Small integral membrane protein 15
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30007798 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Homology
BLAST of Small integral membrane protein 15 vs. TrEMBL
Match: A0A504YWC9 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00975 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 4.562e-10 Identity = 39/93 (41.94%), Postives = 61/93 (65.59%), Query Frame = 1 Query: 67 MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRH 345 +SD K+ +++D + +W WF GL++VIY A DPW F TVL+ L P +SA+CA+KL KE+ +E++KK +AKR A ++K ++H Sbjct: 4 LSDSEKDPLSVDLGD--PPAEWSKWFAYIGLKLVIYVAKDPWGFFATVLIILTPLLGLSAFCAFKLAKEVQRQEEEKKLRAKRSAAIAKRQKH 94
BLAST of Small integral membrane protein 15 vs. TrEMBL
Match: G7YT92 (Small integral membrane protein 15 OS=Clonorchis sinensis OX=79923 GN=SMIM15 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 1.962e-9 Identity = 37/93 (39.78%), Postives = 58/93 (62.37%), Query Frame = 1 Query: 70 SDETKNKITLDHFNMTEA-KDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRH 345 ++ K +LD ++ + +DWK WF L+ +Y A DPW F TVL+ L P M+ A+CA+KL +E+ +E +KK KAKR A ++K+R+ Sbjct: 6 AENVKQTPSLDSLDLGDPPEDWKGWFAYMALKFTVYVAKDPWGFFGTVLMILTPLFMLGAFCAYKLAQELKKQEVEKKLKAKRSAAIAKSRKQ 98
BLAST of Small integral membrane protein 15 vs. TrEMBL
Match: A0A4S2LY99 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004197 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.277e-9 Identity = 36/93 (38.71%), Postives = 59/93 (63.44%), Query Frame = 1 Query: 70 SDETKNKITLDHFNMTEA-KDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRH 345 ++ K +LD ++ + +DW+ WF L+ +Y A DPW FL TVL+ + P M+ A+CA+KL +E+ +E +KK KAKR A ++K+R+ Sbjct: 6 AENVKQTPSLDSLDLGDPPEDWRGWFAYMALKFTVYVAKDPWGFLGTVLMIVTPLFMLGAFCAYKLAQELKKQEMEKKLKAKRSAAIAKSRKQ 98
BLAST of Small integral membrane protein 15 vs. TrEMBL
Match: A0A0X3Q5N5 (Small integral membrane protein 15 OS=Schistocephalus solidus OX=70667 GN=SIM15 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 7.278e-9 Identity = 34/93 (36.56%), Postives = 57/93 (61.29%), Query Frame = 1 Query: 67 MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRH 345 + D K++LD N+ +DW W L+ ++AA DPW F+ V++ + P ++SA C+WKL ++ + +KK+K +R+AN+SK RRH Sbjct: 20 LGDVLSKKLSLD--NIPVPQDWVGWLSYTCLKWAVFAAEDPWGFVGHVMMVVGPLFLVSAICSWKLANLLEKEAAEKKQKVRREANISKTRRH 110
BLAST of Small integral membrane protein 15 vs. TrEMBL
Match: A0A4E0RMW4 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_006438 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 9.641e-9 Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 1 Query: 127 DWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRH 345 +W WF GL++VIY A DPW F TVL+ L P +SA+CA+KL KE+ +E++KK +AKR A ++K ++H Sbjct: 22 EWSKWFAYIGLKLVIYVAKDPWGFFATVLIILTPLLGLSAFCAFKLAKEVQRQEEEKKLRAKRSAAIAKRQKH 94
BLAST of Small integral membrane protein 15 vs. Ensembl Cavefish
Match: smim15 (small integral membrane protein 15 [Source:NCBI gene;Acc:103033273]) HSP 1 Score: 42.743 bits (99), Expect = 6.680e-6 Identity = 29/72 (40.28%), Postives = 48/72 (66.67%), Query Frame = 1 Query: 127 DWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARR 342 D+K+W +V +AA DP+ FL TV++ L P + SA +WKL K I+ +++++K+K KR N++KA+R Sbjct: 3 DFKAW----AEYVVEWAAKDPYGFLTTVILALTPLFIASALLSWKLAKMIEARDREQKKKQKRQENIAKAKR 70
BLAST of Small integral membrane protein 15 vs. Planmine SMEST
Match: SMESG000017644.1 (SMESG000017644.1) HSP 1 Score: 163.31 bits (412), Expect = 9.285e-53 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 1 Query: 67 MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVXXXXXXXXXXXXXXXXXXNVSKARRHSNKKND 363 MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVKEIDHKEKDKKRKAKRDANVSKARRHSNKKND Sbjct: 1 MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVFLAPFCMISAYCAWKLVKEIDHKEKDKKRKAKRDANVSKARRHSNKKND 99 The following BLAST results are available for this feature:
BLAST of Small integral membrane protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Small integral membrane protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Small integral membrane protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 1
BLAST of Small integral membrane protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Small integral membrane protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30007798 ID=SMED30007798|Name=Small integral membrane protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=499bpback to top protein sequence of SMED30007798-orf-1 >SMED30007798-orf-1 ID=SMED30007798-orf-1|Name=SMED30007798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp MSDETKNKITLDHFNMTEAKDWKSWFFQKGLQIVIYAANDPWNFLITVLVback to top Annotated Terms
The following terms have been associated with this transcript:
|