90          
BLAST of SMED30007802 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 58.9214 bits (141), Expect = 1.274e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 58.9214 bits (141), Expect = 1.461e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 58.9214 bits (141), Expect = 1.461e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 58.9214 bits (141), Expect = 1.461e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 51.6026 bits (122), Expect = 1.660e-7
Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + P+H A   G  + VQ L++    IDA +QDGK  +  A++ GN +I  ILI N C++N  D
Sbjct:  130 ETPLHVAAARGHVDCVQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHAD 192          
BLAST of SMED30007802 vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 51.6026 bits (122), Expect = 1.707e-7
Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + P+H A   G  + VQ L++    IDA +QDGK  +  A++ GN +I  ILI N C++N  D
Sbjct:  365 ETPLHVAAARGHVDCVQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHAD 427          
BLAST of SMED30007802 vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 51.6026 bits (122), Expect = 1.891e-7
Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + P+H A   G  + VQ L++    IDA +QDGK  +  A++ GN +I  ILI N C++N  D
Sbjct:  172 ETPLHVAAARGHVDCVQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHAD 234          
BLAST of SMED30007802 vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 51.6026 bits (122), Expect = 1.897e-7
Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + P+H A   G  + VQ L++    IDA +QDGK  +  A++ GN +I  ILI N C++N  D
Sbjct:  526 ETPLHVAAARGHVDCVQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHAD 588          
BLAST of SMED30007802 vs. Ensembl Celegans
Match: C45B2.6 (pep chromosome:WBcel235:X:6053058:6057177:1 gene:WBGene00016661.1 transcript:C45B2.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C45B2.6)

HSP 1 Score: 50.0618 bits (118), Expect = 6.608e-7
Identity = 29/112 (25.89%), Postives = 55/112 (49.11%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILI------NNKCELNALDETNQCFQNGYQHKKPMNGAERGSERARLEEPRPKR 328
            INA DL G  P+HY  K G    + +L ++  +++  D  G  P+ YA++R + +IV+  +       ++    AL+   +C +   +H K +   +  + +  LE P  +R
Sbjct:  327 INAQDLNGLTPMHYIAKNGNLSTIILLWSHGANVNMLDNKGMSPMDYALERDDVDIVKAFLAFDGHSTDRILKAALNSRRKCAEVLQKHFKALEEGKEKNIKYNLENPSHRR 438          
BLAST of SMED30007802 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 57.7658 bits (138), Expect = 2.405e-9
Identity = 29/75 (38.67%), Postives = 39/75 (52.00%), Query Frame = 2
Query:   14 NAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            NA    G  P+H ACK GK  +VQIL+ N   ID + ++   P+H A    NP IV++L+ N    N      QC
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQC 631          
BLAST of SMED30007802 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 57.7658 bits (138), Expect = 2.405e-9
Identity = 29/75 (38.67%), Postives = 39/75 (52.00%), Query Frame = 2
Query:   14 NAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            NA    G  P+H ACK GK  +VQIL+ N   ID + ++   P+H A    NP IV++L+ N    N      QC
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQC 631          
BLAST of SMED30007802 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 57.7658 bits (138), Expect = 2.405e-9
Identity = 29/75 (38.67%), Postives = 39/75 (52.00%), Query Frame = 2
Query:   14 NAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            NA    G  P+H ACK GK  +VQIL+ N   ID + ++   P+H A    NP IV++L+ N    N      QC
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQC 631          
BLAST of SMED30007802 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 57.7658 bits (138), Expect = 2.405e-9
Identity = 29/75 (38.67%), Postives = 39/75 (52.00%), Query Frame = 2
Query:   14 NAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            NA    G  P+H ACK GK  +VQIL+ N   ID + ++   P+H A    NP IV++L+ N    N      QC
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQC 631          
BLAST of SMED30007802 vs. Ensembl Fly
Match: Ilk (gene:FBgn0028427 transcript:FBtr0078305)

HSP 1 Score: 51.6026 bits (122), Expect = 2.111e-7
Identity = 24/75 (32.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D N GD  G  P+H+  K G  ++V+ L+     ++A +     P+H A   G+ ++VQ+LI  + ++NA++E
Sbjct:   24 EHDNNLGDDHGFSPLHWVAKEGHAKLVETLLQRGSRVNATNMGDDIPLHLAAAHGHRDVVQMLIKERSDVNAVNE 98          
BLAST of SMED30007802 vs. Ensembl Zebrafish
Match: rai14 (retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE-040718-235])

HSP 1 Score: 58.5362 bits (140), Expect = 3.099e-10
Identity = 29/73 (39.73%), Postives = 40/73 (54.79%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            D++  D  G   +H A K   PE  + L+ NKC +DA D  G+  +H+A   GN EIVQ+L  NK  +N  D 
Sbjct:   78 DVSLQDASGFTALHLAAKNNHPECAKKLLQNKCVVDAPDSSGRTALHHAAACGNNEIVQLLCENKYHVNLKDS 150          
BLAST of SMED30007802 vs. Ensembl Zebrafish
Match: rai14 (retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE-040718-235])

HSP 1 Score: 58.9214 bits (141), Expect = 1.035e-9
Identity = 30/72 (41.67%), Postives = 41/72 (56.94%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            D++  D  G   +H A K   PE  + L+ NKC +DA D  G+  +H+A   GN EIVQ+L  NKC +N  D
Sbjct:   79 DVSLQDASGFTALHLAAKNNHPECAKKLLQNKCVVDAPDSSGRTALHHAAACGNNEIVQLLCENKCHVNLKD 150          

HSP 2 Score: 51.2174 bits (121), Expect = 3.672e-7
Identity = 25/78 (32.05%), Postives = 45/78 (57.69%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQ 235
            +C ++A D  G+  +H+A   G  EIVQ+L  NKC ++ +D DG  P+  +    + E+ Q L++   ++NA D+  +
Sbjct:  110 KCVVDAPDSSGRTALHHAAACGNNEIVQLLCENKCHVNLKDSDGFTPLLLSARHAHAEVCQSLLDWGADINARDKNGR 187          
BLAST of SMED30007802 vs. Ensembl Zebrafish
Match: ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle) [Source:ZFIN;Acc:ZDB-GENE-090313-383])

HSP 1 Score: 56.6102 bits (135), Expect = 3.912e-9
Identity = 26/73 (35.62%), Postives = 43/73 (58.90%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DIN  D LG + +H+AC+GG    + +L +   DI+ RD+    P+H A   G+ ++VQ L+++   +NA D
Sbjct:  167 ADINFKDRLGCRAVHWACRGGSLSALTVLQDRGADINVRDKLLSSPLHVATRTGHSDVVQHLLDSGININAKD 239          
BLAST of SMED30007802 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 55.8398 bits (133), Expect = 1.098e-8
Identity = 23/72 (31.94%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            +N  D  G+ P+H+A + G  E+V++L+N   ++ A D+  +QPIH+A   G+ E+V++L++   + +  D+
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDK 204          

HSP 2 Score: 53.5286 bits (127), Expect = 7.523e-8
Identity = 24/74 (32.43%), Postives = 42/74 (56.76%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDET 229
            DIN  D  G+  +H A  GG  E + +L+++  D++ +D+ G+ P+HYA   G  + V +L+    E+N  D +
Sbjct:  415 DINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRS 488          

HSP 3 Score: 51.6026 bits (122), Expect = 3.114e-7
Identity = 30/92 (32.61%), Postives = 49/92 (53.26%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQCFQNGYQHKKPMNGAE 283
            +++A D   +QPIH+A   G  E+V++L++   D   +D+ G  P+H A   G+ ++V+ L+ N  E   +DE N  F N   H     G E
Sbjct:  165 NLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAE---IDEPN-AFGNTALHVACYTGQE 252          
BLAST of SMED30007802 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 55.8398 bits (133), Expect = 1.106e-8
Identity = 23/72 (31.94%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            +N  D  G+ P+H+A + G  E+V++L+N   ++ A D+  +QPIH+A   G+ E+V++L++   + +  D+
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDK 204          

HSP 2 Score: 53.5286 bits (127), Expect = 7.649e-8
Identity = 24/74 (32.43%), Postives = 42/74 (56.76%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDET 229
            DIN  D  G+  +H A  GG  E + +L+++  D++ +D+ G+ P+HYA   G  + V +L+    E+N  D +
Sbjct:  401 DINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRS 474          

HSP 3 Score: 51.6026 bits (122), Expect = 3.137e-7
Identity = 30/92 (32.61%), Postives = 49/92 (53.26%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQCFQNGYQHKKPMNGAE 283
            +++A D   +QPIH+A   G  E+V++L++   D   +D+ G  P+H A   G+ ++V+ L+ N  E   +DE N  F N   H     G E
Sbjct:  165 NLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAE---IDEPN-AFGNTALHVACYTGQE 252          
BLAST of SMED30007802 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 59.6918 bits (143), Expect = 5.944e-10
Identity = 27/76 (35.53%), Postives = 48/76 (63.16%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINN--KCELNALD 223
            + ++NA D   + P+H A +GG  E+VQ+L+NNK D ++ ++D K P+H A   G+ EIV +++    +C +  +D
Sbjct:  190 KANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMD 265          

HSP 2 Score: 53.1434 bits (126), Expect = 1.046e-7
Identity = 26/81 (32.10%), Postives = 49/81 (60.49%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILIN------NKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            + DINA +  G+  +H A   G   +++ LIN      +K +++A+D+  + P+H A + G  E+VQ+L+NNK + N+ ++
Sbjct:  151 DTDINAVNPSGETLLHIAAASGHVAVIEYLINKDSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEK 231          
BLAST of SMED30007802 vs. Ensembl Xenopus
Match: ilk (integrin linked kinase [Source:NCBI gene;Acc:100145644])

HSP 1 Score: 58.9214 bits (141), Expect = 7.311e-10
Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  IV +LI     I+  ++    P+H A   G+ +IVQ LI  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSNIVDMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLIQYKADVNAVNE 98          
BLAST of SMED30007802 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 59.3066 bits (142), Expect = 1.177e-9
Identity = 27/76 (35.53%), Postives = 48/76 (63.16%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINN--KCELNALD 223
            + ++NA D   + P+H A +GG  E+VQ+L+NNK D ++ ++D K P+H A   G+ EIV +++    +C +  +D
Sbjct:  353 KANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMD 428          

HSP 2 Score: 52.373 bits (124), Expect = 2.469e-7
Identity = 21/62 (33.87%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   41 PIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            P+H A + G   + Q L+++K +++A+D+  + P+H A + G  E+VQ+L+NNK + N+ ++
Sbjct:  333 PLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEK 394          
BLAST of SMED30007802 vs. Ensembl Xenopus
Match: egln1 (egl-9 family hypoxia-inducible factor 1 [Source:Xenbase;Acc:XB-GENE-1017116])

HSP 1 Score: 55.4546 bits (132), Expect = 1.419e-8
Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
              +N  D L    IH+AC+GGK EIV++L ++  +I+ +D+    P+H A   G+  IV+ LI    E+NA D
Sbjct:  172 SSVNFRDRLDCTAIHWACRGGKLEIVKLLQDSGAEINVKDKLLSTPLHVATRTGHAHIVEHLIATGVEINARD 244          
BLAST of SMED30007802 vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:549110])

HSP 1 Score: 54.6842 bits (130), Expect = 1.810e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            +NA + +G  P+HYA    K EI  +L+ N    DA+D     P+H A  +GN  IVQIL+ ++   N  D
Sbjct:  100 VNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKDNLESTPLHRAASKGNLRIVQILLKHQASTNIQD 170          

HSP 2 Score: 48.521 bits (114), Expect = 1.883e-6
Identity = 20/64 (31.25%), Postives = 36/64 (56.25%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            +  +H+AC  G+ E+ + L+     +DA+D  G  P+H A   G  +IV+ LI    ++NA ++
Sbjct:   42 RTALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQ 105          

HSP 3 Score: 48.1358 bits (113), Expect = 2.831e-6
Identity = 24/71 (33.80%), Postives = 38/71 (53.52%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            ++A D  G  P+H A   G+ +IV+ LI     ++A +Q G  P+HYA  +   EI  +L+ N    +A D
Sbjct:   67 VDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKD 137          
BLAST of SMED30007802 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 58.5362 bits (140), Expect = 7.893e-10
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 58.9214 bits (141), Expect = 1.041e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 58.9214 bits (141), Expect = 1.041e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 56.6102 bits (135), Expect = 2.344e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. Ensembl Mouse
Match: Invs (inversin [Source:MGI Symbol;Acc:MGI:1335082])

HSP 1 Score: 55.4546 bits (132), Expect = 1.242e-8
Identity = 30/96 (31.25%), Postives = 47/96 (48.96%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQCFQNGYQHKKPMNGAERG 289
            +  ++A D++   P+  AC+ G  +++Q LI     +D  DQDG   +H+A   GN ++ QILI NK   N  D         Y  + P+  A  G
Sbjct:  324 DAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQD---------YAGRTPLQCAAYG 410          
BLAST of SMED30007802 vs. UniProt/SwissProt
Match: sp|Q13418|ILK_HUMAN (Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 7.014e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. UniProt/SwissProt
Match: sp|Q5R5V4|ILK_PONAB (Integrin-linked protein kinase OS=Pongo abelii OX=9601 GN=ILK PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.146e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. UniProt/SwissProt
Match: sp|P57044|ILK_CAVPO (Integrin-linked protein kinase OS=Cavia porcellus OX=10141 GN=ILK PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.273e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. UniProt/SwissProt
Match: sp|Q99J82|ILK_RAT (Integrin-linked protein kinase OS=Rattus norvegicus OX=10116 GN=Ilk PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.281e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. UniProt/SwissProt
Match: sp|O55222|ILK_MOUSE (Integrin-linked protein kinase OS=Mus musculus OX=10090 GN=Ilk PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 7.281e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V++LI     I+  ++    P+H A   G+ +IVQ L+  K ++NA++E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNE 98          
BLAST of SMED30007802 vs. TrEMBL
Match: A2G327 (Ankyrin repeat protein, putative OS=Trichomonas vaginalis OX=5722 GN=TVAG_099300 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.058e-13
Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA +  K EI +IL++N  DI+A+D+DG  P+HYA D    EI +ILI+N  ++NA D+
Sbjct:   69 ADINAKDKDGFTPLHYAARNNKKEIAEILVSNGADINAKDKDGFTPLHYAADYNKKEIAEILISNGADINAKDK 142          

HSP 2 Score: 75.485 bits (184), Expect = 1.798e-12
Identity = 37/74 (50.00%), Postives = 48/74 (64.86%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA    K EI +ILI+N  DI+A+D+DG  P+HYA D    EI +ILI+N  ++NA  E
Sbjct:  201 ADINAKDKDGFTPLHYAADYNKKEIAEILISNGADINAKDKDGFTPLHYAADYNKKEIAEILISNGADINAKTE 274          

HSP 3 Score: 75.485 bits (184), Expect = 1.834e-12
Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA +  K E  +ILI+N  DI+A+D+DG  P+HYA D    EI +ILI+N  ++NA D+
Sbjct:  168 ADINAKDKDGCTPLHYAARNNKKETAEILISNGADINAKDKDGFTPLHYAADYNKKEIAEILISNGADINAKDK 241          

HSP 4 Score: 72.0182 bits (175), Expect = 3.379e-11
Identity = 36/74 (48.65%), Postives = 48/74 (64.86%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA    K EI +ILI+N  DI+A+D+DG  P+HYA      EI +ILI+N  ++NA D+
Sbjct:  102 ADINAKDKDGFTPLHYAADYNKKEIAEILISNGADINAKDKDGFTPLHYAASNIWKEIAEILISNGADINAKDK 175          

HSP 5 Score: 70.0922 bits (170), Expect = 1.776e-10
Identity = 34/74 (45.95%), Postives = 47/74 (63.51%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA      EI +ILI+N  DI+A+D+DG  P+HYA      EI +IL++N  ++NA D+
Sbjct:   36 ADINAEDKYGCTPLHYAASNIWKEIAEILISNGADINAKDKDGFTPLHYAARNNKKEIAEILVSNGADINAKDK 109          

HSP 6 Score: 67.781 bits (164), Expect = 1.105e-9
Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D  G  P+HYA      EI +ILI+N  DI+A+D+DG  P+HYA      E  +ILI+N  ++NA D+
Sbjct:  135 ADINAKDKDGFTPLHYAASNIWKEIAEILISNGADINAKDKDGCTPLHYAARNNKKETAEILISNGADINAKDK 208          
BLAST of SMED30007802 vs. TrEMBL
Match: A2END7 (ANK_REP_REGION domain-containing protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_202640 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.419e-13
Identity = 34/76 (44.74%), Postives = 53/76 (69.74%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQ 235
            D+NA D LGK P+HYA +G   E+++ LI+N  DI+A+D DG+ P+H AI   +P I+  LI++  ++NA+D  N+
Sbjct:  427 DVNAKDYLGKIPLHYAAQGNSTELLETLISNGSDINAKDDDGRTPLHDAIPSMHPHIIDFLISHGADINAVDNFNR 502          
BLAST of SMED30007802 vs. TrEMBL
Match: A2FNS2 (Ankyrin repeat protein, putative OS=Trichomonas vaginalis OX=5722 GN=TVAG_137200 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.252e-12
Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    EI+ ILI+ + DI+A+D DGK  +HYA++R N EI+ ILI+ + ++NA D
Sbjct:  260 VDINAKDVDGKTALHYAVEKHNAEIINILISRRVDINAKDVDGKTALHYAVERYNVEIINILISRRVDINAKD 332          

HSP 2 Score: 73.559 bits (179), Expect = 2.255e-11
Identity = 34/73 (46.58%), Postives = 51/73 (69.86%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    EI+ ILI+ + DI+A+D DGK  +HYA+++ N EI+ ILI+ + ++NA D
Sbjct:  227 ADINAKDVDGKTALHYAVERYNVEIINILISRRVDINAKDVDGKTALHYAVEKHNAEIINILISRRVDINAKD 299          

HSP 3 Score: 72.0182 bits (175), Expect = 7.323e-11
Identity = 35/72 (48.61%), Postives = 48/72 (66.67%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            DIN  D+ GK  +HYA K    +I  ILI N  DI+A+D DGK  +HYA++R N EI+ ILI+ + ++NA D
Sbjct:  195 DINVKDVNGKTALHYAIKHCNEDITNILILNGADINAKDVDGKTALHYAVERYNVEIINILISRRVDINAKD 266          

HSP 4 Score: 71.633 bits (174), Expect = 9.461e-11
Identity = 34/73 (46.58%), Postives = 50/73 (68.49%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    EI+ ILI+ + DI+A+D DGK  +HYA+++ N EI+ ILI+   ++NA D
Sbjct:  293 VDINAKDVDGKTALHYAVERYNVEIINILISRRVDINAKDVDGKTALHYAVEKHNAEIINILISCGVDINAKD 365          

HSP 5 Score: 68.1662 bits (165), Expect = 1.602e-9
Identity = 33/73 (45.21%), Postives = 48/73 (65.75%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    EI+ ILI+   DI+A+D +GK  +HYA+++ N EI+ ILI+    +NA D
Sbjct:  326 VDINAKDVDGKTALHYAVEKHNAEIINILISCGVDINAKDINGKTALHYAVEKHNAEIINILISCGVNINAKD 398          

HSP 6 Score: 63.5438 bits (153), Expect = 4.887e-8
Identity = 32/73 (43.84%), Postives = 44/73 (60.27%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA K     I+ IL ++  DI+ +D +GK  +HYAI   N +I  ILI N  ++NA D
Sbjct:  161 VDINAKDVNGKTALHYAIKNYNIAIINILTSHGIDINVKDVNGKTALHYAIKHCNEDITNILILNGADINAKD 233          

HSP 7 Score: 62.3882 bits (150), Expect = 1.398e-7
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    EI+ ILI+   +I+A+D DGK  +HYA+++   +I  ILI++  ++N  D
Sbjct:  359 VDINAKDINGKTALHYAVEKHNAEIINILISCGVNINAKDVDGKTALHYAVEKYYIQISNILISHGSDINTKD 431          

HSP 8 Score: 59.3066 bits (142), Expect = 1.334e-6
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D+ GK  +HYA +    E++ I I+   DI+A+D +GK  +HYAI   N  I+ IL ++  ++N  D
Sbjct:  128 ADINAKDVDGKTALHYATELRNEEMISIFISRGVDINAKDVNGKTALHYAIKNYNIAIINILTSHGIDINVKD 200          
BLAST of SMED30007802 vs. TrEMBL
Match: A2FU16 (Ankyrin repeat protein, putative OS=Trichomonas vaginalis OX=5722 GN=TVAG_385630 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.777e-11
Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D +G  P+HYA K    EI +ILI+N  DI+A+D+DG  P+HYA    + E  +ILI+N  ++NA D
Sbjct:  340 ADINAKDRIGLTPLHYAAKYNNKEIAEILISNGADINAKDEDGSTPLHYAAMNNSKETAEILISNGADINAKD 412          

HSP 2 Score: 70.4774 bits (171), Expect = 2.457e-10
Identity = 35/74 (47.30%), Postives = 47/74 (63.51%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
             DINA D +G  P+H A K    E  +ILI+N  DI+A+D+ G  P+HYA    N EI +ILI+N  ++NA DE
Sbjct:  307 ADINAKDRIGLTPLHSAAKNNSKETAEILISNGADINAKDRIGLTPLHYAAKYNNKEIAEILISNGADINAKDE 380          

HSP 3 Score: 67.781 bits (164), Expect = 1.881e-9
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D++G  P+HYA      E  +ILI+N  DI+A+D  G  P+HYA    N E  ++LI+N  ++NA D
Sbjct:  406 ADINAKDIIGLTPLHYAAMNNSKETAEILISNGADINAKDIIGLTPLHYAAMNDNKETAEVLISNGADINAKD 478          

HSP 4 Score: 63.1586 bits (152), Expect = 7.903e-8
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DINA D  G  P+HYA      E  +ILI+N  DI+A+D  G  P+HYA    + E  +ILI+N  ++NA D
Sbjct:  373 ADINAKDEDGSTPLHYAAMNNSKETAEILISNGADINAKDIIGLTPLHYAAMNNSKETAEILISNGADINAKD 445          
BLAST of SMED30007802 vs. TrEMBL
Match: A0A0N4UVP2 (ANK_REP_REGION domain-containing protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS1227 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.786e-11
Identity = 32/73 (43.84%), Postives = 50/73 (68.49%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             D N+ D + + P+H+A K G  EIV+IL  NK D++A+D+  + P+H+A+ +G+ EIV+IL  NK +LN  D
Sbjct:  129 MDKNSKDRVQRTPMHWAAKNGHTEIVKILTENKADLNAKDKWQRTPMHWAVFKGHTEIVKILAQNKVDLNVKD 201          

HSP 2 Score: 61.6178 bits (148), Expect = 2.399e-7
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            + D+NA D   + P+H+A   G  EIV+IL  NK D++ +D+  + P+H+A+   + E V+IL   K +LN  DE
Sbjct:  161 KADLNAKDKWQRTPMHWAVFKGHTEIVKILAQNKVDLNVKDRWQETPMHWAVQNRHTESVEILAQYKADLNIRDE 235          

HSP 3 Score: 60.8474 bits (146), Expect = 4.591e-7
Identity = 28/74 (37.84%), Postives = 45/74 (60.81%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + D+N  D   + P+H+A +    E V+IL   K D++ RD+    P+H+A+ +G+ EIV+IL  NK +LN  D
Sbjct:  194 KVDLNVKDRWQETPMHWAVQNRHTESVEILAQYKADLNIRDEIQFTPMHWAVFKGHTEIVKILAQNKVDLNVKD 267          

HSP 4 Score: 57.7658 bits (138), Expect = 4.082e-6
Identity = 27/71 (38.03%), Postives = 43/71 (60.56%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELN 214
            + D+N  D +   P+H+A   G  EIV+IL  NK D++ +D+    P+++A   G  E V+ILI N+ +LN
Sbjct:  227 KADLNIRDEIQFTPMHWAVFKGHTEIVKILAQNKVDLNVKDRWQNTPLYHAAKDGKVEFVKILIQNEADLN 297          
BLAST of SMED30007802 vs. Ensembl Cavefish
Match: acbd6 (acyl-CoA binding domain containing 6 [Source:NCBI gene;Acc:324090])

HSP 1 Score: 56.6102 bits (135), Expect = 2.697e-9
Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILI 193
            D+N  D  G+  +H+AC  G  E+V +L++N  DI+ +D +G+ P+HYA      EIV++L+
Sbjct:  185 DVNTKDEEGRALLHWACDRGHKELVSLLLSNNADINCQDDEGQTPLHYASACEFAEIVELLL 246          
BLAST of SMED30007802 vs. Ensembl Cavefish
Match: ankrd2 (ankyrin repeat domain 2 [Source:NCBI gene;Acc:103042132])

HSP 1 Score: 53.1434 bits (126), Expect = 4.700e-8
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
             DIN  D L    +H+AC+GG+ E ++IL     +++ RD+    P+H A   G+ E+V+ L+ +  ++NA D
Sbjct:  169 ADINFQDRLDCTALHWACRGGRLEALKILQGRGANLNIRDKLMSTPLHVATRTGHSEVVEHLLASGVKINAQD 241          
BLAST of SMED30007802 vs. Ensembl Cavefish
Match: ilk (integrin linked kinase [Source:NCBI gene;Acc:103042782])

HSP 1 Score: 53.5286 bits (127), Expect = 5.627e-8
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V +LI     I+  ++    P+H A   G+ EI+  LI  K + NA +E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSGVVDMLIMRGARINVMNRGDDTPLHLAASHGHREILGKLIQCKADTNAANE 98          
BLAST of SMED30007802 vs. Ensembl Cavefish
Match: ilk (integrin linked kinase [Source:NCBI gene;Acc:103042782])

HSP 1 Score: 53.1434 bits (126), Expect = 5.949e-8
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            E D+N GD  G  P+H+AC+ G+  +V +LI     I+  ++    P+H A   G+ EI+  LI  K + NA +E
Sbjct:   24 ENDLNQGDDHGFSPLHWACREGRSGVVDMLIMRGARINVMNRGDDTPLHLAASHGHREILGKLIQCKADTNAANE 98          
BLAST of SMED30007802 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 51.6026 bits (122), Expect = 8.701e-8
Identity = 23/68 (33.82%), Postives = 39/68 (57.35%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            +  +H+AC  G   IVQ L++   ++D +D     P+H A   G  EIV+ LI+   +LN++++ N C
Sbjct:   27 RTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQ-NGC 93          

HSP 2 Score: 48.521 bits (114), Expect = 1.217e-6
Identity = 22/62 (35.48%), Postives = 37/62 (59.68%), Query Frame = 2
Query:   41 PIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            P+H A   G+ EIV+ LI+    +++ +Q+G  P+HYA  +   EI  +L+ N  + NA D+
Sbjct:   62 PLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDK 123          
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 57.7658 bits (138), Expect = 4.293e-10
Identity = 23/80 (28.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:   32 GKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCEL-----NALDETNQCFQNGYQ 256
            G+ P+H A   G  E+V++L +  C++D +D  G+  +H A++ G+  ++ +L++  C L     N L   + C   GY+
Sbjct:   42 GRSPLHLAASRGHAEVVRLLASAGCNLDLQDDGGQTALHRAVEAGSTAVLSVLLDEGCSLDRQDTNCLTLAHDCSTRGYK 121          
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 53.5286 bits (127), Expect = 1.239e-8
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINN 199
            ++A +++   P+  AC+ G  E+++ LI     +D  DQDG  P+H+A   GN +I  ILI N
Sbjct:  384 VDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRN 446          
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 53.1434 bits (126), Expect = 1.408e-8
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINN 199
            ++A +++   P+  AC+ G  E+++ LI     +D  DQDG  P+H+A   GN +I  ILI N
Sbjct:  380 VDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRN 442          
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Match: gabpb2b (GA binding protein transcription factor subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-050208-136])

HSP 1 Score: 52.7582 bits (125), Expect = 1.834e-8
Identity = 25/67 (37.31%), Postives = 36/67 (53.73%), Query Frame = 2
Query:   23 DLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            D LG  P+H A + G     ++L+      DAR +  K P+H A   G+  IV++LI N  E+NA D
Sbjct:   35 DWLGTSPLHLAAQYGHYTTAEVLLRAGVSRDARTKVDKTPLHMAASEGHVNIVELLIKNGAEVNAKD 101          

HSP 2 Score: 45.0542 bits (105), Expect = 5.941e-6
Identity = 18/68 (26.47%), Postives = 37/68 (54.41%), Query Frame = 2
Query:   35 KQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQC 238
            K P+H A   G   IV++LI N  +++A+D      +H+A + G+  +V+ L+    + + L + ++ 
Sbjct:   72 KTPLHMAASEGHVNIVELLIKNGAEVNAKDMLKMTALHWAAEHGHRAVVEALVRGAADTHTLSKFDKT 139          
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 3.250e-8
Identity = 26/77 (33.77%), Postives = 45/77 (58.44%), Query Frame = 2
Query:    8 DINAGDLLGKQ--PIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETN 232
            ++NA D  G++  P+H+A   G+ ++V+ L+ N  ++ ARD  G  P+H A   G+ E+V +L+    + NA D  N
Sbjct:  171 NVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWN 247          

HSP 2 Score: 47.3654 bits (111), Expect = 1.452e-6
Identity = 22/72 (30.56%), Postives = 41/72 (56.94%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            + +A D     P+H A    +  IVQ+L+ +  D+ A+D+ G  P+H A   G+ E+ ++L+ +   +NA+D
Sbjct:  326 NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMD 397          
BLAST of SMED30007802 vs. Ensembl Nematostella
Match: EDO44570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG1])

HSP 1 Score: 51.6026 bits (122), Expect = 2.747e-9
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 2
Query:   32 GKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            G  P+H+AC  G+  IV++L+    DI AR+  G  P+H A   GN E ++ILI +  +L+A +
Sbjct:    1 GDTPLHFACARGESAIVRVLLLFGADIHARNFAGYSPLHVAALHGNAESIRILILHGADLHATE 64          
BLAST of SMED30007802 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 51.2174 bits (121), Expect = 7.653e-9
Identity = 23/63 (36.51%), Postives = 39/63 (61.90%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILIN 196
            D  A D  G  P+H AC  GK E+V++L+    D++A   DG +P+H A + G+ E++++L+ 
Sbjct:   12 DPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLT 74          
BLAST of SMED30007802 vs. Ensembl Nematostella
Match: EDO34162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ64])

HSP 1 Score: 49.6766 bits (117), Expect = 3.706e-8
Identity = 23/63 (36.51%), Postives = 38/63 (60.32%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILIN 196
            D  A D  G  P+H AC  GK E+V++L     D++A   DG +P+H A + G+ E++++L+ 
Sbjct:   12 DPTAKDNAGWTPLHEACARGKLEVVKVLAQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLT 74          
BLAST of SMED30007802 vs. Ensembl Nematostella
Match: EDO32649 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH5])

HSP 1 Score: 49.6766 bits (117), Expect = 5.324e-8
Identity = 23/66 (34.85%), Postives = 39/66 (59.09%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKC---DIDARDQDGKQPIHYAIDRGNPEIVQILI 193
             D+N+ D  G+  + Y C   K ++V++LIN      D + +D DG  P+ +A+  GN EIV++L+
Sbjct:   60 ADVNSTDPEGRHALAYTCLTQKLDLVRLLINTSVHNLDFNKQDLDGNTPLLHAVKVGNLEIVRVLL 125          
BLAST of SMED30007802 vs. Ensembl Nematostella
Match: EDO35810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKC0])

HSP 1 Score: 50.8322 bits (120), Expect = 8.106e-8
Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 2
Query:   11 INAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            IN+ D  G   +H+AC  G   +V  LI N  D++  D DG+ PIHYA       IVQ L++     N  D
Sbjct:  142 INSPDEQGMSLLHWACDRGHDCVVDFLIKNNADVNITDSDGQTPIHYAATCEFTSIVQQLLDAHALTNIKD 212          
BLAST of SMED30007802 vs. Ensembl Medaka
Match: ENSORLT00000018386.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 59.3066 bits (142), Expect = 7.013e-10
Identity = 24/74 (32.43%), Postives = 45/74 (60.81%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            C ++  D LG+ P+HYA   G  E+V +L+    ++ A+D+  +QPIH+A   G  E+V++L+++   +   D+
Sbjct:  127 CSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDK 200          

HSP 2 Score: 53.9138 bits (128), Expect = 4.780e-8
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            E DIN  D  G+  +H A  GG  E + +L+N   ++D +D  G+ P+HYA   GN +    L+    E+N  D
Sbjct:  400 ELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDAD 473          

HSP 3 Score: 48.1358 bits (113), Expect = 4.104e-6
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELN 214
            D++  +  GK P+H A K G+    QILI N  +ID  D +G  P+H A   G   ++  L+ N  + N
Sbjct:  294 DVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKN 362          
BLAST of SMED30007802 vs. Ensembl Medaka
Match: ENSORLT00000027359.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 59.3066 bits (142), Expect = 7.687e-10
Identity = 24/74 (32.43%), Postives = 45/74 (60.81%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            C ++  D LG+ P+HYA   G  E+V +L+    ++ A+D+  +QPIH+A   G  E+V++L+++   +   D+
Sbjct:   58 CSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 5.095e-8
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            E DIN  D  G+  +H A  GG  E + +L+N   ++D +D  G+ P+HYA   GN +    L+    E+N  D
Sbjct:  340 ELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDAD 413          

HSP 3 Score: 47.7506 bits (112), Expect = 4.414e-6
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELN 214
            D++  +  GK P+H A K G+    QILI N  +ID  D +G  P+H A   G   ++  L+ N  + N
Sbjct:  225 DVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKN 293          
BLAST of SMED30007802 vs. Ensembl Medaka
Match: ENSORLT00000036677.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 59.3066 bits (142), Expect = 7.687e-10
Identity = 24/74 (32.43%), Postives = 45/74 (60.81%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            C ++  D LG+ P+HYA   G  E+V +L+    ++ A+D+  +QPIH+A   G  E+V++L+++   +   D+
Sbjct:   58 CSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 5.095e-8
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            E DIN  D  G+  +H A  GG  E + +L+N   ++D +D  G+ P+HYA   GN +    L+    E+N  D
Sbjct:  340 ELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDAD 413          

HSP 3 Score: 47.7506 bits (112), Expect = 4.414e-6
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELN 214
            D++  +  GK P+H A K G+    QILI N  +ID  D +G  P+H A   G   ++  L+ N  + N
Sbjct:  225 DVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKN 293          
BLAST of SMED30007802 vs. Ensembl Medaka
Match: ENSORLT00000036692.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 59.3066 bits (142), Expect = 8.151e-10
Identity = 24/74 (32.43%), Postives = 45/74 (60.81%), Query Frame = 2
Query:    5 CDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            C ++  D LG+ P+HYA   G  E+V +L+    ++ A+D+  +QPIH+A   G  E+V++L+++   +   D+
Sbjct:  131 CSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDK 204          

HSP 2 Score: 53.9138 bits (128), Expect = 5.107e-8
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 2
Query:    2 ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALD 223
            E DIN  D  G+  +H A  GG  E + +L+N   ++D +D  G+ P+HYA   GN +    L+    E+N  D
Sbjct:  413 ELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDAD 486          

HSP 3 Score: 47.7506 bits (112), Expect = 4.586e-6
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELN 214
            D++  +  GK P+H A K G+    QILI N  +ID  D +G  P+H A   G   ++  L+ N  + N
Sbjct:  298 DVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKN 366          
BLAST of SMED30007802 vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 54.6842 bits (130), Expect = 2.760e-8
Identity = 41/134 (30.60%), Postives = 61/134 (45.52%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDETNQCFQNGYQHKKPMNG-AERG-SERARLEEPRPKRSCPTLWQILGRENDPRRPNEEQYPA 403
            +IN  D  G+  +H A  GG  E + +L+++  D++ RD  G+ P+HYA   G  +    L++   E+N  D+T  C    Y       G  ER  S   + EE   K S   L  +L    DP   N + Y A
Sbjct:  415 EINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTG-CTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSA 547          

HSP 2 Score: 48.521 bits (114), Expect = 2.562e-6
Identity = 22/73 (30.14%), Postives = 45/73 (61.64%), Query Frame = 2
Query:    8 DINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHYAIDRGNPEIVQILINNKCELNALDE 226
            ++N  D  G+  +H+A + G  E+V++L+N   ++ A D+  +QPIH A   G+ E+V++L++   + +  D+
Sbjct:  132 NLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDK 204          
BLAST of SMED30007802 vs. Planmine SMEST
Match: SMESG000017814.1 (SMESG000017814.1)

HSP 1 Score: 215.698 bits (548), Expect = 3.780e-66
Identity = 106/119 (89.08%), Postives = 110/119 (92.44%), Query Frame = 2
Query:  284 RGSERAR----LEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEIRDHARNLLALWEKIQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPGYSPEEGVKKF 628
            R  +RAR    LEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEI DHAR+LLA WEKIQEEVDL+VVKARMYLANVEEDILVGRIAE YPTRPARNTRRPVPIIPGYSPEEGVKK+
Sbjct:   16 RAWKRARPSMTLEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEILDHARSLLAQWEKIQEEVDLHVVKARMYLANVEEDILVGRIAETYPTRPARNTRRPVPIIPGYSPEEGVKKY 134          

HSP 2 Score: 51.9878 bits (123), Expect = 1.425e-7
Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  235 MLPEWISAQEADEWRRAWKRARPS 306
            MLP WISAQEADEWRRAWKRARPS
Sbjct:    1 MLPNWISAQEADEWRRAWKRARPS 24          
BLAST of SMED30007802 vs. Planmine SMEST
Match: SMESG000042306.1 (SMESG000042306.1)

HSP 1 Score: 195.667 bits (496), Expect = 1.014e-63
Identity = 98/123 (79.67%), Postives = 105/123 (85.37%), Query Frame = 2
Query:  284 RGSERAR----LEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEIRDHARNLLALWEKIQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPGYSPEEGVKKFFEES 640
            R  +RAR    L+EPRPKRSCP+LWQ+L R NDP RP EEQYPAEEI D+ARNLLA WEKIQ EVDL VVKARMYLANVEEDILVGRIAE YP RPARN RRPVPIIPGY+PEEGV+KF EES
Sbjct:   26 RAWKRARPSMTLDEPRPKRSCPSLWQVLDRGNDPHRPEEEQYPAEEIVDNARNLLAQWEKIQTEVDLQVVKARMYLANVEEDILVGRIAETYPARPARNLRRPVPIIPGYTPEEGVRKFLEES 148          

HSP 2 Score: 45.0542 bits (105), Expect = 6.834e-6
Identity = 22/26 (84.62%), Postives = 22/26 (84.62%), Query Frame = 1
Query:  229 EPMLPEWISAQEADEWRRAWKRARPS 306
            E MLP  IS QEADEWRRAWKRARPS
Sbjct:    9 EFMLPNLISKQEADEWRRAWKRARPS 34          
BLAST of SMED30007802 vs. Planmine SMEST
Match: SMESG000018097.1 (SMESG000018097.1)

HSP 1 Score: 206.068 bits (523), Expect = 1.008e-60
Identity = 98/113 (86.73%), Postives = 100/113 (88.50%), Query Frame = 2
Query:  272 NGAERGSERAR----LEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEIRDHARNLLALWEKIQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPG 598
            N   R  +RAR    LEEPRPKRS PTLWQILGRENDPRRPNEEQYPAEEI DHARNLLA WEKIQEEVDLNVVKARMYLANVEEDILVGRIA+ YPTRPARNTRRPVPIIPG
Sbjct:  192 NEWRRAWKRARPSMTLEEPRPKRSFPTLWQILGRENDPRRPNEEQYPAEEILDHARNLLAQWEKIQEEVDLNVVKARMYLANVEEDILVGRIADTYPTRPARNTRRPVPIIPG 304          

HSP 2 Score: 65.4698 bits (158), Expect = 5.349e-12
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  226 DEPMLPEWISAQEADEWRRAWKRARPS 306
            +EPMLPEWISAQEA+EWRRAWKRARPS
Sbjct:  178 EEPMLPEWISAQEANEWRRAWKRARPS 204          
BLAST of SMED30007802 vs. Planmine SMEST
Match: SMESG000054283.1 (SMESG000054283.1)

HSP 1 Score: 190.274 bits (482), Expect = 6.640e-57
Identity = 93/116 (80.17%), Postives = 99/116 (85.34%), Query Frame = 2
Query:  284 RGSERAR----LEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEIRDHARNLLALWEKIQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPGYSPEEGV 619
            R  +RAR    L+EPRPKRSCP+LWQ+LGR NDP RP EEQYPAEEI DHAR+LLA WE+IQ EVDL VVKARMYLANVEEDILVGRIAE YP RPARN RRPVPIIPGYSPEE V
Sbjct:   16 RAWKRARPSMTLDEPRPKRSCPSLWQVLGRGNDPHRPEEEQYPAEEIVDHARSLLAQWEQIQAEVDLQVVKARMYLANVEEDILVGRIAETYPARPARNLRRPVPIIPGYSPEEEV 131          

HSP 2 Score: 46.9802 bits (110), Expect = 6.637e-6
Identity = 21/24 (87.50%), Postives = 21/24 (87.50%), Query Frame = 1
Query:  235 MLPEWISAQEADEWRRAWKRARPS 306
            MLP  IS QEADEWRRAWKRARPS
Sbjct:    1 MLPNLISKQEADEWRRAWKRARPS 24          
BLAST of SMED30007802 vs. Planmine SMEST
Match: SMESG000006309.1 (SMESG000006309.1)

HSP 1 Score: 166.777 bits (421), Expect = 3.517e-52
Identity = 89/125 (71.20%), Postives = 100/125 (80.00%), Query Frame = 2
Query:  284 RGSERAR----LEEPRPKRSCPTLWQILGRENDPRRPNE---EQYPAEEIRDHARNLLALWEKIQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPGYSPEEGVKKFFEE 637
            R  +RAR    LEEP+PKR   T  Q+LG ENDPR  NE   +QYPAEEIRDHARNLLA WE+IQ +VDL VVK R YLANVE+DI VGRIA+IYPTRPARNTRRPV +IPG SPEEGV++FFEE
Sbjct:   40 RAWKRARPTTSLEEPQPKRPHQTALQMLGMENDPRWANERDTDQYPAEEIRDHARNLLARWEEIQWQVDLQVVKVRQYLANVEDDISVGRIADIYPTRPARNTRRPVAVIPGCSPEEGVRRFFEE 164          
The following BLAST results are available for this feature:
BLAST of SMED30007802 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ILK1.563e-1036.00integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK1.274e-936.00integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK1.461e-936.00integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK1.461e-936.00integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK1.461e-936.00integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dapk-11.660e-739.68Death-associated protein kinase dapk-1 [Source:Un... [more]
dapk-11.707e-739.68Death-associated protein kinase dapk-1 [Source:Un... [more]
dapk-11.891e-739.68Death-associated protein kinase dapk-1 [Source:Un... [more]
dapk-11.897e-739.68Death-associated protein kinase dapk-1 [Source:Un... [more]
C45B2.66.608e-725.89pep chromosome:WBcel235:X:6053058:6057177:1 gene:W... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank2.405e-938.67gene:FBgn0011747 transcript:FBtr0089172[more]
Ank2.405e-938.67gene:FBgn0011747 transcript:FBtr0300497[more]
Ank2.405e-938.67gene:FBgn0011747 transcript:FBtr0089171[more]
Ank2.405e-938.67gene:FBgn0011747 transcript:FBtr0089173[more]
Ilk2.111e-732.00gene:FBgn0028427 transcript:FBtr0078305[more]
back to top
BLAST of SMED30007802 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rai143.099e-1039.73retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE... [more]
rai141.035e-941.67retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd23.912e-935.62ankyrin repeat domain 2 (stretch responsive muscle... [more]
ankrd52a1.098e-831.94ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a1.106e-831.94ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pan35.944e-1035.53poly(A) specific ribonuclease subunit PAN3 [Source... [more]
ilk7.311e-1038.67integrin linked kinase [Source:NCBI gene;Acc:10014... [more]
pan31.177e-935.53poly(A) specific ribonuclease subunit PAN3 [Source... [more]
egln11.419e-838.36egl-9 family hypoxia-inducible factor 1 [Source:Xe... [more]
psmd101.810e-838.03proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ilk7.893e-1036.00integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk1.041e-936.00integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk1.041e-936.00integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk2.344e-936.00integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Invs1.242e-831.25inversin [Source:MGI Symbol;Acc:MGI:1335082][more]
back to top
BLAST of SMED30007802 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13418|ILK_HUMAN7.014e-936.00Integrin-linked protein kinase OS=Homo sapiens OX=... [more]
sp|Q5R5V4|ILK_PONAB7.146e-936.00Integrin-linked protein kinase OS=Pongo abelii OX=... [more]
sp|P57044|ILK_CAVPO7.273e-936.00Integrin-linked protein kinase OS=Cavia porcellus ... [more]
sp|Q99J82|ILK_RAT7.281e-936.00Integrin-linked protein kinase OS=Rattus norvegicu... [more]
sp|O55222|ILK_MOUSE7.281e-936.00Integrin-linked protein kinase OS=Mus musculus OX=... [more]
back to top
BLAST of SMED30007802 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A2G3273.058e-1348.65Ankyrin repeat protein, putative OS=Trichomonas va... [more]
A2END78.419e-1344.74ANK_REP_REGION domain-containing protein OS=Tricho... [more]
A2FNS25.252e-1247.95Ankyrin repeat protein, putative OS=Trichomonas va... [more]
A2FU161.777e-1147.95Ankyrin repeat protein, putative OS=Trichomonas va... [more]
A0A0N4UVP23.786e-1143.84ANK_REP_REGION domain-containing protein OS=Entero... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acbd62.697e-938.71acyl-CoA binding domain containing 6 [Source:NCBI ... [more]
ankrd24.700e-834.25ankyrin repeat domain 2 [Source:NCBI gene;Acc:1030... [more]
ilk5.627e-836.00integrin linked kinase [Source:NCBI gene;Acc:10304... [more]
ilk5.949e-836.00integrin linked kinase [Source:NCBI gene;Acc:10304... [more]
psmd108.701e-833.82proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd6b4.293e-1028.75ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
invs1.239e-836.51inversin [Source:NCBI gene;Acc:245946][more]
invs1.408e-836.51inversin [Source:NCBI gene;Acc:245946][more]
gabpb2b1.834e-837.31GA binding protein transcription factor subunit be... [more]
ENSPMAT00000009608.13.250e-833.77pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007802 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445702.747e-939.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341617.653e-936.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341623.706e-836.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326495.324e-834.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358108.106e-838.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30007802 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018386.27.013e-1032.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000027359.17.687e-1032.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000036677.17.687e-1032.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000036692.18.151e-1032.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ankrd52a2.760e-830.60serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30007802 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017814.13.780e-6689.08SMESG000017814.1[more]
SMESG000042306.11.014e-6379.67SMESG000042306.1[more]
SMESG000018097.11.008e-6086.73SMESG000018097.1[more]
SMESG000054283.16.640e-5780.17SMESG000054283.1[more]
SMESG000006309.13.517e-5271.20SMESG000006309.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007802 ID=SMED30007802|Name=SMED30007802|organism=Schmidtea mediterranea sexual|type=transcript|length=697bp
TGAATGTGACATCAATGCTGGTGATCTACTAGGCAAGCAGCCCATTCATT
ACGCTTGTAAAGGTGGAAAACCAGAAATAGTTCAGATATTGATCAATAAT
AAATGTGACATCGATGCTCGTGATCAGGATGGCAAGCAGCCCATTCATTA
TGCAATCGATCGAGGCAATCCAGAAATTGTTCAGATATTGATCAATAATA
AATGCGAACTCAATGCTCTTGATGAGACGAACCAATGCTTCCAGAATGGA
TATCAGCACAAGAAGCCGATGAATGGCGCCGAGCGTGGAAGCGAGCGCGC
CCGTCTCGAGGAGCCACGTCCCAAAAGATCTTGTCCTACCCTATGGCAGA
TTCTGGGTCGGGAGAATGACCCCCGCAGGCCAAACGAAGAGCAGTATCCC
GCCGAGGAAATCCGCGACCACGCGAGAAACCTTCTTGCTCTGTGGGAGAA
GATTCAGGAAGAAGTCGATCTAAACGTGGTAAAGGCGAGGATGTACCTCG
CCAACGTTGAAGAGGACATCCTCGTCGGGCGCATTGCAGAGATTTACCCG
ACTCGACCGGCCCGCAATACTCGACGTCCAGTGCCCATCATCCCAGGATA
CTCTCCGGAAGAAGGGGTCAAGAAGTTTTTTGAAGAGTCATGAATCCCCG
ATCAAAACCATAAATAACAATTTACTTTAGTGATGTTGTTAATATCT
back to top

protein sequence of SMED30007802-orf-1

>SMED30007802-orf-1 ID=SMED30007802-orf-1|Name=SMED30007802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=214bp
ECDINAGDLLGKQPIHYACKGGKPEIVQILINNKCDIDARDQDGKQPIHY
AIDRGNPEIVQILINNKCELNALDETNQCFQNGYQHKKPMNGAERGSERA
RLEEPRPKRSCPTLWQILGRENDPRRPNEEQYPAEEIRDHARNLLALWEK
IQEEVDLNVVKARMYLANVEEDILVGRIAEIYPTRPARNTRRPVPIIPGY
SPEEGVKKFFEES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0031432titin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0014704intercalated disc
GO:0015629actin cytoskeleton
GO:0030016myofibril
Vocabulary: biological process
TermDefinition
GO:0009612response to mechanical stimulus