Leucine, glutamate and lysine rich 1

Overview
NameLeucine, glutamate and lysine rich 1
Smed IDSMED30007783
Length (bp)2010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine, glutamate and lysine rich 1 (SMED30007783) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine, glutamate and lysine rich 1 (SMED30007783) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine, glutamate and lysine rich 1 (SMED30007783) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine, glutamate and lysine rich 1 (SMED30007783) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007783

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007783SMESG000052799.1 SmedASXL_005671SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007783SMESG000052799.1 dd_Smed_v4_16355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007783SMESG000052799.1 dd_Smed_v6_16355_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 56.9954 bits (136), Expect = 2.384e-9
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D + P H LP+EI+ +   E VC++CG+SYLI  E K +EE++ ++ K++K  Q S   EK+ + K
Sbjct:    1 MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 56.6102 bits (135), Expect = 4.662e-9
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D + P H LP+EI+ +   E VC++CG+SYLI  E K +EE++ ++ K++K  Q S   EK+ + K
Sbjct:    1 MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 56.6102 bits (135), Expect = 4.662e-9
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D + P H LP+EI+ +   E VC++CG+SYLI  E K +EE++ ++ K++K  Q S   EK+ + K
Sbjct:    1 MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 59.3066 bits (142), Expect = 4.975e-9
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D + P H LP+EI+ +   E VC++CG+SYLI  E K +EE++ ++ K++K  Q S   EK+ + K
Sbjct:    1 MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 55.8398 bits (133), Expect = 8.208e-9
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D + P H LP+EI+ +   E VC++CG+SYLI  E K +EE++ ++ K++K  Q S   EK+ + K
Sbjct:    1 MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Zebrafish
Match: CR626874.1 (pep chromosome:GRCz11:18:34667486:34836808:1 gene:ENSDARG00000100141.2 transcript:ENSDART00000163583.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR626874.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.215e-7
Identity = 21/57 (36.84%), Postives = 38/57 (66.67%), Query Frame = 3
Query:  192 PQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEK 362
            P +PLP+EI+ +  TE  C +CG+SYLI  E +RL+E +  + ++++ ++ S   E+
Sbjct:   22 PSYPLPQEIQQMDHTEKACRYCGVSYLILHEFQRLQEHLREVERELEQMRGSAERER 78          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Xenopus
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 55.0694 bits (131), Expect = 1.175e-8
Identity = 19/33 (57.58%), Postives = 28/33 (84.85%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLI 275
            +D++ P HPLP+EI+ +P  ETVC++CG+SYLI
Sbjct:   15 MDRHIPMHPLPEEIQKMPRDETVCKYCGVSYLI 47          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Xenopus
Match: LEKR1 (leucine, glutamate and lysine rich 1 [Source:HGNC Symbol;Acc:HGNC:33765])

HSP 1 Score: 53.5286 bits (127), Expect = 1.559e-7
Identity = 19/33 (57.58%), Postives = 28/33 (84.85%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLI 275
            +D++ P HPLP+EI+ +P  ETVC++CG+SYLI
Sbjct:   85 MDRHIPMHPLPEEIQKMPRDETVCKYCGVSYLI 117          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Mouse
Match: Lekr1 (leucine, glutamate and lysine rich 1 [Source:MGI Symbol;Acc:MGI:3645902])

HSP 1 Score: 59.6918 bits (143), Expect = 1.995e-10
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D++ P H LP+EI+ +   ETVC++CG+SYLI  E K +EE++ ++ +++K  Q S   EKK + K
Sbjct:    1 MDRHIPMHALPEEIQKMSPEETVCKYCGVSYLILHEFKAMEEKLKAVQEEMKFYQGSVEREKKLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Mouse
Match: Lekr1 (leucine, glutamate and lysine rich 1 [Source:MGI Symbol;Acc:MGI:3645902])

HSP 1 Score: 62.7734 bits (151), Expect = 1.017e-9
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHK 377
            +D++ P H LP+EI+ +   ETVC++CG+SYLI  E K +EE++ ++ +++K  Q S   EKK + K
Sbjct:    1 MDRHIPMHALPEEIQKMSPEETVCKYCGVSYLILHEFKAMEEKLKAVQEEMKFYQGSVEREKKLQEK 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Match: A0A3Q0JNC4 (Uncharacterized protein OS=Ciona intestinalis OX=7719 GN=LOC100183357 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.470e-13
Identity = 35/69 (50.72%), Postives = 53/69 (76.81%), Query Frame = 3
Query:  159 KNGNVLLDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKK 365
            K+ + +++++ PQHPLP ++K+LP  ETVC+FCG+SYLIH EIK+LEE +  L +++K  Q SE  E+K
Sbjct:    7 KSLSPIMERHTPQHPLPDDLKNLPNDETVCQFCGVSYLIHHEIKKLEEMVAHLEQELKFHQGSEEREQK 75          
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Match: V3ZJG8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_132470 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.337e-12
Identity = 30/52 (57.69%), Postives = 43/52 (82.69%), Query Frame = 3
Query:  180 DKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKN 335
            ++Y PQHPLP+EIK + + ETVC FCG+SYLIHSE+KRLE+ +  + K+++N
Sbjct:    8 ERYTPQHPLPEEIKKMSKDETVCHFCGVSYLIHSEMKRLEDRLKEIEKELEN 59          
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Match: A0A3M6U481 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010973 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.809e-11
Identity = 34/78 (43.59%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  126 WFQNLIMEKAHKNGNVLL----DKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQES 347
            WF +        N N LL    +++ P+HPLP EI+++P+ +TVC+FCG+SYLIHSE+K LEE +    +K++   ES
Sbjct:   31 WFSS--------NRNFLLCTVMERFIPEHPLPTEIREMPKDDTVCQFCGVSYLIHSEMKALEERVKEAERKMQYYVES 100          
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Match: A0A433TGR5 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_011457 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.611e-10
Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 3
Query:  186 YYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINE 359
            Y PQHPLP+EIK L   +TVC++CG+SYLIH+EIK LE+++  L K++  L+  E  E
Sbjct:   10 YTPQHPLPEEIKKLARDDTVCKYCGVSYLIHNEIKVLEDKLAKLEKELATLRGQEQRE 67          
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Match: A0A2B4SL81 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene6128 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.777e-10
Identity = 28/57 (49.12%), Postives = 45/57 (78.95%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQES 347
            ++++ P+HPLP EI+++P+ +TVC+FCG+SYLIHSE+K LEE +    +K++   ES
Sbjct:    1 MERFVPEHPLPTEIREMPKDDTVCQFCGVSYLIHSEMKALEERVKEAERKMQYYVES 57          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Cavefish
Match: ENSAMXT00000056772.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:27204366:27297664:-1 gene:ENSAMXG00000037577.1 transcript:ENSAMXT00000056772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.709e-9
Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLE 299
            L  Y P HPLP EI+ + +TET C++CG+SYLI  E +RL+
Sbjct:   14 LKMYKPSHPLPVEIQQMEQTETTCQYCGVSYLILHEFQRLQ 54          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Cavefish
Match: ENSAMXT00000038324.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:27152455:27297664:-1 gene:ENSAMXG00000037577.1 transcript:ENSAMXT00000038324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 2.943e-9
Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLE 299
            L  Y P HPLP EI+ + +TET C++CG+SYLI  E +RL+
Sbjct:   14 LKMYKPSHPLPVEIQQMEQTETTCQYCGVSYLILHEFQRLQ 54          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Cavefish
Match: ENSAMXT00000057803.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:27167561:27297664:-1 gene:ENSAMXG00000037577.1 transcript:ENSAMXT00000057803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 4.362e-9
Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLE 299
            L  Y P HPLP EI+ + +TET C++CG+SYLI  E +RL+
Sbjct:   14 LKMYKPSHPLPVEIQQMEQTETTCQYCGVSYLILHEFQRLQ 54          
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Nematostella
Match: EDO47829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA7])

HSP 1 Score: 73.1738 bits (178), Expect = 2.065e-13
Identity = 25/44 (56.82%), Postives = 39/44 (88.64%), Query Frame = 3
Query:  177 LDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEI 308
            L+++ P+HPLP+EI+++ + +TVC+FCG+SYLIHSE+K LEE +
Sbjct:    6 LNRHIPEHPLPQEIQEMKKDDTVCQFCGVSYLIHSEMKALEERV 49          

HSP 2 Score: 48.9062 bits (115), Expect = 7.015e-6
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 1599 IQELENEITDKEKIIDRMEEDLIRNNNEISSLKQMVQQECEERYELTESLNRAREQLLMIGEFSISKNP 1805
            +QELE  + D ++ I ++E +L  +  ++  L++ V++ECEER ELTE+L+ AR QLL     S+ +NP
Sbjct:  789 VQELEQTLDDADEHIKKIETELDGSKEQMMFLQETVRRECEERLELTEALSEARTQLL-----SLKRNP 852          
BLAST of Leucine, glutamate and lysine rich 1 vs. Planmine SMEST
Match: SMESG000052799.1 (SMESG000052799.1)

HSP 1 Score: 1014.99 bits (2623), Expect = 0.000e+0
Identity = 615/616 (99.84%), Postives = 615/616 (99.84%), Query Frame = 3
Query:  144 MEKAHKNGNVLLDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHKXXXXXXXXXXXXXXXXSLEESAFQLKTERDFLKNTVTEKEDLLITMQSSVQIWKADKDKLTEKRKQIFQYLFDLKQANRDLKDQLLADKSEIELNMSNERMKNQFAIANIASLIERIKETNHSEVDLYEKKLKIQNLEISKLQDXXXXXXXXXXXXXXXFAVIEDKNRKLLEENNKLEHKIQEQSLVITQKDDVIKLTTDSNHAMRSSKMADMNNIKSEMASLKKENQNLEDSLDQERKLKISLNAELESALGRLNGVSNIKENLEKQISLHEVENQTLLKKLEEIYENNQSTLKDRDKQIINXXXXXXXXXXXXXXXXXXXXXXXTKLEATFNLKSKVYEREIANQTNELQVLKEKLKVVEMENVNLEKMLIQCKNDNQEIQKQNDEFVRXXXXXXXXXXXXXXKIIQELENEITDKEKIIDRMEEDLIRNNNEISSLKQMVQQECEERYELTESLNRAREQLLMIGEFSISKNPISLPPIPPRXXXXXXXXXXXXXXQNSQKSLFQDKQNSSISQRKNSKNSLISTKRKLERLFNE 1991
            MEKAHKNGNVLLDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHKCQNLLNELEQCNLKCLSLEESAFQLKTERDFLKNTVTEKEDLLITMQSSVQIWKADKDKLTEKRKQIFQYLFDLKQANRDLKDQLLADKSEIELNMSNERMKNQFAIANIASLIERIKETNHSEVDLYEKKLKIQNLEISKLQDEVKKKKNELLEESEKFAVIEDKNRKLLEENNKLEHKIQEQSLVITQKDDVIKLTTDSNHAMRSSKMADMNNIKSEMASLKKENQNLEDSLDQERKLKISLNAELESALGRLNGVSNIKENLEKQISLHEVENQTLLKKLEEIYENNQSTLKDRDKQIINLKEQISELLLQLKSIQQLSQDSQTKLEATFNLKSKVYEREIANQTNELQVLKEKLKVVEMENVNLEKMLIQCKNDNQEIQKQNDEFVRQKNQQNFENEETQNKIIQELENEI DKEKIIDRMEEDLIRNNNEISSLKQMVQQECEERYELTESLNRAREQLLMIGEFSISKNPISLPPIPPRNSSSSTVSAKTNSSQNSQKSLFQDKQNSSISQRKNSKNSLISTKRKLERLFNE
Sbjct:    1 MEKAHKNGNVLLDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKRLEEEIISLNKKIKNLQESEINEKKYEHKCQNLLNELEQCNLKCLSLEESAFQLKTERDFLKNTVTEKEDLLITMQSSVQIWKADKDKLTEKRKQIFQYLFDLKQANRDLKDQLLADKSEIELNMSNERMKNQFAIANIASLIERIKETNHSEVDLYEKKLKIQNLEISKLQDEVKKKKNELLEESEKFAVIEDKNRKLLEENNKLEHKIQEQSLVITQKDDVIKLTTDSNHAMRSSKMADMNNIKSEMASLKKENQNLEDSLDQERKLKISLNAELESALGRLNGVSNIKENLEKQISLHEVENQTLLKKLEEIYENNQSTLKDRDKQIINLKEQISELLLQLKSIQQLSQDSQTKLEATFNLKSKVYEREIANQTNELQVLKEKLKVVEMENVNLEKMLIQCKNDNQEIQKQNDEFVRQKNQQNFENEETQNKIIQELENEIMDKEKIIDRMEEDLIRNNNEISSLKQMVQQECEERYELTESLNRAREQLLMIGEFSISKNPISLPPIPPRNSSSSTVSAKTNSSQNSQKSLFQDKQNSSISQRKNSKNSLISTKRKLERLFNE 616          
The following BLAST results are available for this feature:
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LEKR12.384e-940.30leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
LEKR14.662e-940.30leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
LEKR14.662e-940.30leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
LEKR14.975e-940.30leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
LEKR18.208e-940.30leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR626874.11.215e-736.84pep chromosome:GRCz11:18:34667486:34836808:1 gene:... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LEKR11.175e-857.58leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
LEKR11.559e-757.58leucine, glutamate and lysine rich 1 [Source:HGNC ... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lekr11.995e-1041.79leucine, glutamate and lysine rich 1 [Source:MGI S... [more]
Lekr11.017e-941.79leucine, glutamate and lysine rich 1 [Source:MGI S... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0JNC46.470e-1350.72Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
V3ZJG81.337e-1257.69Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3M6U4813.809e-1143.59Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A433TGR51.611e-1053.45Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A2B4SL811.777e-1049.12Uncharacterized protein OS=Stylophora pistillata O... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000056772.12.709e-953.66pep primary_assembly:Astyanax_mexicanus-2.0:18:272... [more]
ENSAMXT00000038324.12.943e-953.66pep primary_assembly:Astyanax_mexicanus-2.0:18:271... [more]
ENSAMXT00000057803.14.362e-953.66pep primary_assembly:Astyanax_mexicanus-2.0:18:271... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478292.065e-1356.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine, glutamate and lysine rich 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052799.10.000e+099.84SMESG000052799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007783 ID=SMED30007783|Name=Leucine, glutamate and lysine rich 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2010bp
CAAATTAAAAGTTTTACAATTAAAATTTTTAACAAAAGTTTTTATTAAAA
AAATAATTTTTGAATAAACATACTTACTTTTATCTGTCTATTGAATTTTG
ATAATTAATTGCAAACTTTTTATTTTGGTTTCAAAACTTAATCATGGAAA
AAGCTCATAAAAATGGAAATGTGCTTTTGGATAAATACTATCCTCAGCAT
CCTTTACCAAAAGAAATTAAAGATTTACCAGAAACAGAAACAGTTTGCGA
ATTTTGTGGAATCAGTTATTTAATTCATTCTGAAATCAAAAGATTAGAAG
AGGAAATTATTTCATTAAATAAAAAAATTAAAAATTTACAAGAATCAGAA
ATAAATGAAAAAAAGTATGAACATAAATGTCAAAATCTACTGAATGAGTT
GGAGCAGTGCAATTTAAAATGCCTATCTTTGGAAGAAAGCGCATTTCAAC
TGAAAACTGAAAGAGATTTTTTGAAAAATACCGTAACGGAGAAAGAAGAC
CTGCTAATCACAATGCAATCATCCGTTCAGATCTGGAAGGCTGACAAAGA
TAAATTAACAGAGAAAAGAAAACAGATTTTTCAATATTTATTCGATCTAA
AGCAAGCCAACAGAGATTTGAAAGATCAACTATTGGCGGACAAATCCGAG
ATTGAACTCAATATGTCAAATGAAAGAATGAAAAACCAGTTTGCAATTGC
CAATATTGCCAGTCTGATTGAACGAATCAAGGAAACCAATCATTCCGAAG
TAGATTTGTATGAGAAGAAGTTGAAAATCCAAAATTTGGAAATCAGCAAA
TTGCAAGATGAAGTGAAAAAGAAAAAGAATGAATTATTGGAAGAGTCTGA
AAAATTTGCAGTTATTGAAGATAAAAATAGAAAATTATTGGAAGAAAACA
ATAAATTGGAGCACAAAATTCAAGAACAGTCTTTAGTAATTACTCAAAAA
GATGATGTCATCAAGCTTACCACTGACTCCAATCATGCAATGAGATCTTC
CAAAATGGCTGACATGAACAACATCAAAAGTGAGATGGCTTCGTTGAAAA
AAGAAAATCAGAATCTAGAAGATTCATTGGATCAAGAGAGAAAATTAAAA
ATCTCTTTAAATGCGGAATTAGAATCAGCACTTGGGCGGCTAAATGGTGT
TTCCAACATTAAAGAAAACCTTGAAAAACAGATTTCATTACATGAAGTGG
AAAATCAGACTTTGTTGAAAAAGTTAGAAGAAATTTATGAAAATAATCAA
TCAACATTGAAGGATAGAGACAAACAAATAATAAATTTGAAAGAGCAAAT
TTCGGAACTTTTGTTGCAGTTAAAATCTATTCAGCAATTGTCTCAAGACT
CTCAAACTAAATTAGAAGCGACATTCAATTTGAAATCAAAAGTCTATGAA
AGGGAAATCGCAAATCAAACCAACGAATTACAGGTTTTGAAAGAAAAATT
GAAAGTGGTGGAGATGGAAAATGTGAATTTGGAGAAAATGCTTATTCAGT
GCAAAAATGACAATCAAGAAATTCAAAAACAGAATGATGAATTTGTGAGA
CAAAAAAATCAGCAAAACTTTGAGAATGAAGAAACTCAGAATAAGATTAT
TCAGGAATTGGAAAATGAAATAACGGATAAAGAGAAAATTATTGATAGAA
TGGAAGAGGATTTAATAAGAAATAACAATGAGATAAGTTCATTGAAACAA
ATGGTACAACAGGAGTGCGAAGAGAGATACGAATTGACGGAATCCCTGAA
TCGAGCAAGAGAGCAGTTGCTGATGATTGGGGAATTTAGTATCTCTAAGA
ACCCAATCAGTCTCCCGCCTATTCCGCCCAGAAATTCTTCCTCCAGCACA
GTGTCAGCTAAAACTAATTCCAGTCAAAATTCTCAGAAATCTTTATTCCA
AGATAAGCAAAATAGCTCAATTTCGCAACGGAAAAATTCAAAAAACTCAC
TTATATCGACGAAACGTAAATTAGAAAGACTTTTTAATGAATAAATGTTA
ATATGAGGTT
back to top

protein sequence of SMED30007783-orf-1

>SMED30007783-orf-1 ID=SMED30007783-orf-1|Name=SMED30007783-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=617bp
MEKAHKNGNVLLDKYYPQHPLPKEIKDLPETETVCEFCGISYLIHSEIKR
LEEEIISLNKKIKNLQESEINEKKYEHKCQNLLNELEQCNLKCLSLEESA
FQLKTERDFLKNTVTEKEDLLITMQSSVQIWKADKDKLTEKRKQIFQYLF
DLKQANRDLKDQLLADKSEIELNMSNERMKNQFAIANIASLIERIKETNH
SEVDLYEKKLKIQNLEISKLQDEVKKKKNELLEESEKFAVIEDKNRKLLE
ENNKLEHKIQEQSLVITQKDDVIKLTTDSNHAMRSSKMADMNNIKSEMAS
LKKENQNLEDSLDQERKLKISLNAELESALGRLNGVSNIKENLEKQISLH
EVENQTLLKKLEEIYENNQSTLKDRDKQIINLKEQISELLLQLKSIQQLS
QDSQTKLEATFNLKSKVYEREIANQTNELQVLKEKLKVVEMENVNLEKML
IQCKNDNQEIQKQNDEFVRQKNQQNFENEETQNKIIQELENEITDKEKII
DRMEEDLIRNNNEISSLKQMVQQECEERYELTESLNRAREQLLMIGEFSI
SKNPISLPPIPPRNSSSSTVSAKTNSSQNSQKSLFQDKQNSSISQRKNSK
NSLISTKRKLERLFNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038799LEKR1
IPR015155PFU
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 415..473
NoneNo IPR availableCOILSCoilCoilcoord: 284..360
NoneNo IPR availableCOILSCoilCoilcoord: 372..399
NoneNo IPR availableCOILSCoilCoilcoord: 48..99
NoneNo IPR availableCOILSCoilCoilcoord: 479..520
NoneNo IPR availableCOILSCoilCoilcoord: 203..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 555..616
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 562..601
IPR038799Leucine-, glutamate- and lysine-rich protein 1PANTHERPTHR34251FAMILY NOT NAMEDcoord: 17..497
coord: 471..602