Collagen alpha-6(VI) chain

Overview
NameCollagen alpha-6(VI) chain
Smed IDSMED30007780
Length (bp)1269
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen alpha-6(VI) chain (SMED30007780) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen alpha-6(VI) chain (SMED30007780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-6(VI) chain (SMED30007780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-6(VI) chain (SMED30007780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30007780SMESG000046770.1 SmedASXL_005416SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007780SMESG000046770.1 dd_Smed_v4_7616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007780SMESG000046770.1 Contig1823GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007780SMESG000046770.1 dd_Smed_v6_7616_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30007780SMESG000046770.1 dd_Smed_v6_7616_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30007780SMESG000046770.1 dd_Smed_v6_7616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30007780SMESG000046770.1 dd_Smed_v4_7616_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Match: COL6A6 (collagen type VI alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:27023])

HSP 1 Score: 120.168 bits (300), Expect = 1.850e-28
Identity = 100/375 (26.67%), Postives = 181/375 (48.27%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH----GIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVT 1227
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D F    +++  ++N +   G+T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++++ DLV LMD S SI   DF+  K F+A ++  F +     R+G   FSD    EF L   +   ++  +I++++++   T +G ALREV+  F P        G P  +L+LTDG +       + A  L+  G +I S+GIG  ++ ++L  I+   +K LTV++++ L+K  K +++ + 
Sbjct:  809 DVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDG-ANPVELLAMAGSSDKYF---FVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFKKMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQ--DEVAQAAEALRHRGIDIYSVGIG-DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNIC 1176          

HSP 2 Score: 117.472 bits (293), Expect = 1.668e-27
Identity = 99/373 (26.54%), Postives = 183/373 (49.06%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQK 1197
            S C   ++  +++L D S S  ++DF   K  + +++          R+  + + D   L F  +K+ N  D+ + ++N+R   G T  G AL  T   L    ++   +   ++++ T+G + +    P   A+ L++  +R+  +GI  E N+ +L  +A     +  V DF  L +   +++  +C        E CK  + D++ L+DSS SI   +F   K F+ +L+SK QIGP   ++G+V FSD  + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  I   ++++TDG      +  E A  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ+
Sbjct:  427 SGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEP---ANRLREEHIRVYAIGI-KEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICT------EEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVK--EPAVVLRQEGVIIYSVGV-FGSNVTQLEEISGRPEMVFYVENFDILQR 786          

HSP 3 Score: 83.5741 bits (205), Expect = 1.924e-16
Identity = 90/395 (22.78%), Postives = 180/395 (45.57%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENL------------VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPNMAI----TVADFQKLFENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVT 1227
            D VF+LD S + S  +F+  K  + + ++ +       R+  + + ++  +I +     N +++++ ++N+    G    G A+K   + +            VPQ+       ++   D  +NV  A    A +L+   V I T+GI G+   + E I        +    T AD     +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF+++     + L K I+++R++G  T  G AL     +  K    R + +P ++++LT+G +       E A++L+ E   + ++GI +  N  +L +I+  +K +  V+ ++ L+     V++ + 
Sbjct:  229 DVVFLLDMSINGSEENFDYLKGFLEESVSALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIA-----VLVTHRDSEDNVTKA----AVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSK--DSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEIC 611          

HSP 4 Score: 57.3806 bits (137), Expect = 4.562e-8
Identity = 58/211 (27.49%), Postives = 93/211 (44.08%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILIL--TDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAV 1224
            L+ I  H+ V  D  P      E  D+V L+DSS  +    F   K F+  +IS   I     RV L  +SD    EF  HL         + HLRK    +G +  +G AL+E    ++    +G      P  +++L  ++  +NV     E +  L+++G  IIS+G+ +    NLK +     +  + TV       +NM  ++K V
Sbjct:    8 LVIICSHISVNQDSGP------EYADVVFLVDSSDRLGSKSFPFVKMFITKMISSLPIEADKYRVALAQYSDKLHSEF--HLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPANGRDKKQFPPILVVLASSESEDNV----EEASKALRKDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDV 206          

HSP 5 Score: 55.8398 bits (133), Expect = 1.496e-7
Identity = 47/187 (25.13%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCV 660
            C   K D VF++D S SI  +DF+  K  +  ++     +    RI    F D     F    F    ++  Q++N++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   + I +VGIG +++ ++LI +  +    +TV +F +L +   +I+ ++C 
Sbjct:  994 CEIDKVDLVFLMDGSTSIQPNDFKKMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQ--AAEALRHRGIDIYSVGIG-DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1177          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Match: COL6A5 (collagen type VI alpha 5 chain [Source:HGNC Symbol;Acc:HGNC:26674])

HSP 1 Score: 100.908 bits (250), Expect = 4.241e-22
Identity = 95/377 (25.20%), Postives = 174/377 (46.15%), Query Frame = 1
Query:   70 ISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVA-DFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR---RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKIL 1167
            IS     +  + T      + D  F++D S SI    FE  KR ++++           R+  + + DD  + F    + N  D+ + + N++   G T  GKAL    + +   M+    +   Y+I+ TDG +    V PA  + A+      + +  VGIG+  NK EL  +A     ++   +F  L     +++  +C        + C+  + D++ L+DSS SI   +F   K F+ +L++K QIG   T++G+V FSD  + EF L+    + ++ + I  +  +   T  G AL  V  +++ H    R G    ++++TDG      R  + A  L+ +   I S+G+  + N  +L +IS +  ++
Sbjct:  421 ISTYAEQRNLDKTGCVDTKEADIHFLIDGSSSIQEKQFEQIKRFMLEVTEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSKVPCYLIVLTDGMSTDRVVEPAKRLRAEQ-----ITVHAVGIGA-ANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICA------EKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG-QYFTHSKGARLGAKKFLILITDGVAQDDVR--DPARILRGKDVTIFSVGV-YNANRSQLEEISGDSSLV 781          

HSP 2 Score: 97.8265 bits (242), Expect = 5.552e-21
Identity = 96/388 (24.74%), Postives = 181/388 (46.65%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDGT--NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNI----LILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVTC 1230
            A   C   K D +F++D+S SI + +F   K  +  ++T I+      +I  + F D     F  +++    ++   +  +   N  T  GKAL     Y       R  A++++IL TDG   ++V     I    L+   V I +VG+    N+ +L  ++   ++   V +F  L     K+I  VC + D      CK +   D+V ++D S SI     +       HL+ K  +G    + G + +SD P I F L+   +R+ ++E ++  R  G  T    AL+     F       I  N+    +++TDG ++   + ++ A +L+ +G  I ++G+G+  N KEL  ++ N +  + V+++++L K++ T+++   C
Sbjct:  618 AEKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGAKKFLILITDGVAQDDVRDPARI----LRGKDVTIFSVGV-YNANRSQLEEISGDSSLVFHVENFDHLKALERKLIFRVCALHD------CKRITLLDVVFVLDHSGSIKKQYQDHMINLTIHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALFTEEHGSRIKQNVKQMLIVITDGESHDHDQLNDTALELRNKGITIFAVGVGK-ANQKELEGMAGNKNNTIYVDNFDKL-KDVFTLVQERMC 992          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Match: COL6A5 (collagen type VI alpha 5 chain [Source:HGNC Symbol;Acc:HGNC:26674])

HSP 1 Score: 100.908 bits (250), Expect = 4.521e-22
Identity = 95/377 (25.20%), Postives = 174/377 (46.15%), Query Frame = 1
Query:   70 ISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVA-DFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR---RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKIL 1167
            IS     +  + T      + D  F++D S SI    FE  KR ++++           R+  + + DD  + F    + N  D+ + + N++   G T  GKAL    + +   M+    +   Y+I+ TDG +    V PA  + A+      + +  VGIG+  NK EL  +A     ++   +F  L     +++  +C        + C+  + D++ L+DSS SI   +F   K F+ +L++K QIG   T++G+V FSD  + EF L+    + ++ + I  +  +   T  G AL  V  +++ H    R G    ++++TDG      R  + A  L+ +   I S+G+  + N  +L +IS +  ++
Sbjct:  421 ISTYAEQRNLDKTGCVDTKEADIHFLIDGSSSIQEKQFEQIKRFMLEVTEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSKVPCYLIVLTDGMSTDRVVEPAKRLRAEQ-----ITVHAVGIGA-ANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICA------EKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG-QYFTHSKGARLGAKKFLILITDGVAQDDVR--DPARILRGKDVTIFSVGV-YNANRSQLEEISGDSSLV 781          

HSP 2 Score: 97.8265 bits (242), Expect = 5.759e-21
Identity = 96/388 (24.74%), Postives = 181/388 (46.65%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDGT--NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNI----LILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVTC 1230
            A   C   K D +F++D+S SI + +F   K  +  ++T I+      +I  + F D     F  +++    ++   +  +   N  T  GKAL     Y       R  A++++IL TDG   ++V     I    L+   V I +VG+    N+ +L  ++   ++   V +F  L     K+I  VC + D      CK +   D+V ++D S SI     +       HL+ K  +G    + G + +SD P I F L+   +R+ ++E ++  R  G  T    AL+     F       I  N+    +++TDG ++   + ++ A +L+ +G  I ++G+G+  N KEL  ++ N +  + V+++++L K++ T+++   C
Sbjct:  618 AEKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGAKKFLILITDGVAQDDVRDPARI----LRGKDVTIFSVGV-YNANRSQLEEISGDSSLVFHVENFDHLKALERKLIFRVCALHD------CKRITLLDVVFVLDHSGSIKKQYQDHMINLTIHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALFTEEHGSRIKQNVKQMLIVITDGESHDHDQLNDTALELRNKGITIFAVGVGK-ANQKELEGMAGNKNNTIYVDNFDKL-KDVFTLVQERMC 992          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24709])

HSP 1 Score: 91.6633 bits (226), Expect = 1.632e-19
Identity = 75/311 (24.12%), Postives = 135/311 (43.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH---GIPFNILILTDG 1029
            D +F+LD+S   +   F  AK  + + +  + + ++  R+    +  +  +     +++++ D+V  +  +    G T  G AL+   E       +  Q    R V+L T+  +      PA +  A  L       L +G+GSE  + EL  +  SP   +  +D Q LF  + ++   +C    P     C+ +  DLV ++D+S S+   +F   + FV     +F++ P  T+VGLV +    +  F L     R  +L  I     LG     G AL  +  K    +R    G+P  +++LT G
Sbjct:   39 DLLFLLDSSAGTTLDGFLRAKVFVKRFVRAVLSEDSRARVGVATYSRELLVAVPVGEYQDVPDLVWSLDGIPFRGGPTLTGSALRQAAERGFGSATRTGQDRPRRVVVLLTESHSEDEVAGPARHARAREL-------LLLGVGSEAVRAELEEITGSPKHVMVYSDPQDLFNQIPELQGKLCSRQRP----GCRTQALDLVFMLDTSASVGPENFAQMQSFVRSCALQFEVNPDVTQVGLVVYGSQVQTAFGLDTKPTRAAMLRAISQAPYLGGVGSAGTALLHIYDKVMTVQRGARPGVPKAVVVLTGG 338          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24709])

HSP 1 Score: 91.2781 bits (225), Expect = 5.137e-19
Identity = 75/311 (24.12%), Postives = 135/311 (43.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH---GIPFNILILTDG 1029
            D +F+LD+S   +   F  AK  + + +  + + ++  R+    +  +  +     +++++ D+V  +  +    G T  G AL+   E       +  Q    R V+L T+  +      PA +  A  L       L +G+GSE  + EL  +  SP   +  +D Q LF  + ++   +C    P     C+ +  DLV ++D+S S+   +F   + FV     +F++ P  T+VGLV +    +  F L     R  +L  I     LG     G AL  +  K    +R    G+P  +++LT G
Sbjct:  343 DLLFLLDSSAGTTLDGFLRAKVFVKRFVRAVLSEDSRARVGVATYSRELLVAVPVGEYQDVPDLVWSLDGIPFRGGPTLTGSALRQAAERGFGSATRTGQDRPRRVVVLLTESHSEDEVAGPARHARAREL-------LLLGVGSEAVRAELEEITGSPKHVMVYSDPQDLFNQIPELQGKLCSRQRP----GCRTQALDLVFMLDTSASVGPENFAQMQSFVRSCALQFEVNPDVTQVGLVVYGSQVQTAFGLDTKPTRAAMLRAISQAPYLGGVGSAGTALLHIYDKVMTVQRGARPGVPKAVVVLTGG 642          

HSP 2 Score: 57.3806 bits (137), Expect = 3.614e-8
Identity = 47/179 (26.26%), Postives = 80/179 (44.69%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHG-IPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGI----------------GRHINLKELTDISSNDKILTVNS 1179
            D++ L+D S S+    FE  K F   +     I P+  RVG   FS  P +EF L     + +V  +IK +   G  T   LAL+ +  +  P  R+  +P  ++I+TDG +      P     + +LK  G  + ++G+                G+H+ L E  + ++N    T++S
Sbjct:   51 DIMFLLDGSNSVGKGSFERSKHFAITVCDGLDISPERVRVGAFQFSSTPHLEFPLDSFSTQQEVKARIKRMVFKGGRTETELALKYLLHRGLPGGRNASVPQILIIVTDGKSQGDVALP-----SKQLKERGVTVFAVGVRFPRWEELHALASEPRGQHVLLAEQVEDATNGLFSTLSS 224          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Match: cutl-23 (CUTiclin-Like [Source:UniProtKB/TrEMBL;Acc:A0A168H2V5])

HSP 1 Score: 86.6557 bits (213), Expect = 5.247e-18
Identity = 92/364 (25.27%), Postives = 170/364 (46.70%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENL-VP--QMRKDA-QRYVILFTDGTNNVFPAPYIYADHLKD--ASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPC---KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH--LVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKFWPHR------RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRH--INLKELTDISSNDK 1161
            D VFILD+S S+    F+    +I +++  +       R+  I F     L FNF+KF +  +++  +  +R+ +G T IG A +   + L  P   +R     + V L +DG  + FP  +  AD L+    ++ I   G G  +    L N   S    +T  + QKL     K  +H   I +  P+  C     +  DL +++D+S+S+     +  K  V  ++    I P+A RV L+++S    + F  +  L   N  ++  +K++R +   T   +AL +  F     +      R G+P   L+LTDG+++  P+  +I+ K++  G  +I++ +     ++  EL  I+ ++K
Sbjct:   54 DLVFILDSSGSLRDK-FQDEIDIIRRILKHVTIGKTATRVMLIQFSGTQHLEFNFEKFTDREELLAALDVLRHVSGITRIGGAFEFALQQLKTPGSGLRDGTVPKIVYLLSDGRTHDFPKDWQMADILRREIPNIDIWAYGTGDYVAMAALANYTQSEQKIVTNLNLQKLEPQFEK--YHGTEICEQQPS--CVKGSDKPLDLALVVDASESLDHLFSDQKKFLVERVLGNINIHPEAVRVALITYSGQAFVHFKFNSFLYGNNTSVQGFVKNIRSIKGTTATNVALMDA-FDLLTSKDPSIGVREGVPKMALVLTDGHSHKSPK--DISEKMRAAGIIMIAVSVTPRPLVDEAELRLIAGSEK 409          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Match: mup-4 (Transmembrane matrix receptor MUP-4 [Source:UniProtKB/Swiss-Prot;Acc:Q21281])

HSP 1 Score: 82.0333 bits (201), Expect = 2.463e-16
Identity = 62/203 (30.54%), Postives = 99/203 (48.77%), Query Frame = 1
Query:  652 VCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGK-RFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN-----ILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            VC +    P +P      DLV L+D S SI    F+    RF+A     F I P+ TRV +V +SD  R EF L +  DR  +   I+++  L   T  G A+  V  + +  RR   P        +++TDG   +NV  RP + A   +R+   + ++G+  H+   EL +IS S D+   V+ +E L   +++ ++ V C
Sbjct:  424 VCTLSTACPAQP-----TDLVFLIDGSGSIGSYVFQTEVLRFLAEFTELFDIAPQKTRVSVVQYSDQIRHEFGLDNYSDRKSLQNAIRNIEYLTGLTRTGAAIEHVANEAFSERRGARPVGQVSRVAIVITDGRSQDNV-TRPSDNA---RRQDIQLFAVGVTNHVLDAELEEISGSKDRTFHVSGFEDLNTRLRSAIQRVAC 617          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Match: dig-1 (Mesocentin [Source:UniProtKB/Swiss-Prot;Acc:Q09165])

HSP 1 Score: 77.411 bits (189), Expect = 8.039e-15
Identity = 84/407 (20.64%), Postives = 172/407 (42.26%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMT-FIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLK----DASVRILTVGIGSEINKKELINLASPNMAITVADFQKL-FENLMKIIHHVCVIVD--------PIPNEPCKVE------------QQDLVVLMDSSKSISGPDFEIGKRFVAHLI-SKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGL-ALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLK-REGANIISLGIGRH----INLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG*TKFMN 1251
            D + ++D+S +I   D+ + K +I   +T          R+  + +GD A +  +   + N +D+V ++   R   G   +G  L+   + L         + V++  +G      A   Y+  +K    + +V +  V  G + ++++   L   +  I ++ ++    E L  I  ++C IV         P P                   + D+++++DSS++ +  +F   K  VA ++ + F + P  +++G V +SD   +   L H  D+ ++LEKI    K+     + L  L   + +F  H R      ++++T+G N         A  L+   G  + ++ +G +      +K L   S+ + ++ V     +  +   +LKAV CG T   N
Sbjct: 12167 DLLLVIDSSNNIKVLDYRVMKELIKNFLTEHFNLRKHQVRVGLVKYGDGAEIPVSLGDYDNEDDLVHRISESRRLKGRAQLGAGLREALDELSISGVDGVPQIVLIVKNGK-----ASDDYSSAVKSLKAERNVTVFVVDAGDDESQQQNSELTEEDKTIVISQWRGADSEVLGPIADYICKIVPNVETSRTWPTPRTKATTTSGTGRSCSSIDYESDVIIVLDSSENFTPDEFVSMKDAVASIVDTGFDLAPDVSKIGFVIYSDKVAVPVALGHYEDKIELLEKITDAEKINDGVAIALYGLNAARQQFQLHGRENATKVVILITNGKNR--GNAAAAAEDLRDMYGVQLFAVAVGSNPEELATIKRLVGNSNTENVIEVAQSTEIDDDAAALLKAV-CGNTSPKN 12565          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Match: dig-1 (Mesocentin [Source:UniProtKB/Swiss-Prot;Acc:Q09165])

HSP 1 Score: 77.411 bits (189), Expect = 8.039e-15
Identity = 84/407 (20.64%), Postives = 172/407 (42.26%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMT-FIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLK----DASVRILTVGIGSEINKKELINLASPNMAITVADFQKL-FENLMKIIHHVCVIVD--------PIPNEPCKVE------------QQDLVVLMDSSKSISGPDFEIGKRFVAHLI-SKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGL-ALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLK-REGANIISLGIGRH----INLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG*TKFMN 1251
            D + ++D+S +I   D+ + K +I   +T          R+  + +GD A +  +   + N +D+V ++   R   G   +G  L+   + L         + V++  +G      A   Y+  +K    + +V +  V  G + ++++   L   +  I ++ ++    E L  I  ++C IV         P P                   + D+++++DSS++ +  +F   K  VA ++ + F + P  +++G V +SD   +   L H  D+ ++LEKI    K+     + L  L   + +F  H R      ++++T+G N         A  L+   G  + ++ +G +      +K L   S+ + ++ V     +  +   +LKAV CG T   N
Sbjct: 12167 DLLLVIDSSNNIKVLDYRVMKELIKNFLTEHFNLRKHQVRVGLVKYGDGAEIPVSLGDYDNEDDLVHRISESRRLKGRAQLGAGLREALDELSISGVDGVPQIVLIVKNGK-----ASDDYSSAVKSLKAERNVTVFVVDAGDDESQQQNSELTEEDKTIVISQWRGADSEVLGPIADYICKIVPNVETSRTWPTPRTKATTTSGTGRSCSSIDYESDVIIVLDSSENFTPDEFVSMKDAVASIVDTGFDLAPDVSKIGFVIYSDKVAVPVALGHYEDKIELLEKITDAEKINDGVAIALYGLNAARQQFQLHGRENATKVVILITNGKNR--GNAAAAAEDLRDMYGVQLFAVAVGSNPEELATIKRLVGNSNTENVIEVAQSTEIDDDAAALLKAV-CGNTSPKN 12565          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Match: mua-3 (Transmembrane cell adhesion receptor mua-3 [Source:UniProtKB/Swiss-Prot;Acc:P34576])

HSP 1 Score: 75.485 bits (184), Expect = 3.698e-14
Identity = 60/192 (31.25%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  688 CKVEQQDLVVLMDSSKSISGPDFEIGK-RFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN------ILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            C  ++ DLV L+D S SI    F+    RFV   +  F+IG   TRVGL+ +SD  R EFDL    DR+ +L+ I   + L   T  G A++ +  + +  RR   P         +ILTDG   +NV   P + A KL     N  ++G+  H+   EL  I+ S ++   V+ ++ L   ++++++   C
Sbjct:  640 CPKQKTDLVFLIDGSGSIGSYVFKNEVLRFVREFVELFEIGRSKTRVGLIQYSDQIRHEFDLDQYGDRDSLLKGISETQYLTGLTRTGAAIQHMVQEGFSERRGARPQQSDIARVAIILTDGRSQDNV-TGPADSARKLS---INTFAIGVTDHVLASELESIAGSPNRWFYVDKFKDLDTRLRSMIQKAAC 827          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Match: col6a4a (collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-041111-303])

HSP 1 Score: 102.449 bits (254), Expect = 9.604e-23
Identity = 94/376 (25.00%), Postives = 181/376 (48.14%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISF--IVFGDDATLIFNFDKFKNLNDMVRQVKNVRND--NGATAIGKALKLTY--ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREV----QFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAV 1224
            D +F++  ++ I   DFE  K  ++ ++    T   DN I F  IV+ D  +  F+ +++     +   + ++++   +G TA   A  LTY  E    + ++   + + + TDG           AD      + +  +G+    + +  I   S N    V ++  L +  M +   +C    P+    C+ E  DLV L+D S+SIS   +     F+ +++ K +IGP+  RVG+  FS   + EF ++   D + V   I+ + ++   T +G AL  V    Q      ++ G+P N++++TDG ++   R +E A +L+  G N+ ++GIG  ++L++L+ I+ S D++  V ++  L     T + A+
Sbjct:  995 DVIFLVQCTRQIRLQDFEKIKSFLISVVN--STQIGDNLIRFGVIVYSDTPSQ-FSLNQYNTRRQIAEAITSLKSPAVSGYTARALAYSLTYFTEANGGRQKRGVPQMLFMITDGDARDRENLRARADEFAAKQINVYGIGVARAQDSELEIITKSKNKIFHVNNYDNLQDLQMNVSGVLCNATKPV----CQNEVADLVFLIDGSESISEESWITVIAFLLNVVDKLRIGPELFRVGIAQFSSVYQKEFYMNEYKDADGVKSAIRRITQIKEGTLIGKALSNVVEFFQEDKGSRKQSGVPQNLVLITDGVSS--DRVNEAADQLRNLGINVFAIGIG-AVSLQQLSYIAGSPDRLFKVQNFNYLNLTTATFVDAL 1360          

HSP 2 Score: 95.5153 bits (236), Expect = 1.835e-20
Identity = 98/366 (26.78%), Postives = 174/366 (47.54%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD----AQRYVILFTDGTN-NVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMK--IIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQ--FKFWPHRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERL 1191
            D  F+LD S S + +DFE  K+ I+  +          R+  +    + TL F+  + KN       V+ +    G +  GKALK    +L  Q +       Q  +I+ TD T+ +    P   A+ L+   V +  +G+  + ++ EL+ + A       V ++  L  N++K  I+  +C        E CK +  D++ L+D S SI GPDF   K F+  +++   IG  +  VG+V FS++P+ +F L+   D+N++ E I  + +L   T  G AL  +   F      R  +P  ++++TDG  ++    P   A  ++ +G  I S+G+   +N  +L +IS + DK+     ++ L
Sbjct:  622 DIYFLLDNSGS-TRADFEDVKKFILGSLQLFNIGPNRVRVGVVKVDRNPTLQFSLTEHKNRASFEAAVRGISQPVGGSEKGKALKYV-ASLFNQAKASRPAKVQEILIVITDKTSQDDVGDP---AEELRIQGVSVYAIGV-KDASQDELLKMTADETKDFYVTNYDAL--NVLKREIVTDIC------SQEACKNKVADIMFLIDGSSSIYGPDFTSMKTFITKVVNGTIIGEDSVHVGVVQFSNNPQEQFPLNRYFDQNELEEAIDGIEQLTGDTYTGKALSFISKYFDASNGGRPDVPQFLVVITDGEAHDAVAVP---AKAIRDKGVTIFSIGVA-SVNTTQLWEISGTQDKVYVQRDFDAL 969          

HSP 3 Score: 91.6633 bits (226), Expect = 2.915e-19
Identity = 81/289 (28.03%), Postives = 132/289 (45.67%), Query Frame = 1
Query:   91 KVYEATSSC-SWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD-----AQRYVILFTDGTNN----------VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKII-------------HHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL 870
            +V+  T  C S    D VFI+D S SI+ ++FEL KR + ++++ ++  +   R+  +++ D  +  F  D F N ND++  +K +    G TA G ALK    NL  Q R        ++  I+ TDG +                 +YA  +K+ASV  L   IGS    + + N+ S  M  ++   + L ++L K++                CV            E+ D+  L+D+S S    DFE  K+F+   +  F IGP   RVG+V    +P ++F L
Sbjct:  401 EVFNVTGDCRSAQVADIVFIVDESGSITRNNFELIKRFLHRIISGLEVNSDSVRVGMVLYNDRPSAEFYLDTFANKNDIMNYIKIIPYRGGGTATGAALKFAQNNLFTQKRGSRKALGVKQIAIVMTDGESEDDVTTTAAELRRSGVTVYALGVKNASVEELK-KIGSYPEHEFVFNVGSFLMLSSLE--KSLRKSLCKVVVNRRFDKNNRLLLKQGCV----------NTEEADIYFLLDNSGSTRA-DFEDVKKFILGSLQLFNIGPNRVRVGVVKVDRNPTLQFSL 675          

HSP 4 Score: 61.2326 bits (147), Expect = 1.697e-9
Identity = 67/287 (23.34%), Postives = 127/287 (44.25%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNR---ISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEF---DLHLVDR-----NKVLEKIKHLRKLGSA 933
            D VF++D+S SI + DF   + V   M TF+     D +   +  + F  D    F   ++ N  ++ R++ N+    G T +GKA+    +N        ++ +   + V++ TDG + +    P   A+ L+   + I  +G+GS  N  EL  +AS       + + ++Q L      +   VCV++     +    +  D+ VL+DS+    G   +I +  +  L+ +  +G  + ++ L  F ++   EF   D     +     N+   ++   RKLG A
Sbjct:   35 DIVFLVDSSSSIGTRDF---REVKTFMHTFVDGLEIDTKKVQVGVVQFSTDPHKEFLLGEYANKAELFRKIDNLPYRTGGTYMGKAMNFLKDNYFTSAGGSRVSEKVPQVVVVITDGDSTDDIKGP---AEDLRKKGIIIFAIGVGS-TNMTELKAIASTPPERFVVNIDNYQALQGLTTTMKETVCVLMRD-QGKALAPKFTDVFVLVDSTA--QGETQQI-RELLNRLLVQLNVGDGSNKIALAQFGENVVKEFLFKDYQTAQKAREFINRFEPRLNGERKLGKA 310          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Match: col6a4a (collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-041111-303])

HSP 1 Score: 102.064 bits (253), Expect = 1.460e-22
Identity = 94/377 (24.93%), Postives = 181/377 (48.01%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISF--IVFGDDATLIFNFDKFKNLNDMVRQVKNVRND--NGATAIGKALKLTY--ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREV----QFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVT 1227
            D +F++  ++ I   DFE  K  ++ ++    T   DN I F  IV+ D  +  F+ +++     +   + ++++   +G TA   A  LTY  E    + ++   + + + TDG           AD      + +  +G+    + +  I   S N    V ++  L +  M +   +C    P+    C+ E  DLV L+D S+SIS   +     F+ +++ K +IGP+  RVG+  FS   + EF ++   D + V   I+ + ++   T +G AL  V    Q      ++ G+P N++++TDG ++   R +E A +L+  G N+ ++GIG  ++L++L+ I+ S D++  V ++  L     T + A+ 
Sbjct:  970 DVIFLVQCTRQIRLQDFEKIKSFLISVVN--STQIGDNLIRFGVIVYSDTPSQ-FSLNQYNTRRQIAEAITSLKSPAVSGYTARALAYSLTYFTEANGGRQKRGVPQMLFMITDGDARDRENLRARADEFAAKQINVYGIGVARAQDSELEIITKSKNKIFHVNNYDNLQDLQMNVSGVLCNATKPV----CQNEVADLVFLIDGSESISEESWITVIAFLLNVVDKLRIGPELFRVGIAQFSSVYQKEFYMNEYKDADGVKSAIRRITQIKEGTLIGKALSNVVEFFQEDKGSRKQSGVPQNLVLITDGVSS--DRVNEAADQLRNLGINVFAIGIG-AVSLQQLSYIAGSPDRLFKVQNFNYLNLTTATFVDALC 1336          

HSP 2 Score: 95.5153 bits (236), Expect = 2.079e-20
Identity = 95/363 (26.17%), Postives = 171/363 (47.11%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD----AQRYVILFTDGTN-NVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQ--FKFWPHRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERL 1191
            D  F+LD S S + +DFE  K+ I+  +          R+  +    + TL F+  + KN       V+ +    G +  GKALK    +L  Q +       Q  +I+ TD T+ +    P   A+ L+   V +  +G+  + ++ EL+ +     A    DF     + + ++    ++ D    E CK +  D++ L+D S SI GPDF   K F+  +++   IG  +  VG+V FS++P+ +F L+   D+N++ E I  + +L   T  G AL  +   F      R  +P  ++++TDG  ++    P   A  ++ +G  I S+G+   +N  +L +IS + DK+     ++ L
Sbjct:  597 DIYFLLDNSGS-TRADFEDVKKFILGSLQLFNIGPNRVRVGVVKVDRNPTLQFSLTEHKNRASFEAAVRGISQPVGGSEKGKALKYV-ASLFNQAKASRPAKVQEILIVITDKTSQDDVGDP---AEELRIQGVSVYAIGV-KDASQDELLKMT----ADETKDFYVTNYDALNVLKRE-IVTDICSQEACKNKVADIMFLIDGSSSIYGPDFTSMKTFITKVVNGTIIGEDSVHVGVVQFSNNPQEQFPLNRYFDQNELEEAIDGIEQLTGDTYTGKALSFISKYFDASNGGRPDVPQFLVVITDGEAHDAVAVP---AKAIRDKGVTIFSIGVA-SVNTTQLWEISGTQDKVYVQRDFDAL 944          

HSP 3 Score: 92.0485 bits (227), Expect = 2.450e-19
Identity = 81/289 (28.03%), Postives = 132/289 (45.67%), Query Frame = 1
Query:   91 KVYEATSSC-SWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD-----AQRYVILFTDGTNN----------VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKII-------------HHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL 870
            +V+  T  C S    D VFI+D S SI+ ++FEL KR + ++++ ++  +   R+  +++ D  +  F  D F N ND++  +K +    G TA G ALK    NL  Q R        ++  I+ TDG +                 +YA  +K+ASV  L   IGS    + + N+ S  M  ++   + L ++L K++                CV            E+ D+  L+D+S S    DFE  K+F+   +  F IGP   RVG+V    +P ++F L
Sbjct:  376 EVFNVTGDCRSAQVADIVFIVDESGSITRNNFELIKRFLHRIISGLEVNSDSVRVGMVLYNDRPSAEFYLDTFANKNDIMNYIKIIPYRGGGTATGAALKFAQNNLFTQKRGSRKALGVKQIAIVMTDGESEDDVTTTAAELRRSGVTVYALGVKNASVEELKK-IGSYPEHEFVFNVGSFLMLSSLE--KSLRKSLCKVVVNRRFDKNNRLLLKQGCV----------NTEEADIYFLLDNSGSTRA-DFEDVKKFILGSLQLFNIGPNRVRVGVVKVDRNPTLQFSL 650          

HSP 4 Score: 61.2326 bits (147), Expect = 1.653e-9
Identity = 67/287 (23.34%), Postives = 127/287 (44.25%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNR---ISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEF---DLHLVDR-----NKVLEKIKHLRKLGSA 933
            D VF++D+S SI + DF   + V   M TF+     D +   +  + F  D    F   ++ N  ++ R++ N+    G T +GKA+    +N        ++ +   + V++ TDG + +    P   A+ L+   + I  +G+GS  N  EL  +AS       + + ++Q L      +   VCV++     +    +  D+ VL+DS+    G   +I +  +  L+ +  +G  + ++ L  F ++   EF   D     +     N+   ++   RKLG A
Sbjct:   10 DIVFLVDSSSSIGTRDF---REVKTFMHTFVDGLEIDTKKVQVGVVQFSTDPHKEFLLGEYANKAELFRKIDNLPYRTGGTYMGKAMNFLKDNYFTSAGGSRVSEKVPQVVVVITDGDSTDDIKGP---AEDLRKKGIIIFAIGVGS-TNMTELKAIASTPPERFVVNIDNYQALQGLTTTMKETVCVLMRD-QGKALAPKFTDVFVLVDSTA--QGETQQI-RELLNRLLVQLNVGDGSNKIALAQFGENVVKEFLFKDYQTAQKAREFINRFEPRLNGERKLGKA 285          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Match: si:ch211-62a1.3 (si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-41])

HSP 1 Score: 98.5969 bits (244), Expect = 1.853e-21
Identity = 93/399 (23.31%), Postives = 183/399 (45.86%), Query Frame = 1
Query:  112 SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENL--VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVAD-FQKLFENLMKIIHHVCVIVDPIPNEPCKV-EQQDLVVLMDSSK--SISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLG----SATGLGLALREVQFKFWPHRRHGIPFNILILTDG----YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTCG*TKFMNRIE 1260
             C     D VF++D S S+S+ DFE  K ++  ++      +   R++ + +G +    F+ + F N + ++++++N+R   G T  GKAL    ++       R  A +++I  TDG +    A  + A  L+D S+    +G+    N+ +++ +A  +  +   D    L E   +++  +C       N  CK  E  D++ L+D+S   +I G    I    + H++ K  +  K  R G +++S+ P++EF L     +  V+  I  LR LG    +A  L  +L          R   +P  + ++TDG     N +   P  +AS       N  ++G  +   + +L +I+  N ++   ++Y+ L + ++ ++    C  TK +  +E
Sbjct:   10 GCEGLLADVVFLIDGSDSVSAEDFEKMKDIMEYVIEKFAIGSEKERVAVVQYGTNPNEEFSLNAFDNKDRLLQEIRNIRQVTGKTYTGKALTQVLQSFDKSKGGRSSALKFLIALTDGESRDDVA--LPAKALRDNSINTYAIGL-RHANRSQILAIAGSHGEVFYEDAVASLKELSSEVLLKIC-------NTECKTPELIDIIFLVDTSAWPNIDGLQEMI--NLMTHVVRKSVVSEKRVRFGAITYSNSPQLEFTLQQYKSQADVMRGISSLRPLGGNRNTARALNYSLSYFAEMHGGRRAKNVPQVLFLITDGKVNDLNGLKTWPQSLASSQ----VNFFAIGT-KDAEVAQLREIAGGNGRVHYASTYQGL-RGLQKIITQELCNLTKPICEME 390          

HSP 2 Score: 96.2857 bits (238), Expect = 1.097e-20
Identity = 94/378 (24.87%), Postives = 175/378 (46.30%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFI--KTTNADNRISF--IVFGDDATLIFNFDKFKNLNDMVRQVKNVR----NDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKII-HHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDR-NKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAV 1224
            D +F++D S   +    +     ++ +MT +  K+  ++ R+ F  I + +   L F   ++K+  D++R + ++R    N N A A+  +L    E    +  K+  + + L TDG  N       +   L  + V    +G   +    +L  +A  N  +  A   +    L KII   +C +  PI    C++E  DLV L+D S+SI  P ++I K+ +  ++ +  I     RVG+  FSD    +F L+      +V E I ++++    T    AL+ +++ F          G+  N+L++TDG  N     + +A  LK +   I  +GIG  I   EL +I+ +   + + ++E L+  +KT ++ V
Sbjct:  202 DIIFLVDTSAWPNIDGLQ----EMINLMTHVVRKSVVSEKRVRFGAITYSNSPQLEFTLQQYKSQADVMRGISSLRPLGGNRNTARALNYSLSYFAEMHGGRRAKNVPQVLFLITDGKVNDLNGLKTWPQSLASSQVNFFAIGT-KDAEVAQLREIAGGNGRVHYASTYQGLRGLQKIITQELCNLTKPI----CEMEVADLVFLIDGSESIKPPSWDILKQTMIGIVKELDIAKDKWRVGVAQFSDILLHQFYLNTYTSFAEVEEAINNIKQRKQGTNTWDALKLIKYYFTKENGSRIEGGVAQNLLLITDGEANDEKDLNALAD-LKNKKIAITVIGIGNEIKKSELREIAGSPDRVLIETFESLE--LKTTIRKV 567          

HSP 3 Score: 56.9954 bits (136), Expect = 3.415e-8
Identity = 46/188 (24.47%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKL-----TYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQ--KLFENLMKIIHHVC 657
            C     D VF++D S+SI    +++ K+ ++ ++  +       R+    F D     F  + + +  ++   + N++     T    ALKL     T EN   ++     + ++L TDG  N        AD LK+  + I  +GIG+EI K EL  +A     + +  F+  +L   + K++H +C
Sbjct:  387 CEMEVADLVFLIDGSESIKPPSWDILKQTMIGIVKELDIAKDKWRVGVAQFSDILLHQFYLNTYTSFAEVEEAINNIKQRKQGTNTWDALKLIKYYFTKEN-GSRIEGGVAQNLLLITDGEANDEKDLNALAD-LKNKKIAITVIGIGNEIKKSELREIAGSPDRVLIETFESLELKTTIRKVLHFLC 572          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Match: col6a3 (collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070501-8])

HSP 1 Score: 85.1149 bits (209), Expect = 4.305e-17
Identity = 100/396 (25.25%), Postives = 181/396 (45.71%), Query Frame = 1
Query:   52 LASLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNG-ATAIGKALKLTYENL------------VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSE-INKKELINLA-SPNMAITVADFQKLFENLMKIIHHV-CVIVDPIPNEPC-----KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFW-----PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            LAS+   S  V+      T+  S  ++D VF+LD S    SS F   +  + +++         +R+S + +  DA + F  + +    D++ +VK +R+  G     G AL+   +N+            VPQ+       +IL + G +  F +    A  LK+  V  LT+GIGS   + +EL  ++   N A++VADF +L     +++  V  V +   P  P       + ++D+V L+D S       F   + FV  L+ +F +     R+ +V +S    + F L+    +  VL  ++ LR + G     G AL+ V+   +       ++ G+P  +++L+ G +N        AS LK  G  ++ LGIG   + +E+  I+++
Sbjct:  156 LASVQVTSIPVTPTSPTVTAEYSTPRKDVVFLLDGSDGTRSS-FPAMRDFVQRVVEKFNIEANRDRVSVVQYSRDAEVHFYLNSYTKKEDILDRVKGLRHKGGRPLYTGAALQYVRDNVFTASSGSRRLEGVPQI-------LILLSGGRS--FDSVDAAASSLKELGV--LTLGIGSRGSDSRELQRISYEANYALSVADFSELPNVQEQLLASVQTVAMSGTPTSPTLTADDTIPRKDVVFLLDGSDGTRN-TFPAMRAFVQRLVEQFNVEANRDRISVVQYSRDAEVNFYLNTYTAKADVLNTVRGLRHRGGRPLNTGAALQYVRDSVFTASAGSRKQEGVPQVLILLSGGRSN--DNVDTPASALKESG--VLILGIGTRNSSREVQRITND 534          

HSP 2 Score: 81.2629 bits (199), Expect = 7.686e-16
Identity = 99/396 (25.00%), Postives = 179/396 (45.20%), Query Frame = 1
Query:   52 LASLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNG-ATAIGKALKLTYENL------------VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSE-INKKELINLA-SPNMAITVADFQKLFENLMKIIHHV-CVIVDPIPNEPC-----KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFW-----PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            LAS+   S  V+      T+  S  ++D VF+LD S    SS F   +  + +++         +R+S + +  DA + F  + +    D++ +V  +R+  G     G AL+   +N+            VPQ+       +IL + G +  F +    A  LK+  V  LT+GIGS   + +EL  ++   N A++VADF +L     +++  V  V +   P  P       + ++D+V L+D S       F   + FV  L+ +  +     R+ +V +S    + F L+    +  VL  ++ LR + G     G AL+ V+   +       ++ GIP  +++L+ G +N        AS LK  G  ++ LGIG   + +E+  I+++
Sbjct:  955 LASVQVTSIPVTPTSPTVTAEYSTPRKDVVFLLDGSDGTRSS-FPAMRDFVQRVVEKFNIEANRDRVSVVQYSRDAEVHFYLNSYTKKEDILDRVTGLRHKGGRPLYTGAALQYVRDNVFTASSGSRRLEGVPQI-------LILLSGGRS--FDSVDAAASSLKELGV--LTLGIGSRGSDSRELQRISYEANYALSVADFSELPNVQEQLLASVQTVAMSGTPTSPTLTADDTIPRKDVVFLLDGSDGTRN-TFPAMRAFVQRLVEQLNVEANRDRISVVQYSRDAEVNFYLNTYTAKADVLNTVRGLRHRGGRPLNTGAALQYVRDSVFTASAGSRKQEGIPQVLILLSGGRSN--DNVDTPASALKESG--VLILGIGTRNSSREVQRITND 1333          

HSP 3 Score: 59.3066 bits (142), Expect = 6.275e-9
Identity = 74/341 (21.70%), Postives = 156/341 (45.75%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGD--DATLIFNFDKFKN--LNDM--VRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKEL-INLASPNMAITVADFQKLF---ENLMKIIHHVCV-------------IVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDGYNN 1038
            K+D +F++D S+ +   +F + +  + ++++ +       RI  + +GD  +A +  N  + K   LN +  +RQ++  + +     +G+A+      ++   R     +   ++V++ + G  T+N+  +    A  LK + +  L++G   ++  +EL +    P  A  V D   L+   E L+  +  +                V P+P    + +++D+V L+D +  I   +F   +  V  ++ K  +G    RV +V +SD P++EF L+    + +V + I+ LR K G+    G AL  V    +          G+P  ++++T G +N
Sbjct: 1579 KKDIIFLIDGSEDVGR-EFPIIQEFVRRVVSNLNVGENKIRIGVVQYGDIPNADIYLNSHRTKEGVLNGIKELRQLRGTKRN-----LGQAIDFVRREVLASGRGGRKEEGVPQFVVVVSGGKATDNIRQS----ATALKQSGIFPLSIGT-RDVGTQELQVTSYVPRFAYLVDDLPGLYTIQETLINTLTELSSEELAQLRPVYPTETVVPVP----RGDKRDVVFLIDGTSKIRN-EFPAIRDMVQRVVEKLDVGLDNVRVSVVQYSDDPKLEFLLNEHSTKEEVRQAIRRLRNKGGNELNTGKALEYVSKTIYQRSAGSRVEEGVPQFLILVTGGKSN 1903          

HSP 4 Score: 57.7658 bits (138), Expect = 1.939e-8
Identity = 77/354 (21.75%), Postives = 159/354 (44.92%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLVPQMR----KDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSE-INKKELINLA-SPNMAITVADFQKLFENLMKIIHHVC--VIVDP-------IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLR-KLGSATGLGLALREVQFKFW-----PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIG 1113
            ++D +F++D S S+  S     +  I+K++  +       R++ + +G+     F+ +   N   ++  +K +R+  G  A + +A+K    N +          A +++++ T G  T++V      Y   LK +  R+  +GIG+E  + ++LI +A S +  + V  F  L     K I  +   ++V+P        P  P + +  D+V L+D S ++   +F+    F+ +LI  F       ++GL  ++      F L+   +++ ++  I     K G     G A+R VQ   +       +  GIP  ++++T G +    +   +   LK  G  + ++G+G
Sbjct: 1985 RKDIIFLIDGSDSVGQSGVAHIRDFILKVVDQLDVRPDQVRVALVQYGERPKTEFSLNSHDNKQSVISAIKRLRHMGGRGADLAEAIKYVIRNELQASAGVRLAQASQHLVVLTGGRSTSDV----STYGSILKGS--RVNCIGIGAENADSRQLIQIATSSDDVLQVPSFPNLPNIQNKFIARLSGSIVVEPPIEIDETTPGLP-QAKAADIVFLVDGSINLGRNNFKEVMEFILNLIDLFYTERDRLQIGLAHYATDVTDVFYLNTYNNKDDIINAITRAEYKGGREIRTGSAIRHVQKTHFVKEKGSRKDEGIPQILMVVTGGRSRDDSKSAALG--LKASGVRVYAVGVG 2329          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Match: VIT (si:ch1073-291c23.1 [Source:ZFIN;Acc:ZDB-GENE-050208-114])

HSP 1 Score: 80.1073 bits (196), Expect = 5.472e-16
Identity = 80/350 (22.86%), Postives = 153/350 (43.71%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM---RKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPN------------MAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDG--YNNVFPRPHEIASKLKREGANIISLGIG 1113
            K D  F++D S SI    F++ K  +V++   +    A   +  I +GDD    F+  +F N  D+   +  +    G + +GKAL    +         R  A    ++  DG  T+ V  A  +     +++ + I  V I G + N+K+  N+   N             ++ +A +  L + +  ++  VC     + ++ C +   D+  ++D S S+   +F    +FVA++  +F+I    TRVG+V ++   R+EF      ++  +L  IK +      T  G A+     + +   +      ++++TDG  Y++V  R   +A  + R G    S+GI 
Sbjct:   19 KVDMAFLMDGSWSIGKRRFKIQKDFLVEVSQALNVGVAGAMMGIIQYGDDPVTEFSLKQFSNSKDLKPAISKIVQKGGPSHVGKALSYINKQFFSDANGNRGGAPNVAVVLVDGWPTDRVEEASRL----ARESGINIFFVTIEGPDDNEKQ--NVVESNFVDKAVCRTNGFFSLPIASWFALRKAVQPLVKRVCDTDRLVCSKTC-LNANDIAFVIDGSSSVGTGNFRTVLQFVANVTREFEISDTDTRVGIVQYTYEQRLEFAFGQHNNKADLLNAIKRINYWSGGTSTGAAITYAADQLFSKSKPNKRKIMIVITDGRSYDDV--RAPALA--VHRTGVIAYSIGIA 357          

HSP 2 Score: 57.3806 bits (137), Expect = 1.623e-8
Identity = 40/179 (22.35%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNM--AITVADFQKLFENLMKIIHHVC 657
            D  F++D S S+ + +F    + +  +    + ++ D R+  + +  +  L F F +  N  D++  +K +   +G T+ G A+    + L  + + + ++ +I+ TDG + +   AP +    +    V   ++GI +   + EL  +A+ P+   +  V +F  L++ + KIIH++C
Sbjct:  223 DIAFVIDGSSSVGTGNFRTVLQFVANVTREFEISDTDTRVGIVQYTYEQRLEFAFGQHNNKADLLNAIKRINYWSGGTSTGAAITYAADQLFSKSKPNKRKIMIVITDGRSYDDVRAPAL---AVHRTGVIAYSIGI-AWAAQDELEYIATDPDREHSFFVDEFDNLYKYVSKIIHNIC 397          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Match: ENSXETT00000014315.1 (collagen type VI alpha 5 chain [Source:NCBI gene;Acc:100486063])

HSP 1 Score: 112.079 bits (279), Expect = 9.703e-26
Identity = 107/401 (26.68%), Postives = 188/401 (46.88%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM--RKDAQRYVILFTDGTNNVFPAPY--IYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            SL  ++  + +++     SC   +  D +F+LDAS SI+  +F L +R +  ++        + +   +V+G +    F+ + +    D+++ V ++   +G T   KAL+ T          R      +IL TDG       P   I +  LKD  + +  VG+G  +  +EL  +A  P+    V +++ L      I   VC    P     C  EQ DLV L+D S SI+  +F   K F+  ++  F I     R+G+  +S +P+ EF L+     + + ++I  + +L + T  G  LR V+  F P    R  +P  ++++TDG +N     +E A+ L+  G  I S+GIG   N  EL  I+ + K +  V +++ L  ++K  + A  C
Sbjct: 1187 SLAFLNKNIMFEICNPQESCKKTEVADIIFLLDASASITRGEFRLMQRFVEAVVNDSLVGKDNVQFGAVVYGTNPAEQFSLNTYSTKLDILKAVFSLPQVSGYTYTAKALEYTRIRFGTSYGGRPGISHILILVTDGATTEADRPNLPIVSKALKDDGIIVFAVGVGKAV-PQELQQIAGYPDRWFLVQNYKGLDNIHDNITQVVCDESKPA----CSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALD-SIKRQIVAQVC 1578          

HSP 2 Score: 93.2041 bits (230), Expect = 1.648e-19
Identity = 92/399 (23.06%), Postives = 184/399 (46.12%), Query Frame = 1
Query:   34 SKIIVKLASLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGD---DATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKAL---KLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDR-NKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            ++I+VK  ++PAI+  V     +   +      D  F++D S SI   DFE  K+ ++++++  +      R   + + D       I   +  K L D + Q++ +    G T  G+AL   K  + N          + +++ TDG   + V  A    A  +++  + I  +G+ + + ++E+ ++A  N  +  V +F  L      +   +C        E CK  + D+V L+DSS SI+  D+E  K F+  ++ + +IGP   ++GL+ FS   + EF L+   R +++   I+ +++L   T +G AL+     F   +  R      ++++TDG   +    P   A  ++  G  I ++G+ +  N + L      +++   +S++ L
Sbjct:  813 NEIVVKSFAVPAIARAVKEGCVDTEEA------DIYFLIDGSGSIYPEDFEDMKKFMIELISMFQVGANRVRFGVVQYSDVRRTEFFISEHNTQKMLKDAISQIEQL---GGGTLTGEALTSMKQLFVNAAKDRPHKVPQSLVVITDGESQDRVTEA----AAEIRNDGITIFAIGVKNAV-EEEIRDIAGSNEKMFFVNNFDSLKVIKNDLARELCT------PEACKNMKADIVFLVDSSASINSDDYETMKEFMESMVKQAEIGPDRVQIGLIQFSSETKEEFPLNRYKRKDEIQSAIRGIQQLSQGTLMGEALKYTLPYFSASKGGRVNTKQYLIVITDGEAQDAVGNP---AKAIRDHGVIIYAIGVQQANNTQLLEIAGKQEQVYYEDSFDSL 1188          

HSP 3 Score: 86.6557 bits (213), Expect = 1.905e-17
Identity = 84/369 (22.76%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   73 SYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIG----SEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV-------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLG 1107
            SY V+    + T        D VF++D S SI + +F   K  +  ++          +I  I + D+A   F  + + N  D+++ ++N++   G T  G +L+        E    +  +   +  ++ TDG   +    P I    +K+A + +  +GI     SE+N  E+ +        +VADF  L      +I  +C  V+    +  ++        Q D+V+L++S+  +    FE  K F+  L+S   +G    R+GLV+++D    EF L+    + ++LE I++++ +   T  G AL  V   ++           +   ++I+T+G  ++    P   A +LK  G ++  +G
Sbjct:   14 SYSVNVSASQKTVCTEASIADIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSLEFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAI---AVKNAGIILYAIGIKDAVLSELN--EIASDPDDKHVYSVADFNALQSISQNMIQVLCTTVEEAARQTGQIAQVCRTANQADIVLLVESTTRMGDATFEKAKNFLYDLVSNLDVGINKIRIGLVTYNDETNPEFLLNSYSSKTEILESIQNMKYVEGYTYTGRALEYVNTTYFTQAAGSRFEESVAQILIIVTEGDSSDTLTEP---AKELKSRGISVYVVG 374          

HSP 4 Score: 84.7297 bits (208), Expect = 8.572e-17
Identity = 87/362 (24.03%), Postives = 168/362 (46.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRN-DNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV--------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN-----ILILTDGYN-NVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D VF++D+S S+ +  F+  K  I+ ++  +      +RI    +       F  + ++   ++++ +K       G    G AL+        E    ++     +++++ T   +    A   +A+ LK   V  ++VGIG+  ++KEL  +A+          Q +  NL + + +V +  D +   P  V           D+V L+D S SI   +F++ + F+  ++S   I     RVGLV +SD PR+E  L+   ++ ++L+ I  L   G     G AL  ++ K +  +  G P        +++T+G + + F +P   A+KL+R G  + ++G  ++IN  EL  I+S+
Sbjct:  432 DVVFLVDSSTSMGTIFFQKMKDFIIHIINQLNVGINKHRIGLAQYSGLPQTEFLLNHYETKEEILKHIKETFTYRGGPLKTGHALEFVRSTFFIEEAGSRINYGNPQFLVVITSSKSE--DAVRRHAEELKSVGVTTISVGIGNS-DRKELEKIATDPFVFQTTGLQHI-SNLQQDVANVIIAEDMLQFSPVSVVPAVCSSASVADIVFLIDESSSIGPINFQLTRVFLHKVVSALDISLSNVRVGLVLYSDEPRLELKLNTFNEKYEILDFITKLPYRGGKAHTGAALDFLRKKMFTKQNGGRPHQGVQQIAVVMTNGQSMDNFTKP---AAKLRRSGVEVFAVGF-QNINDTELDIIASH 785          

HSP 5 Score: 75.8702 bits (185), Expect = 6.297e-14
Identity = 61/216 (28.24%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  100 EATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ--MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVD-PIPNEPCKVEQQDLVVLMDSSK 735
            E+  +CS  + D VF++D S SI+SS+F  AK  + +++     +    RI    +  +    F  +++ + +DM +Q+ ++      T  GK L+   +   P    RK+  +Y+I+ TDG +N   +    A  L+ + V+I ++GIG   N  EL+ +A SP     V  FQ L     +I+  VC   D PI  + C +   D+ + +D S+
Sbjct: 1393 ESKPACSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALDSIKRQIVAQVCEPSDQPIIGKECSL---DITISVDYSR 1602          

HSP 6 Score: 65.855 bits (159), Expect = 9.727e-11
Identity = 57/185 (30.81%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPH--------RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS--NDK----ILTVNSYERLQKNMKTVL 1215
            D+V LMD S SI   +F   K F+  L++ F +G    ++GL+ +SD+ R EF L+   ++  VL+ I++L+  G  T  GL+L   +F    H           G+P   +++TDG      R   IA  +K  G  + ++GI   + L EL +I+S  +DK    +   N+ + + +NM  VL
Sbjct:   34 DIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSL---EFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAIA--VKNAGIILYAIGIKDAV-LSELNEIASDPDDKHVYSVADFNALQSISQNMIQVL 212          

HSP 7 Score: 62.3882 bits (150), Expect = 1.000e-9
Identity = 82/399 (20.55%), Postives = 178/399 (44.61%), Query Frame = 1
Query:   94 VYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNAD----NRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA--IGKALKLTYENLVPQMRKD--AQRYVILFTDGTNNVFPAP---YIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQ-----KLFENLMKIIHHVCVIVDPI-PNEPCKVEQ-------QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPK------ATRVGLVSFS---------DHP-RIEFDLHLVDRNKVLEK-IKH-LRKLGSATGLGLALR----EVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
             + + S C  +  + VF LDASQ +  + F+  K  I+ ++  +  + ++     R++ + +  +   +  F  +K  + ++  ++ +  +  ++   IG+A+K    N+  ++R     ++  + F +G     P+P    I +  L+ +++ I+ + I        + N+ +   A     FQ     +  +  +++I +  +  D   P+E C+++Q        D+  ++DSS ++    FE  K FV+ ++    I  +        RV LV  +           P + EFDL   +   ++++ IK  +R+L   + +G +++     +  K    R+H + F IL     Y +   +  E++ K K +G  I  LG G+ I+  E+T + S
Sbjct: 2148 CFASASKCPVYPTEIVFALDASQDVPPAAFQRMKNTIISIIEKLDISESNCPRGARVAVVAYNSNTKYLIRFSDYKRKSLLLEAIRGISPERSSSRRNIGEAMKFVGRNIFKRIRHGIHVRKVAVFFANG-----PSPDADAINSAVLEYSALDIIPIVIAF----NNVPNVVAAFSADETRRFQVFVWSRPEDQRLELISYCTLCYDKCTPDEECELDQMPATLIDMDIAFVLDSSHNVQADVFEEMKDFVSSMLDTVYISTRPAVSETEARVALVQQAVKDFGPNRNTSPVKTEFDLLRYNSANMMKRHIKQSVRQLNGPSAVGNSVQWVIDNIFLKTPMPRKHKVLFLILASPTSYWDR-EKLKEVSKKAKCQGFAIFVLGFGKTISELEMTQLPS 2536          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Match: ENSXETT00000014273.1 (collagen type VI alpha 5 chain [Source:NCBI gene;Acc:100486063])

HSP 1 Score: 112.079 bits (279), Expect = 1.038e-25
Identity = 107/401 (26.68%), Postives = 188/401 (46.88%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM--RKDAQRYVILFTDGTNNVFPAPY--IYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            SL  ++  + +++     SC   +  D +F+LDAS SI+  +F L +R +  ++        + +   +V+G +    F+ + +    D+++ V ++   +G T   KAL+ T          R      +IL TDG       P   I +  LKD  + +  VG+G  +  +EL  +A  P+    V +++ L      I   VC    P     C  EQ DLV L+D S SI+  +F   K F+  ++  F I     R+G+  +S +P+ EF L+     + + ++I  + +L + T  G  LR V+  F P    R  +P  ++++TDG +N     +E A+ L+  G  I S+GIG   N  EL  I+ + K +  V +++ L  ++K  + A  C
Sbjct: 1187 SLAFLNKNIMFEICNPQESCKKTEVADIIFLLDASASITRGEFRLMQRFVEAVVNDSLVGKDNVQFGAVVYGTNPAEQFSLNTYSTKLDILKAVFSLPQVSGYTYTAKALEYTRIRFGTSYGGRPGISHILILVTDGATTEADRPNLPIVSKALKDDGIIVFAVGVGKAV-PQELQQIAGYPDRWFLVQNYKGLDNIHDNITQVVCDESKPA----CSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALD-SIKRQIVAQVC 1578          

HSP 2 Score: 93.2041 bits (230), Expect = 1.639e-19
Identity = 92/399 (23.06%), Postives = 184/399 (46.12%), Query Frame = 1
Query:   34 SKIIVKLASLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGD---DATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKAL---KLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDR-NKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            ++I+VK  ++PAI+  V     +   +      D  F++D S SI   DFE  K+ ++++++  +      R   + + D       I   +  K L D + Q++ +    G T  G+AL   K  + N          + +++ TDG   + V  A    A  +++  + I  +G+ + + ++E+ ++A  N  +  V +F  L      +   +C        E CK  + D+V L+DSS SI+  D+E  K F+  ++ + +IGP   ++GL+ FS   + EF L+   R +++   I+ +++L   T +G AL+     F   +  R      ++++TDG   +    P   A  ++  G  I ++G+ +  N + L      +++   +S++ L
Sbjct:  813 NEIVVKSFAVPAIARAVKEGCVDTEEA------DIYFLIDGSGSIYPEDFEDMKKFMIELISMFQVGANRVRFGVVQYSDVRRTEFFISEHNTQKMLKDAISQIEQL---GGGTLTGEALTSMKQLFVNAAKDRPHKVPQSLVVITDGESQDRVTEA----AAEIRNDGITIFAIGVKNAV-EEEIRDIAGSNEKMFFVNNFDSLKVIKNDLARELCT------PEACKNMKADIVFLVDSSASINSDDYETMKEFMESMVKQAEIGPDRVQIGLIQFSSETKEEFPLNRYKRKDEIQSAIRGIQQLSQGTLMGEALKYTLPYFSASKGGRVNTKQYLIVITDGEAQDAVGNP---AKAIRDHGVIIYAIGVQQANNTQLLEIAGKQEQVYYEDSFDSL 1188          

HSP 3 Score: 86.6557 bits (213), Expect = 1.998e-17
Identity = 84/369 (22.76%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   73 SYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIG----SEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV-------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLG 1107
            SY V+    + T        D VF++D S SI + +F   K  +  ++          +I  I + D+A   F  + + N  D+++ ++N++   G T  G +L+        E    +  +   +  ++ TDG   +    P I    +K+A + +  +GI     SE+N  E+ +        +VADF  L      +I  +C  V+    +  ++        Q D+V+L++S+  +    FE  K F+  L+S   +G    R+GLV+++D    EF L+    + ++LE I++++ +   T  G AL  V   ++           +   ++I+T+G  ++    P   A +LK  G ++  +G
Sbjct:   14 SYSVNVSASQKTVCTEASIADIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSLEFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAI---AVKNAGIILYAIGIKDAVLSELN--EIASDPDDKHVYSVADFNALQSISQNMIQVLCTTVEEAARQTGQIAQVCRTANQADIVLLVESTTRMGDATFEKAKNFLYDLVSNLDVGINKIRIGLVTYNDETNPEFLLNSYSSKTEILESIQNMKYVEGYTYTGRALEYVNTTYFTQAAGSRFEESVAQILIIVTEGDSSDTLTEP---AKELKSRGISVYVVG 374          

HSP 4 Score: 84.7297 bits (208), Expect = 8.446e-17
Identity = 87/362 (24.03%), Postives = 168/362 (46.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV-RNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV--------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN-----ILILTDGYN-NVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D VF++D+S S+ +  F+  K  I+ ++  +      +RI    +       F  + ++   ++++ +K       G    G AL+        E    ++     +++++ T   +    A   +A+ LK   V  ++VGIG+  ++KEL  +A+          Q +  NL + + +V +  D +   P  V           D+V L+D S SI   +F++ + F+  ++S   I     RVGLV +SD PR+E  L+   ++ ++L+ I  L   G     G AL  ++ K +  +  G P        +++T+G + + F +P   A+KL+R G  + ++G  ++IN  EL  I+S+
Sbjct:  432 DVVFLVDSSTSMGTIFFQKMKDFIIHIINQLNVGINKHRIGLAQYSGLPQTEFLLNHYETKEEILKHIKETFTYRGGPLKTGHALEFVRSTFFIEEAGSRINYGNPQFLVVITSSKSE--DAVRRHAEELKSVGVTTISVGIGNS-DRKELEKIATDPFVFQTTGLQHI-SNLQQDVANVIIAEDMLQFSPVSVVPAVCSSASVADIVFLIDESSSIGPINFQLTRVFLHKVVSALDISLSNVRVGLVLYSDEPRLELKLNTFNEKYEILDFITKLPYRGGKAHTGAALDFLRKKMFTKQNGGRPHQGVQQIAVVMTNGQSMDNFTKP---AAKLRRSGVEVFAVGF-QNINDTELDIIASH 785          

HSP 5 Score: 75.485 bits (184), Expect = 6.838e-14
Identity = 61/216 (28.24%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  100 EATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ--MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVD-PIPNEPCKVEQQDLVVLMDSSK 735
            E+  +CS  + D VF++D S SI+SS+F  AK  + +++     +    RI    +  +    F  +++ + +DM +Q+ ++      T  GK L+   +   P    RK+  +Y+I+ TDG +N   +    A  L+ + V+I ++GIG   N  EL+ +A SP     V  FQ L     +I+  VC   D PI  + C +   D+ + +D S+
Sbjct: 1393 ESKPACSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALDSIKRQIVAQVCEPSDQPIIGKECSL---DITISVDYSR 1602          

HSP 6 Score: 65.855 bits (159), Expect = 9.334e-11
Identity = 57/185 (30.81%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPH--------RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS--NDK----ILTVNSYERLQKNMKTVL 1215
            D+V LMD S SI   +F   K F+  L++ F +G    ++GL+ +SD+ R EF L+   ++  VL+ I++L+  G  T  GL+L   +F    H           G+P   +++TDG      R   IA  +K  G  + ++GI   + L EL +I+S  +DK    +   N+ + + +NM  VL
Sbjct:   34 DIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSL---EFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAIA--VKNAGIILYAIGIKDAV-LSELNEIASDPDDKHVYSVADFNALQSISQNMIQVL 212          

HSP 7 Score: 62.3882 bits (150), Expect = 1.029e-9
Identity = 82/399 (20.55%), Postives = 178/399 (44.61%), Query Frame = 1
Query:   94 VYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNAD----NRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA--IGKALKLTYENLVPQMRKD--AQRYVILFTDGTNNVFPAP---YIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQ-----KLFENLMKIIHHVCVIVDPI-PNEPCKVEQ-------QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPK------ATRVGLVSFS---------DHP-RIEFDLHLVDRNKVLEK-IKH-LRKLGSATGLGLALR----EVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
             + + S C  +  + VF LDASQ +  + F+  K  I+ ++  +  + ++     R++ + +  +   +  F  +K  + ++  ++ +  +  ++   IG+A+K    N+  ++R     ++  + F +G     P+P    I +  L+ +++ I+ + I        + N+ +   A     FQ     +  +  +++I +  +  D   P+E C+++Q        D+  ++DSS ++    FE  K FV+ ++    I  +        RV LV  +           P + EFDL   +   ++++ IK  +R+L   + +G +++     +  K    R+H + F IL     Y +   +  E++ K K +G  I  LG G+ I+  E+T + S
Sbjct: 2148 CFASASKCPVYPTEIVFALDASQDVPPAAFQRMKNTIISIIEKLDISESNCPRGARVAVVAYNSNTKYLIRFSDYKRKSLLLEAIRGISPERSSSRRNIGEAMKFVGRNIFKRIRHGIHVRKVAVFFANG-----PSPDADAINSAVLEYSALDIIPIVIAF----NNVPNVVAAFSADETRRFQVFVWSRPEDQRLELISYCTLCYDKCTPDEECELDQMPATLIDMDIAFVLDSSHNVQADVFEEMKDFVSSMLDTVYISTRPAVSETEARVALVQQAVKDFGPNRNTSPVKTEFDLLRYNSANMMKRHIKQSVRQLNGPSAVGNSVQWVIDNIFLKTPMPRKHKVLFLILASPTSYWDR-EKLKEVSKKAKCQGFAIFVLGFGKTISELEMTQLPS 2536          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Match: ENSXETT00000014204.1 (collagen type VI alpha 5 chain [Source:NCBI gene;Acc:100486063])

HSP 1 Score: 111.694 bits (278), Expect = 1.064e-25
Identity = 107/401 (26.68%), Postives = 188/401 (46.88%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM--RKDAQRYVILFTDGTNNVFPAPY--IYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            SL  ++  + +++     SC   +  D +F+LDAS SI+  +F L +R +  ++        + +   +V+G +    F+ + +    D+++ V ++   +G T   KAL+ T          R      +IL TDG       P   I +  LKD  + +  VG+G  +  +EL  +A  P+    V +++ L      I   VC    P     C  EQ DLV L+D S SI+  +F   K F+  ++  F I     R+G+  +S +P+ EF L+     + + ++I  + +L + T  G  LR V+  F P    R  +P  ++++TDG +N     +E A+ L+  G  I S+GIG   N  EL  I+ + K +  V +++ L  ++K  + A  C
Sbjct: 1187 SLAFLNKNIMFEICNPQESCKKTEVADIIFLLDASASITRGEFRLMQRFVEAVVNDSLVGKDNVQFGAVVYGTNPAEQFSLNTYSTKLDILKAVFSLPQVSGYTYTAKALEYTRIRFGTSYGGRPGISHILILVTDGATTEADRPNLPIVSKALKDDGIIVFAVGVGKAV-PQELQQIAGYPDRWFLVQNYKGLDNIHDNITQVVCDESKPA----CSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALD-SIKRQIVAQVC 1578          

HSP 2 Score: 92.8189 bits (229), Expect = 1.905e-19
Identity = 92/399 (23.06%), Postives = 184/399 (46.12%), Query Frame = 1
Query:   34 SKIIVKLASLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGD---DATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKAL---KLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDR-NKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            ++I+VK  ++PAI+  V     +   +      D  F++D S SI   DFE  K+ ++++++  +      R   + + D       I   +  K L D + Q++ +    G T  G+AL   K  + N          + +++ TDG   + V  A    A  +++  + I  +G+ + + ++E+ ++A  N  +  V +F  L      +   +C        E CK  + D+V L+DSS SI+  D+E  K F+  ++ + +IGP   ++GL+ FS   + EF L+   R +++   I+ +++L   T +G AL+     F   +  R      ++++TDG   +    P   A  ++  G  I ++G+ +  N + L      +++   +S++ L
Sbjct:  813 NEIVVKSFAVPAIARAVKEGCVDTEEA------DIYFLIDGSGSIYPEDFEDMKKFMIELISMFQVGANRVRFGVVQYSDVRRTEFFISEHNTQKMLKDAISQIEQL---GGGTLTGEALTSMKQLFVNAAKDRPHKVPQSLVVITDGESQDRVTEA----AAEIRNDGITIFAIGVKNAV-EEEIRDIAGSNEKMFFVNNFDSLKVIKNDLARELCT------PEACKNMKADIVFLVDSSASINSDDYETMKEFMESMVKQAEIGPDRVQIGLIQFSSETKEEFPLNRYKRKDEIQSAIRGIQQLSQGTLMGEALKYTLPYFSASKGGRVNTKQYLIVITDGEAQDAVGNP---AKAIRDHGVIIYAIGVQQANNTQLLEIAGKQEQVYYEDSFDSL 1188          

HSP 3 Score: 86.6557 bits (213), Expect = 2.142e-17
Identity = 84/369 (22.76%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   73 SYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIG----SEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV-------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLG 1107
            SY V+    + T        D VF++D S SI + +F   K  +  ++          +I  I + D+A   F  + + N  D+++ ++N++   G T  G +L+        E    +  +   +  ++ TDG   +    P I    +K+A + +  +GI     SE+N  E+ +        +VADF  L      +I  +C  V+    +  ++        Q D+V+L++S+  +    FE  K F+  L+S   +G    R+GLV+++D    EF L+    + ++LE I++++ +   T  G AL  V   ++           +   ++I+T+G  ++    P   A +LK  G ++  +G
Sbjct:   14 SYSVNVSASQKTVCTEASIADIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSLEFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAI---AVKNAGIILYAIGIKDAVLSELN--EIASDPDDKHVYSVADFNALQSISQNMIQVLCTTVEEAARQTGQIAQVCRTANQADIVLLVESTTRMGDATFEKAKNFLYDLVSNLDVGINKIRIGLVTYNDETNPEFLLNSYSSKTEILESIQNMKYVEGYTYTGRALEYVNTTYFTQAAGSRFEESVAQILIIVTEGDSSDTLTEP---AKELKSRGISVYVVG 374          

HSP 4 Score: 84.3445 bits (207), Expect = 1.007e-16
Identity = 87/362 (24.03%), Postives = 168/362 (46.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV-RNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV--------EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN-----ILILTDGYN-NVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D VF++D+S S+ +  F+  K  I+ ++  +      +RI    +       F  + ++   ++++ +K       G    G AL+        E    ++     +++++ T   +    A   +A+ LK   V  ++VGIG+  ++KEL  +A+          Q +  NL + + +V +  D +   P  V           D+V L+D S SI   +F++ + F+  ++S   I     RVGLV +SD PR+E  L+   ++ ++L+ I  L   G     G AL  ++ K +  +  G P        +++T+G + + F +P   A+KL+R G  + ++G  ++IN  EL  I+S+
Sbjct:  432 DVVFLVDSSTSMGTIFFQKMKDFIIHIINQLNVGINKHRIGLAQYSGLPQTEFLLNHYETKEEILKHIKETFTYRGGPLKTGHALEFVRSTFFIEEAGSRINYGNPQFLVVITSSKSE--DAVRRHAEELKSVGVTTISVGIGNS-DRKELEKIATDPFVFQTTGLQHI-SNLQQDVANVIIAEDMLQFSPVSVVPAVCSSASVADIVFLIDESSSIGPINFQLTRVFLHKVVSALDISLSNVRVGLVLYSDEPRLELKLNTFNEKYEILDFITKLPYRGGKAHTGAALDFLRKKMFTKQNGGRPHQGVQQIAVVMTNGQSMDNFTKP---AAKLRRSGVEVFAVGF-QNINDTELDIIASH 785          

HSP 5 Score: 75.8702 bits (185), Expect = 6.245e-14
Identity = 61/216 (28.24%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  100 EATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ--MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVD-PIPNEPCKVEQQDLVVLMDSSK 735
            E+  +CS  + D VF++D S SI+SS+F  AK  + +++     +    RI    +  +    F  +++ + +DM +Q+ ++      T  GK L+   +   P    RK+  +Y+I+ TDG +N   +    A  L+ + V+I ++GIG   N  EL+ +A SP     V  FQ L     +I+  VC   D PI  + C +   D+ + +D S+
Sbjct: 1393 ESKPACSHEQLDLVFLIDGSASITSSNFTSAKTFMKEIVDSFTISENRVRIGVAQYSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFVKQFFDPANGGRKNVPQYLIVMTDGMSN--DSVNEDAAALRSSGVKIFSIGIGLR-NSFELVMIAGSPKNVYEVETFQALDSIKRQIVAQVCEPSDQPIIGKECSL---DITISVDYSR 1602          

HSP 6 Score: 65.4698 bits (158), Expect = 1.129e-10
Identity = 57/185 (30.81%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPH--------RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS--NDK----ILTVNSYERLQKNMKTVL 1215
            D+V LMD S SI   +F   K F+  L++ F +G    ++GL+ +SD+ R EF L+   ++  VL+ I++L+  G  T  GL+L   +F    H           G+P   +++TDG      R   IA  +K  G  + ++GI   + L EL +I+S  +DK    +   N+ + + +NM  VL
Sbjct:   34 DIVFLMDGSWSIGTENFITMKNFLYTLVNGFDVGLDKIQIGLIQYSDNARTEFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSL---EFMLTQHFSEAAGSRAAEGVPQIAVVITDGQAQDSIREPAIA--VKNAGIILYAIGIKDAV-LSELNEIASDPDDKHVYSVADFNALQSISQNMIQVL 212          

HSP 7 Score: 62.3882 bits (150), Expect = 1.202e-9
Identity = 82/399 (20.55%), Postives = 178/399 (44.61%), Query Frame = 1
Query:   94 VYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNAD----NRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA--IGKALKLTYENLVPQMRKD--AQRYVILFTDGTNNVFPAP---YIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQ-----KLFENLMKIIHHVCVIVDPI-PNEPCKVEQ-------QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPK------ATRVGLVSFS---------DHP-RIEFDLHLVDRNKVLEK-IKH-LRKLGSATGLGLALR----EVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
             + + S C  +  + VF LDASQ +  + F+  K  I+ ++  +  + ++     R++ + +  +   +  F  +K  + ++  ++ +  +  ++   IG+A+K    N+  ++R     ++  + F +G     P+P    I +  L+ +++ I+ + I        + N+ +   A     FQ     +  +  +++I +  +  D   P+E C+++Q        D+  ++DSS ++    FE  K FV+ ++    I  +        RV LV  +           P + EFDL   +   ++++ IK  +R+L   + +G +++     +  K    R+H + F IL     Y +   +  E++ K K +G  I  LG G+ I+  E+T + S
Sbjct: 2148 CFASASKCPVYPTEIVFALDASQDVPPAAFQRMKNTIISIIEKLDISESNCPRGARVAVVAYNSNTKYLIRFSDYKRKSLLLEAIRGISPERSSSRRNIGEAMKFVGRNIFKRIRHGIHVRKVAVFFANG-----PSPDADAINSAVLEYSALDIIPIVIAF----NNVPNVVAAFSADETRRFQVFVWSRPEDQRLELISYCTLCYDKCTPDEECELDQMPATLIDMDIAFVLDSSHNVQADVFEEMKDFVSSMLDTVYISTRPAVSETEARVALVQQAVKDFGPNRNTSPVKTEFDLLRYNSANMMKRHIKQSVRQLNGPSAVGNSVQWVIDNIFLKTPMPRKHKVLFLILASPTSYWDR-EKLKEVSKKAKCQGFAIFVLGFGKTISELEMTQLPS 2536          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 96.2857 bits (238), Expect = 9.799e-21
Identity = 86/380 (22.63%), Postives = 169/380 (44.47%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYE------NLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELIN-LASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQ---FKFWPHRRHGIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D +F++D+S + S   F L K  + + +    +  +   +    + ++  ++    ++++  ++++ V N+R   G    GKAL+   +       +   +R D  R V+L +   + +    P  Y    +D  V    +G+  + NK E+   + +P   IT ++ Q+LF  L ++   +C     I  + C+ +  DL  ++D+S ++    F   K FV  +  +F I    T++GLV++S  P+  F L   D    +L+ I     +G +  +G AL  V           R G+   +++++DG    +   P     A KL+  G  +  +GIG  +    L    +   ++TV SYE L     +V++ V 
Sbjct:  307 DLLFLVDSSDATSLEGFMLHKSFLKQFLQASLSDESPVNVGVAQYSNEVQMVVKIGEYQSTAELLKHVDNMRFMGGGLFTGKALRYVTQYGFKSSPVFSDIRDDLPRLVVLLSGSKSQDSVAGPATYT---RDQEV--FLIGVAGDSNKGEMAEIIGNPLQLITYSNPQQLFNQLPQLQKRIC----SIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMTVQKGARPGVNKAVVVISDGRGAEDAAVP-----AQKLRDNGIMVYVIGIGSILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVC 672          

HSP 2 Score: 63.1586 bits (152), Expect = 4.854e-10
Identity = 48/154 (31.17%), Postives = 79/154 (51.30%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRR-HGIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            D+++L+D S SI    FE  K F + L     IG    RVG + +S  P++EF L     +  + EKIK +   G  T  GLAL+ + +K +P  R   +P  ++I++DG    N   P     A+++K E   + ++G+ +    +EL  +SS
Sbjct:   15 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIKLP-----AAQIKGEDIEVFTVGV-KFPRWEELHALSS 162          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 96.2857 bits (238), Expect = 1.018e-20
Identity = 86/380 (22.63%), Postives = 169/380 (44.47%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYE------NLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELIN-LASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQ---FKFWPHRRHGIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D +F++D+S + S   F L K  + + +    +  +   +    + ++  ++    ++++  ++++ V N+R   G    GKAL+   +       +   +R D  R V+L +   + +    P  Y    +D  V    +G+  + NK E+   + +P   IT ++ Q+LF  L ++   +C     I  + C+ +  DL  ++D+S ++    F   K FV  +  +F I    T++GLV++S  P+  F L   D    +L+ I     +G +  +G AL  V           R G+   +++++DG    +   P     A KL+  G  +  +GIG  +    L    +   ++TV SYE L     +V++ V 
Sbjct:  342 DLLFLVDSSDATSLEGFMLHKSFLKQFLQASLSDESPVNVGVAQYSNEVQMVVKIGEYQSTAELLKHVDNMRFMGGGLFTGKALRYVTQYGFKSSPVFSDIRDDLPRLVVLLSGSKSQDSVAGPATYT---RDQEV--FLIGVAGDSNKGEMAEIIGNPLQLITYSNPQQLFNQLPQLQKRIC----SIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMTVQKGARPGVNKAVVVISDGRGAEDAAVP-----AQKLRDNGIMVYVIGIGSILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVC 707          

HSP 2 Score: 62.7734 bits (151), Expect = 5.495e-10
Identity = 48/154 (31.17%), Postives = 79/154 (51.30%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRR-HGIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            D+++L+D S SI    FE  K F + L     IG    RVG + +S  P++EF L     +  + EKIK +   G  T  GLAL+ + +K +P  R   +P  ++I++DG    N   P     A+++K E   + ++G+ +    +EL  +SS
Sbjct:   50 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIKLP-----AAQIKGEDIEVFTVGV-KFPRWEELHALSS 197          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Match: Col6a6 (collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:MGI:2444259])

HSP 1 Score: 124.405 bits (311), Expect = 4.014e-30
Identity = 101/374 (27.01%), Postives = 181/374 (48.40%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAV 1224
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D+     ++V  ++N     G T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++E+ DLV LMD S SI   DF+  K F+  ++  F +     R+G+  FSD  R EF L       ++  +I+ ++++   T +G ALR+V++ F P        G P  +L+LTDG +       + A +L+ +G +I S+GIG  ++ +EL  I+   +K LTV++++ L+K  K +++ +
Sbjct:  808 DVVFVIDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNTTAKALRDKGILVLAVGIAG-ANSWELLAMAGSSDKYY---FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQ--DEVAQAAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174          

HSP 2 Score: 107.457 bits (267), Expect = 2.109e-24
Identity = 94/372 (25.27%), Postives = 179/372 (48.12%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQ 1194
            S+C   ++  +++L D S S   +DF   K  + +++          R+  + + D   L F   K+ N  D+ + ++N+R   G T  G AL  T + L    ++   +   ++++ T+G + +    P   A  L++ ++R+  +G+  E N+ +L  +A     +  V +F  L     +++  +C        E C+  + D++ L+DSS SI   +F   K F+ +L+SK QIG    ++G+V FS   + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  +   ++++TDG      R   IA  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ
Sbjct:  426 SACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGP---AHKLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA------EEACRDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPAIA--LRKEGVIIYSVGVFGS-NVTQLEEISGKPEMVFYVENFDILQ 784          

HSP 3 Score: 81.2629 bits (199), Expect = 7.506e-16
Identity = 90/394 (22.84%), Postives = 181/394 (45.94%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTD--GTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAIT--VADFQKLF---ENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGY--NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            D VF+LD + + S  D +  K  + + ++ +       R+  + + ++  +I +     N  +++++++++    G    G AL+ T + +    R     +   +  +L T     +NV  A    A +L+   V I T+GI    N  EL  +AS P    T  + +F +L    +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF++        L K I+++R++G  T  G AL    ++  +    R   +P ++++LT+G   ++V    H    KL+ E   + ++G+ +  N  +L +I+  +K +  V+ ++ L+     V++ +  
Sbjct:  228 DVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTHRASEDNVTKA----AVNLRREGVTIFTMGI-EGANPDELEKIASHPAEQFTSKLGNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAH----KLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA 611          

HSP 4 Score: 59.6918 bits (143), Expect = 4.487e-9
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            L  I  HVCV  D  P      E  D+V L+DSS  +    F + K F+  +IS   I     RV L  +SD    EF L    +RN +L    HL+K    +G +  +G AL+E    ++    +G      P  +++L    +       E A  L+ +G  IIS+G+ +    NLK +     +  + T         NM  ++K VT
Sbjct:    7 LTMICFHVCVNQDSGP------EYADVVFLVDSSDHLGLKSFPLVKTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPML---NHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESE--DDVEEAAKALREDGVKIISVGVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVT 206          

HSP 5 Score: 57.3806 bits (137), Expect = 2.411e-8
Identity = 54/216 (25.00%), Postives = 95/216 (43.98%), Query Frame = 1
Query:   28 NKSKIIVKLASLPAISYLVSWKVYEATS-SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVC 657
            +K   +     L  I   VS  V  ++   C   K D VF++D S SI   DF+  K  +V ++     +    RI    F D     F    F    ++  Q++ ++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   V I +VGIG +++ +EL+ +  +    +TV +F +L +   +I+ ++C
Sbjct:  963 DKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQDEVAQ--AAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNIC 1175          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Match: Col6a6 (collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:MGI:2444259])

HSP 1 Score: 122.865 bits (307), Expect = 1.887e-29
Identity = 101/374 (27.01%), Postives = 181/374 (48.40%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAV 1224
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D+     ++V  ++N     G T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++E+ DLV LMD S SI   DF+  K F+  ++  F +     R+G+  FSD  R EF L       ++  +I+ ++++   T +G ALR+V++ F P        G P  +L+LTDG +       + A +L+ +G +I S+GIG  ++ +EL  I+   +K LTV++++ L+K  K +++ +
Sbjct:  808 DVVFVIDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNTTAKALRDKGILVLAVGIAG-ANSWELLAMAGSSDKYY---FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQ--DEVAQAAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174          

HSP 2 Score: 106.301 bits (264), Expect = 6.174e-24
Identity = 94/372 (25.27%), Postives = 179/372 (48.12%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQ 1194
            S+C   ++  +++L D S S   +DF   K  + +++          R+  + + D   L F   K+ N  D+ + ++N+R   G T  G AL  T + L    ++   +   ++++ T+G + +    P   A  L++ ++R+  +G+  E N+ +L  +A     +  V +F  L     +++  +C        E C+  + D++ L+DSS SI   +F   K F+ +L+SK QIG    ++G+V FS   + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  +   ++++TDG      R   IA  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ
Sbjct:  426 SACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGP---AHKLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA------EEACRDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPAIA--LRKEGVIIYSVGV-FGSNVTQLEEISGKPEMVFYVENFDILQ 784          

HSP 3 Score: 80.4925 bits (197), Expect = 1.272e-15
Identity = 90/394 (22.84%), Postives = 181/394 (45.94%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTD--GTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAIT--VADFQKLF---ENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGY--NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            D VF+LD + + S  D +  K  + + ++ +       R+  + + ++  +I +     N  +++++++++    G    G AL+ T + +    R     +   +  +L T     +NV  A    A +L+   V I T+GI    N  EL  +AS P    T  + +F +L    +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF++        L K I+++R++G  T  G AL    ++  +    R   +P ++++LT+G   ++V    H    KL+ E   + ++G+ +  N  +L +I+  +K +  V+ ++ L+     V++ +  
Sbjct:  228 DVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTHRASEDNVTKA----AVNLRREGVTIFTMGI-EGANPDELEKIASHPAEQFTSKLGNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAH----KLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA 611          

HSP 4 Score: 58.9214 bits (141), Expect = 1.040e-8
Identity = 54/217 (24.88%), Postives = 95/217 (43.78%), Query Frame = 1
Query:   28 NKSKIIVKLASLPAISYLVSWKVYEATS-SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCV 660
            +K   +     L  I   VS  V  ++   C   K D VF++D S SI   DF+  K  +V ++     +    RI    F D     F    F    ++  Q++ ++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   V I +VGIG +++ +EL+ +  +    +TV +F +L +   +I+ ++C 
Sbjct:  963 DKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQDEVAQ--AAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNICT 1176          

HSP 5 Score: 57.3806 bits (137), Expect = 3.271e-8
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            L  I  HVCV  D  P      E  D+V L+DSS  +    F + K F+  +IS   I     RV L  +SD    EF L    +RN +L    HL+K    +G +  +G AL+E    ++    +G      P  +++L    +       E A  L+ +G  IIS+G+ +    NLK +     +  + T         NM  ++K VT
Sbjct:    7 LTMICFHVCVNQDSGP------EYADVVFLVDSSDHLGLKSFPLVKTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPML---NHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESE--DDVEEAAKALREDGVKIISVGVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVT 206          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Match: Col6a6 (collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:MGI:2444259])

HSP 1 Score: 122.865 bits (307), Expect = 1.995e-29
Identity = 101/374 (27.01%), Postives = 181/374 (48.40%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAV 1224
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D+     ++V  ++N     G T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++E+ DLV LMD S SI   DF+  K F+  ++  F +     R+G+  FSD  R EF L       ++  +I+ ++++   T +G ALR+V++ F P        G P  +L+LTDG +       + A +L+ +G +I S+GIG  ++ +EL  I+   +K LTV++++ L+K  K +++ +
Sbjct:  808 DVVFVIDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNTTAKALRDKGILVLAVGIAG-ANSWELLAMAGSSDKYY---FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQ--DEVAQAAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174          

HSP 2 Score: 106.301 bits (264), Expect = 6.117e-24
Identity = 94/372 (25.27%), Postives = 179/372 (48.12%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQ 1194
            S+C   ++  +++L D S S   +DF   K  + +++          R+  + + D   L F   K+ N  D+ + ++N+R   G T  G AL  T + L    ++   +   ++++ T+G + +    P   A  L++ ++R+  +G+  E N+ +L  +A     +  V +F  L     +++  +C        E C+  + D++ L+DSS SI   +F   K F+ +L+SK QIG    ++G+V FS   + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  +   ++++TDG      R   IA  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ
Sbjct:  426 SACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGP---AHKLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA------EEACRDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPAIA--LRKEGVIIYSVGV-FGSNVTQLEEISGKPEMVFYVENFDILQ 784          

HSP 3 Score: 80.4925 bits (197), Expect = 1.261e-15
Identity = 90/394 (22.84%), Postives = 181/394 (45.94%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTD--GTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAIT--VADFQKLF---ENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGY--NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            D VF+LD + + S  D +  K  + + ++ +       R+  + + ++  +I +     N  +++++++++    G    G AL+ T + +    R     +   +  +L T     +NV  A    A +L+   V I T+GI    N  EL  +AS P    T  + +F +L    +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF++        L K I+++R++G  T  G AL    ++  +    R   +P ++++LT+G   ++V    H    KL+ E   + ++G+ +  N  +L +I+  +K +  V+ ++ L+     V++ +  
Sbjct:  228 DVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTHRASEDNVTKA----AVNLRREGVTIFTMGI-EGANPDELEKIASHPAEQFTSKLGNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAH----KLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA 611          

HSP 4 Score: 58.9214 bits (141), Expect = 1.067e-8
Identity = 54/217 (24.88%), Postives = 95/217 (43.78%), Query Frame = 1
Query:   28 NKSKIIVKLASLPAISYLVSWKVYEATS-SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCV 660
            +K   +     L  I   VS  V  ++   C   K D VF++D S SI   DF+  K  +V ++     +    RI    F D     F    F    ++  Q++ ++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   V I +VGIG +++ +EL+ +  +    +TV +F +L +   +I+ ++C 
Sbjct:  963 DKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQDEVAQ--AAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNICT 1176          

HSP 5 Score: 57.3806 bits (137), Expect = 3.271e-8
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            L  I  HVCV  D  P      E  D+V L+DSS  +    F + K F+  +IS   I     RV L  +SD    EF L    +RN +L    HL+K    +G +  +G AL+E    ++    +G      P  +++L    +       E A  L+ +G  IIS+G+ +    NLK +     +  + T         NM  ++K VT
Sbjct:    7 LTMICFHVCVNQDSGP------EYADVVFLVDSSDHLGLKSFPLVKTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPML---NHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESE--DDVEEAAKALREDGVKIISVGVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVT 206          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Match: Col6a4 (collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:MGI:1915803])

HSP 1 Score: 116.701 bits (291), Expect = 1.962e-27
Identity = 110/403 (27.30%), Postives = 189/403 (46.90%), Query Frame = 1
Query:   52 LASLPAISYLVSWKVYEATS-SC-SWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPF---NILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVT 1227
            L+ +P +   +     ++T   C S  K D  F++D S SI  +DF   K  + +++          R   + + D     F   ++ ++  +   + N++   G T  GKAL           R D  RY+I+ TDG  T+ V  A    A  L+D  V I  +G+  + N  EL  +AS  M      F   F++L  I  H  VI D   +E CK ++ D++ L+D S+SI+  DFE  K F+  ++++  IG    ++GL+ FS +P+ EF L+    +  +   I  ++++   T  G AL      F+   R G P     ++++TDG   +NV P     A  L+     I ++G+G ++   +L +I+++ DK+    ++E LQ   K +L  V 
Sbjct:  820 LSGMPPLMSFIPESTRQSTQEGCESVEKADIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQSTDPVAEA----AQGLRDIGVNIYAIGV-RDANTTELEEIASKKMF-----FIYEFDSLKSI--HQEVIRDICSSENCKSQKADIIFLIDGSESIAPKDFEKMKDFMERMVNQSNIGADEIQIGLLQFSSNPQEEFRLNRYSSKVDMCRAILSVQQMSDGTHTGKAL-NFTLPFFDSSRGGRPRVHQYLIVITDGVSQDNVAP----PAKALRDRNIIIFAIGVG-NVQRAQLLEITNDQDKVFQEENFESLQSLEKEILSEVC 1204          

HSP 2 Score: 73.559 bits (179), Expect = 2.297e-13
Identity = 100/399 (25.06%), Postives = 173/399 (43.36%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNA---DNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV--RNDNGATAIGKALK-LTYENLVPQMRKDAQR------YVILFTDGTNNV-FPAPYIYADHLKDASVRILTVGIGSEINKKEL---INLASPNMAITVADFQKLFENLMKIIHHVCV--------IVDPIP-------NEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRP-HEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D VF+++   S    +F+   RV+  + T + + N      R+S + + +   L F+ D +++   ++R +  +  R   G    G AL  L  E  +P+      R       VI+ +   +NV  PA Y     L+ A V I   G       K+L   +       AI +  F +L     K+   +C         ++  IP        E C+ VE+ D+  L+D S SI   DF   K F+  +I  F IGP   R G+V +SD    +F L        +   I +++++G  T  G AL ++   F    R  +   ++++TDG +     P  E A  L+  G NI ++G+ R  N  EL +I+S  K+  +  ++ L+   + V++ + 
Sbjct:  634 DLVFLVEDFSSARQPNFQ---RVVHFLTTTVHSLNIHPDTTRVSLVFYSEKPRLEFSLDMYQSAAQVLRHLDRLTFRARRGRAKAGAALDFLRKEVFLPEKGSRPHRGVQQIAVVIIESPSLDNVSTPASY-----LRRAGVTIYAAGTQPASESKDLEKIVTYPPWKHAIRLESFLQLSVVGNKLKKKLCPEMLSGMPPLMSFIPESTRQSTQEGCESVEKADIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQST---DPVAEAAQGLRDIGVNIYAIGV-RDANTTELEEIASK-KMFFIYEFDSLKSIHQEVIRDIC 1019          

HSP 3 Score: 70.0922 bits (170), Expect = 2.980e-12
Identity = 84/370 (22.70%), Postives = 149/370 (40.27%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRN-DNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEP-------------CKVE-QQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFW------------PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDI 1146
            D VF++D SQ  S + F+  +  I +++  ++      +I    + D     F F+  K  N+MV  +  +     G+   G+ L+  +     E    ++ +   +YV++ T G +         A  L+   V I++VG+  + ++ EL  +      + V+D Q   + + +++  V + +   P  P             C V    DLV L++   S   P+F+    F+   +    I P  TRV LV +S+ PR+EF L +       + ++HL +L      G A       F             PHR       ++I +   +NV       AS L+R G  I + G       K+L  I
Sbjct:  430 DVVFLIDTSQGTSQASFQWMQNFISRIIGILEVGQDKYQIGLAQYSDQGHTEFLFNTHKTRNEMVAHIHELLVFQGGSRKTGQGLRFLHRTFFQEAAGSRLLQGVPQYVVVITSGKSEDEVGEV--AQILRKRGVDIVSVGL-QDFDRAELEGIGP---VVLVSDLQGE-DRIRQLMLDVNMFIQGSPKPPRVMTDVAKDAVEECLVPVPADLVFLVEDFSSARQPNFQRVVHFLTTTVHSLNIHPDTTRVSLVFYSEKPRLEFSLDMY--QSAAQVLRHLDRLTFRARRGRAKAGAALDFLRKEVFLPEKGSRPHRGVQQIAVVIIESPSLDNV----STPASYLRRAGVTIYAAGTQPASESKDLEKI 786          

HSP 4 Score: 65.4698 bits (158), Expect = 7.441e-11
Identity = 80/357 (22.41%), Postives = 158/357 (44.26%), Query Frame = 1
Query:  241 DN-RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDA---------QRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGI--GSEINKKELINLASPNMAITVADF-------QKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSATGLGLALREVQFK-----FWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS---NDKILTVNSYERLQKNMKTVLKAVT 1227
            DN R+    + D  T  F    +    D+++ ++ ++   G   +G+AL+   E+     R+ A         Q  V++ +  T +    P   A+ L+ A + +  +G+   S+   +E+ +    N    V +F       QKL   L   +       +       +    D+V L+DSS SI   +F+  K F+  ++S   +     +VGLV +SD+    F L     ++ VL++I++L      T  G AL  ++            + G+P  ++++TDG ++      ++A +LKR+G  +  +GI    +++EL  I++    + + T  ++  LQ    T+L+A+ 
Sbjct:   67 DNIRVGLAQYSDTPTSEFLLSVYHRKGDVLKHIRGLQFKPGGNRMGQALQFILEH---HFREGAGSRASQGVPQVAVVVSSGLTEDHIREP---AEALRRAGILVYAIGVKDASQAELREISSSPKDNFTFFVPNFPGLPGLAQKLRPELCSTLGKAAQYTERESPACSEASPADIVFLVDSSTSIGLQNFQKVKHFLHSVVSGLDVRSDQVQVGLVQYSDNIYPAFPLKQSSLKSAVLDRIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQIVVLVTDGESS--DEVQDVADQLKRDGVFVFVVGINIQ-DVQELQKIANEPFEEFLFTTENFSILQALSGTLLQALC 414          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Match: Vwa2 (von Willebrand factor A domain containing 2 [Source:MGI Symbol;Acc:MGI:2684334])

HSP 1 Score: 105.145 bits (261), Expect = 1.074e-23
Identity = 88/368 (23.91%), Postives = 160/368 (43.48%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH---GIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            D +F+LD+S   +   F  AK  + + +  +   ++  R+    +G +  +     +++++ D++R + ++    G T  G AL    E+      +  Q    R V+L T+  +      PA +  A  L       L +G+GSEI + EL+ +  SP   +   D Q LF  + ++   +C    P P   C+ +  DLV L+D+S S+   +F   + F+     +F + P  T+VGLV +    +  F L     R  VL  +     LG     G AL  ++ K    +R    G+P  +++LT G    +   P     A KL+  G +++ + +G  +           D ++ V +Y  L
Sbjct:  342 DVLFLLDSSAGTTLGGFRRAKAFVKRFVQAVLREDSRARVGIASYGRNLMVAVPVGEYQHVPDLIRSLDSIPFSGGPTLTGSALLQVAEHGFGSASRTGQDRPRRVVVLLTESRSQDEVSGPAAHARAREL-------LLLGVGSEILQAELVKITGSPKHVMVHTDPQDLFSQIPELQRRLCS--QPRPG--CQAQSLDLVFLLDASASVGRENFAQMQSFIRKCTLRFDVNPDVTQVGLVVYGSRVQTAFGLDTHPTRAAVLRAMSQAPYLGGVGSAGTALLHIEDKVMTVQRGARPGVPKAVVMLTGGSGAEDAAVP-----AQKLRGNGISVLVMSVGAVLREAVRRLAGPRDSLIHVAAYTDL 693          

HSP 2 Score: 65.0846 bits (157), Expect = 7.917e-11
Identity = 49/156 (31.41%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK 1161
            D++ L+D S SI    FE  KRF         I P   RVG + F   P +EF L     R +V E IK +   G  T  GLAL+ +   F   R   +P  ++I+TDG +      P     A +L+  G  + ++G+ R     EL  ++S  K
Sbjct:   51 DILFLLDGSHSIGKGSFERSKRFAIAACDALDISPGRVRVGALQFGSTPHLEFPLDSFSTRQEVKESIKGIVFKGGRTETGLALKRLSRGFPGGRNGSVPQILIIVTDGKSQGPVALP-----AKQLRERGIVVFAVGV-RFPRWDELLTLASEPK 200          

HSP 3 Score: 54.6842 bits (130), Expect = 1.704e-7
Identity = 39/150 (26.00%), Postives = 62/150 (41.33%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS 582
            D +F+LD S SI    FE +KR  +     +  +    R+  + FG    L F  D F    ++   +K +    G T  G ALK               + +I+ TDG +    A  + A  L++  + +  VG+       EL+ LAS
Sbjct:   51 DILFLLDGSHSIGKGSFERSKRFAIAACDALDISPGRVRVGALQFGSTPHLEFPLDSFSTRQEVKESIKGIVFKGGRTETGLALKRLSRGFPGGRNGSVPQILIIVTDGKSQGPVA--LPAKQLRERGIVVFAVGV-RFPRWDELLTLAS 197          
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Match: sp|Q8C6K9|CO6A6_MOUSE (Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.395e-28
Identity = 101/374 (27.01%), Postives = 181/374 (48.40%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAV 1224
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D+     ++V  ++N     G T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++E+ DLV LMD S SI   DF+  K F+  ++  F +     R+G+  FSD  R EF L       ++  +I+ ++++   T +G ALR+V++ F P        G P  +L+LTDG +       + A +L+ +G +I S+GIG  ++ +EL  I+   +K LTV++++ L+K  K +++ +
Sbjct:  808 DVVFVIDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNTTAKALRDKGILVLAVGIAG-ANSWELLAMAGSSDKYY---FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQ--DEVAQAAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174          

HSP 2 Score: 106.301 bits (264), Expect = 4.279e-23
Identity = 94/372 (25.27%), Postives = 179/372 (48.12%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQ 1194
            S+C   ++  +++L D S S   +DF   K  + +++          R+  + + D   L F   K+ N  D+ + ++N+R   G T  G AL  T + L    ++   +   ++++ T+G + +    P   A  L++ ++R+  +G+  E N+ +L  +A     +  V +F  L     +++  +C        E C+  + D++ L+DSS SI   +F   K F+ +L+SK QIG    ++G+V FS   + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  +   ++++TDG      R   IA  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ
Sbjct:  426 SACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGP---AHKLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA------EEACRDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPAIA--LRKEGVIIYSVGV-FGSNVTQLEEISGKPEMVFYVENFDILQ 784          

HSP 3 Score: 80.4925 bits (197), Expect = 8.820e-15
Identity = 90/394 (22.84%), Postives = 181/394 (45.94%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTD--GTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAIT--VADFQKLF---ENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGY--NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            D VF+LD + + S  D +  K  + + ++ +       R+  + + ++  +I +     N  +++++++++    G    G AL+ T + +    R     +   +  +L T     +NV  A    A +L+   V I T+GI    N  EL  +AS P    T  + +F +L    +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF++        L K I+++R++G  T  G AL    ++  +    R   +P ++++LT+G   ++V    H    KL+ E   + ++G+ +  N  +L +I+  +K +  V+ ++ L+     V++ +  
Sbjct:  228 DVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTHRASEDNVTKA----AVNLRREGVTIFTMGI-EGANPDELEKIASHPAEQFTSKLGNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAH----KLREENIRVHAIGV-KEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICA 611          

HSP 4 Score: 58.9214 bits (141), Expect = 7.466e-8
Identity = 54/217 (24.88%), Postives = 95/217 (43.78%), Query Frame = 1
Query:   28 NKSKIIVKLASLPAISYLVSWKVYEATS-SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCV 660
            +K   +     L  I   VS  V  ++   C   K D VF++D S SI   DF+  K  +V ++     +    RI    F D     F    F    ++  Q++ ++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   V I +VGIG +++ +EL+ +  +    +TV +F +L +   +I+ ++C 
Sbjct:  963 DKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQDEVAQ--AAEELRHKGVDIYSVGIG-DVDDQELVQITGTAEKKLTVHNFDELKKVKKRIVRNICT 1176          

HSP 5 Score: 57.3806 bits (137), Expect = 2.288e-7
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            L  I  HVCV  D  P      E  D+V L+DSS  +    F + K F+  +IS   I     RV L  +SD    EF L    +RN +L    HL+K    +G +  +G AL+E    ++    +G      P  +++L    +       E A  L+ +G  IIS+G+ +    NLK +     +  + T         NM  ++K VT
Sbjct:    7 LTMICFHVCVNQDSGP------EYADVVFLVDSSDHLGLKSFPLVKTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPML---NHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESE--DDVEEAAKALREDGVKIISVGVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVT 206          
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Match: sp|A6NMZ7|CO6A6_HUMAN (Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 8.882e-28
Identity = 100/375 (26.67%), Postives = 181/375 (48.27%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT----YENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH----GIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVT 1227
            D VF++D+S SI   ++ + K  ++ ++          R   + + DD  ++F  D F    +++  ++N +   G+T   +AL  +     E    ++ K   + +I+ TDG ++        A  L+D  + +L VGI    N  EL+ +A  +       F + F  L  I   V   V       C++++ DLV LMD S SI   DF+  K F+A ++  F +     R+G   FSD    EF L   +   ++  +I++++++   T +G ALREV+  F P        G P  +L+LTDG +       + A  L+  G +I S+GIG  ++ ++L  I+   +K LTV++++ L+K  K +++ + 
Sbjct:  809 DVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDG-ANPVELLAMAGSSDKYF---FVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFKKMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQ--DEVAQAAEALRHRGIDIYSVGIG-DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNIC 1176          

HSP 2 Score: 117.472 bits (293), Expect = 8.008e-27
Identity = 99/373 (26.54%), Postives = 183/373 (49.06%), Query Frame = 1
Query:  109 SSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR---YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAIT-VADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQK 1197
            S C   ++  +++L D S S  ++DF   K  + +++          R+  + + D   L F  +K+ N  D+ + ++N+R   G T  G AL  T   L    ++   +   ++++ T+G + +    P   A+ L++  +R+  +GI  E N+ +L  +A     +  V DF  L +   +++  +C        E CK  + D++ L+DSS SI   +F   K F+ +L+SK QIGP   ++G+V FSD  + EF L+  + ++ +   I  +  +G  T  G AL  V   F P +  R  I   ++++TDG      +  E A  L++EG  I S+G+    N+ +L +IS   + +  V +++ LQ+
Sbjct:  427 SGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEP---ANRLREEHIRVYAIGI-KEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICT------EEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVK--EPAVVLRQEGVIIYSVGV-FGSNVTQLEEISGRPEMVFYVENFDILQR 786          

HSP 3 Score: 83.5741 bits (205), Expect = 9.239e-16
Identity = 90/395 (22.78%), Postives = 180/395 (45.57%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENL------------VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPNMAI----TVADFQKLFENLMK-----IIHHVCVI---VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALR---EVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVT 1227
            D VF+LD S + S  +F+  K  + + ++ +       R+  + + ++  +I +     N +++++ ++N+    G    G A+K   + +            VPQ+       ++   D  +NV  A    A +L+   V I T+GI G+   + E I        +    T AD     +  +K     I H V V     + + +     E+ D+ +L+D S S    DF   K F++ ++  F I P   RVG V ++D   +EF+++     + L K I+++R++G  T  G AL     +  K    R + +P ++++LT+G +       E A++L+ E   + ++GI +  N  +L +I+  +K +  V+ ++ L+     V++ + 
Sbjct:  229 DVVFLLDMSINGSEENFDYLKGFLEESVSALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIA-----VLVTHRDSEDNVTKA----AVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSK--DSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEIC 611          

HSP 4 Score: 57.3806 bits (137), Expect = 2.191e-7
Identity = 58/211 (27.49%), Postives = 93/211 (44.08%), Query Frame = 1
Query:  631 LMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRK----LGSATGLGLALREVQFKFWPHRRHG-----IPFNILIL--TDGYNNVFPRPHEIASKLKREGANIISLGIGR--HINLKELTDISSNDKILTVNSYERLQKNMKTVLKAV 1224
            L+ I  H+ V  D  P      E  D+V L+DSS  +    F   K F+  +IS   I     RV L  +SD    EF  HL         + HLRK    +G +  +G AL+E    ++    +G      P  +++L  ++  +NV     E +  L+++G  IIS+G+ +    NLK +     +  + TV       +NM  ++K V
Sbjct:    8 LVIICSHISVNQDSGP------EYADVVFLVDSSDRLGSKSFPFVKMFITKMISSLPIEADKYRVALAQYSDKLHSEF--HLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPANGRDKKQFPPILVVLASSESEDNV----EEASKALRKDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDV 206          

HSP 5 Score: 55.8398 bits (133), Expect = 7.186e-7
Identity = 47/187 (25.13%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM----RKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCV 660
            C   K D VF++D S SI  +DF+  K  +  ++     +    RI    F D     F    F    ++  Q++N++   G T IG AL+       P M         + +++ TDG +    A    A+ L+   + I +VGIG +++ ++LI +  +    +TV +F +L +   +I+ ++C 
Sbjct:  994 CEIDKVDLVFLMDGSTSIQPNDFKKMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQ--AAEALRHRGIDIYSVGIG-DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1177          
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Match: sp|A2AX52|CO6A4_MOUSE (Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.372e-26
Identity = 110/403 (27.30%), Postives = 189/403 (46.90%), Query Frame = 1
Query:   52 LASLPAISYLVSWKVYEATS-SC-SWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPF---NILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVT 1227
            L+ +P +   +     ++T   C S  K D  F++D S SI  +DF   K  + +++          R   + + D     F   ++ ++  +   + N++   G T  GKAL           R D  RY+I+ TDG  T+ V  A    A  L+D  V I  +G+  + N  EL  +AS  M      F   F++L  I  H  VI D   +E CK ++ D++ L+D S+SI+  DFE  K F+  ++++  IG    ++GL+ FS +P+ EF L+    +  +   I  ++++   T  G AL      F+   R G P     ++++TDG   +NV P     A  L+     I ++G+G ++   +L +I+++ DK+    ++E LQ   K +L  V 
Sbjct:  820 LSGMPPLMSFIPESTRQSTQEGCESVEKADIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQSTDPVAEA----AQGLRDIGVNIYAIGV-RDANTTELEEIASKKMF-----FIYEFDSLKSI--HQEVIRDICSSENCKSQKADIIFLIDGSESIAPKDFEKMKDFMERMVNQSNIGADEIQIGLLQFSSNPQEEFRLNRYSSKVDMCRAILSVQQMSDGTHTGKAL-NFTLPFFDSSRGGRPRVHQYLIVITDGVSQDNVAP----PAKALRDRNIIIFAIGVG-NVQRAQLLEITNDQDKVFQEENFESLQSLEKEILSEVC 1204          

HSP 2 Score: 73.559 bits (179), Expect = 1.607e-12
Identity = 100/399 (25.06%), Postives = 173/399 (43.36%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNA---DNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV--RNDNGATAIGKALK-LTYENLVPQMRKDAQR------YVILFTDGTNNV-FPAPYIYADHLKDASVRILTVGIGSEINKKEL---INLASPNMAITVADFQKLFENLMKIIHHVCV--------IVDPIP-------NEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRP-HEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D VF+++   S    +F+   RV+  + T + + N      R+S + + +   L F+ D +++   ++R +  +  R   G    G AL  L  E  +P+      R       VI+ +   +NV  PA Y     L+ A V I   G       K+L   +       AI +  F +L     K+   +C         ++  IP        E C+ VE+ D+  L+D S SI   DF   K F+  +I  F IGP   R G+V +SD    +F L        +   I +++++G  T  G AL ++   F    R  +   ++++TDG +     P  E A  L+  G NI ++G+ R  N  EL +I+S  K+  +  ++ L+   + V++ + 
Sbjct:  634 DLVFLVEDFSSARQPNFQ---RVVHFLTTTVHSLNIHPDTTRVSLVFYSEKPRLEFSLDMYQSAAQVLRHLDRLTFRARRGRAKAGAALDFLRKEVFLPEKGSRPHRGVQQIAVVIIESPSLDNVSTPASY-----LRRAGVTIYAAGTQPASESKDLEKIVTYPPWKHAIRLESFLQLSVVGNKLKKKLCPEMLSGMPPLMSFIPESTRQSTQEGCESVEKADIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQST---DPVAEAAQGLRDIGVNIYAIGV-RDANTTELEEIASK-KMFFIYEFDSLKSIHQEVIRDIC 1019          

HSP 3 Score: 70.0922 bits (170), Expect = 2.085e-11
Identity = 84/370 (22.70%), Postives = 149/370 (40.27%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRN-DNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEP-------------CKVE-QQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFW------------PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDI 1146
            D VF++D SQ  S + F+  +  I +++  ++      +I    + D     F F+  K  N+MV  +  +     G+   G+ L+  +     E    ++ +   +YV++ T G +         A  L+   V I++VG+  + ++ EL  +      + V+D Q   + + +++  V + +   P  P             C V    DLV L++   S   P+F+    F+   +    I P  TRV LV +S+ PR+EF L +       + ++HL +L      G A       F             PHR       ++I +   +NV       AS L+R G  I + G       K+L  I
Sbjct:  430 DVVFLIDTSQGTSQASFQWMQNFISRIIGILEVGQDKYQIGLAQYSDQGHTEFLFNTHKTRNEMVAHIHELLVFQGGSRKTGQGLRFLHRTFFQEAAGSRLLQGVPQYVVVITSGKSEDEVGEV--AQILRKRGVDIVSVGL-QDFDRAELEGIGP---VVLVSDLQGE-DRIRQLMLDVNMFIQGSPKPPRVMTDVAKDAVEECLVPVPADLVFLVEDFSSARQPNFQRVVHFLTTTVHSLNIHPDTTRVSLVFYSEKPRLEFSLDMY--QSAAQVLRHLDRLTFRARRGRAKAGAALDFLRKEVFLPEKGSRPHRGVQQIAVVIIESPSLDNV----STPASYLRRAGVTIYAAGTQPASESKDLEKI 786          

HSP 4 Score: 65.4698 bits (158), Expect = 5.205e-10
Identity = 80/357 (22.41%), Postives = 158/357 (44.26%), Query Frame = 1
Query:  241 DN-RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDA---------QRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGI--GSEINKKELINLASPNMAITVADF-------QKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSATGLGLALREVQFK-----FWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS---NDKILTVNSYERLQKNMKTVLKAVT 1227
            DN R+    + D  T  F    +    D+++ ++ ++   G   +G+AL+   E+     R+ A         Q  V++ +  T +    P   A+ L+ A + +  +G+   S+   +E+ +    N    V +F       QKL   L   +       +       +    D+V L+DSS SI   +F+  K F+  ++S   +     +VGLV +SD+    F L     ++ VL++I++L      T  G AL  ++            + G+P  ++++TDG ++      ++A +LKR+G  +  +GI    +++EL  I++    + + T  ++  LQ    T+L+A+ 
Sbjct:   67 DNIRVGLAQYSDTPTSEFLLSVYHRKGDVLKHIRGLQFKPGGNRMGQALQFILEH---HFREGAGSRASQGVPQVAVVVSSGLTEDHIREP---AEALRRAGILVYAIGVKDASQAELREISSSPKDNFTFFVPNFPGLPGLAQKLRPELCSTLGKAAQYTERESPACSEASPADIVFLVDSSTSIGLQNFQKVKHFLHSVVSGLDVRSDQVQVGLVQYSDNIYPAFPLKQSSLKSAVLDRIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQIVVLVTDGESS--DEVQDVADQLKRDGVFVFVVGINIQ-DVQELQKIANEPFEEFLFTTENFSILQALSGTLLQALC 414          
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Match: sp|P15989|CO6A3_CHICK (Collagen alpha-3(VI) chain OS=Gallus gallus OX=9031 GN=COL6A3 PE=2 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.926e-23
Identity = 107/413 (25.91%), Postives = 195/413 (47.22%), Query Frame = 1
Query:   61 LPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLVPQ-----MRKDAQRYVILFTDGTNNVFPAPYIY-ADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVI----VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDGYN-NVFPRPHEIASKLKREGANIISLGI-GRHINLKELTDISSNDK-ILTVNSYER---LQKNMKTVLKAV 1224
            L  I  L    V   T S    K+D +F+LD S ++ +++F   +  +V ++ ++       R+  + F D     F+   ++  +D+++++  +R   G+    G AL     N   +     + +   + ++L T G + V   P++  ++ L  A V    VG+    +K EL  +A +P M   + DF  L     ++   +  I    V+ +P  P +  ++D++ L+D S ++ G  F   + F+  +IS   +GP ATRV +  FSD+ +IEFD   L  +  +L K+K +R K G    +G+AL EV  + +          GIP  +++L  G + +   RP   +  LK  G  +++  I  ++ +L EL  I+   + IL V S  R   LQ N+  +LK +
Sbjct:  620 LSPIRTLSGGMVIHETPSVQVTKRDIIFLLDGSLNVGNANFPFVRDFVVTLVNYLDVGTDKIRVGLVQFSDTPKTEFSLYSYQTKSDIIQRLGQLRPKGGSVLNTGSALNFVLSNHFTEAGGSRINEQVPQVLVLVTAGRSAV---PFLQVSNDLARAGVLTFAVGV-RNADKAELEQIAFNPKMVYFMDDFSDLTTLPQELKKPITTIVSGGVEEVPLAPTE-SKKDILFLIDGSANLLG-SFPAVRDFIHKVISDLNVGPDATRVAVAQFSDNIQIEFDFAELPSKQDMLLKVKRMRLKTGKQLNIGVALDEVMRRLFVKEAGSRIEEGIPQFLVLLAAGRSTDEVERP---SGALKEAG--VVTFAIKAKNADLSELERIAYAPQFILNVESLPRISELQANIVNLLKTI 1021          

HSP 2 Score: 78.1814 bits (191), Expect = 5.366e-14
Identity = 67/293 (22.87%), Postives = 131/293 (44.71%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINK--KELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDP-------IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLR-KLGSATGLGLALREV 963
            D +F++D+S SI    F+L +  +  ++  +     D R + + F  +    F  + + +  D++  + N+    G +  GK L+   EN +      +  +   + +I+ TDG +    A  + +  LK A V ++ VG+   +    KE+ +         + +F  L   +  ++  V   + P       +  +    E  DL+ L+D S +I   +F+  + F+ +LI   ++G +   +G+V +SD PR EF L+    +  VL+ +K L  + G     G AL  V
Sbjct:   38 DIIFLVDSSWSIGKEHFQLVREFLYDVVKALDVGGNDFRFALVQFSGNPHTEFQLNTYPSNQDVLSHIANMPYMGGGSKTGKGLEYLIENHLTKAAGSRASEGVPQVIIVLTDGQSQDDVA--LPSSVLKSAHVNMIAVGVQDAVEGELKEIASRPFDTHLFNLENFTALHGIVGDLVASVRTSMTPEQAGAKGLVKDITAQESADLIFLIDGSDNIGSVNFQAIRDFLVNLIESLRVGAQQIHIGVVQYSDQPRTEFALNSYSTKADVLDAVKALSFRGGKEANTGAALEYV 328          

HSP 3 Score: 76.2554 bits (186), Expect = 2.356e-13
Identity = 88/388 (22.68%), Postives = 182/388 (46.91%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLVPQ-----MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKL-------FENLMKIIHHVCVIVDP-IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSD--HPRIEFDLHLVDRNKVLEKIKHLRKL-GSATGLGLALREVQFKFWP-----HRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAV 1224
            D +F++D S +I S +F+  +  +V ++  ++       I  + + D     F  + +    D++  VK +    G  A  G AL+   ENL  Q     + +   + ++L + G ++      + A  +K AS+   ++G+    +  EL  +A+  + A T  D + L         N++ +   + ++  P I  E  +V ++D+V L+D S ++    F   + FVA ++ + ++GP   +V +  ++D   P   F+ H  +R  V+  +K ++ + G+A   G AL  V+  F+          G+   ++++T G +       + A+++KR    I+++G  R+ ++ EL +I+   D +   N + RLQ  M+ +L  V
Sbjct:  241 DLIFLIDGSDNIGSVNFQAIRDFLVNLIESLRVGAQQIHIGVVQYSDQPRTEFALNSYSTKADVLDAVKALSFRGGKEANTGAALEYVVENLFTQAGGSRIEEAVPQILVLISGGESSDDIREGLLA--VKQASIFSFSIGV-LNADSAELQQIATDGSFAFTALDIRNLAALRELLLPNIVGVAQRLILLEAPTIVTEVIEVNKKDIVFLIDGSTALGTGPFNSIRDFVAKIVQRLEVGPDLIQVAVAQYADTVRPEFYFNTHQ-NRKDVMANVKKMKLMGGTALNTGSALDFVRNNFFTSAAGCRMEEGVLPMLVLITGGKS--MDAVEQAAAEMKRNRIVILAVG-SRNADVAELQEIAHERDFVFQPNDF-RLQ-FMQAILPEV 619          

HSP 4 Score: 74.3294 bits (181), Expect = 9.192e-13
Identity = 88/403 (21.84%), Postives = 191/403 (47.39%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLV-----PQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVG-----IGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVI-----------VDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFW-----PHRRHGIPFN-ILILTDGYNNVFPRPHEIASKLKREGANIISLGIG-RHINLKELTDISSN-DKILTVNSY---ERLQKNMKTVLKAVT 1227
            K+D VF++D S+  ++ +F L + +I +++  +       RIS + F +   + F  +     +++   V+ +R   G    +G+AL+   + +       ++ +   +++++ +   ++         D L+  SV++  VG     I   ++ +E++ ++ SP+    V+ FQ+L     K++  +  +           V  IP+     E++D+V L+DSS S+        + F++ ++ +  +GP   R+G+V FS++   EF L     +N VL+ I+ LR + G     G AL  V   ++          G+P + ++IL D   +   RP  + S       +I  LG+G R+++  +L  I+++  ++L V  +     L++ ++ +L+ +T
Sbjct: 1237 KRDVVFLVDGSR-YAAQEFYLIRDLIERIVNNLDVGFDTTRISVVQFSEHPHVEFLLNAHSTKDEVQGAVRRLRPRGGQQVNVGEALEFVAKTIFTRPSGSRIEEGVPQFLVILSSRKSD---------DDLEFPSVQVKQVGVAPMVIAKNMDPEEMVQISLSPDYVFQVSSFQELPSLEQKLLAPIETLTADQIRQLLGDVTTIPD--VSGEEKDVVFLIDSSDSVRSDGLAHIRDFISRIVQQLDVGPNKVRIGVVQFSNNVFPEFYLRTHKSKNAVLQAIRRLRLRGGYPVNAGKALDYVVKNYFIKSAGSRIEDGVPQHLVVILGDQSQDDVNRPANVISS-----TSIQPLGVGARNVDRNQLQVITNDPGRVLVVQDFTGLPTLERKVQNILEELT 1622          

HSP 5 Score: 73.1738 bits (178), Expect = 2.405e-12
Identity = 88/369 (23.85%), Postives = 168/369 (45.53%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNG-ATAIGKALKLTYENLVP-----QMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADF-----QKLFENLMKIIHHVC--VIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLR-KLGSATGLGLALREV---QFKFWPHRR--HGIPFNILILTDGYNNVFPRPH-EIASKLKREGANIISLGIGRHINLKELTDISSNDKIL 1167
            K+D VF++D S ++ +  F   +  + K++  ++      +++   + D     F F+  +N  D++  VK ++   G A   G AL     N        +M +     ++L T G +    A    A  +K   + IL VG     +  EL  +A   +      DF     Q +   ++  I  +   +++   P+   +V ++D++ L+D S ++   +F   + FV  L++   +G    RVGLV FSD P+ EF L+    ++ +++++  LR K GS    G AL  V    F      R    +P  ++++T G + V   P  ++++ L R G    ++G+ R+ +  EL  I+ N K++
Sbjct:  442 KKDIVFLIDGSTALGTGPFNSIRDFVAKIVQRLEVGPDLIQVAVAQYADTVRPEFYFNTHQNRKDVMANVKKMKLMGGTALNTGSALDFVRNNFFTSAAGCRMEEGVLPMLVLITGGKS--MDAVEQAAAEMKRNRIVILAVG-SRNADVAELQEIAHERDFVFQPNDFRLQFMQAILPEVLSPIRTLSGGMVIHETPS--VQVTKRDIIFLLDGSLNVGNANFPFVRDFVVTLVNYLDVGTDKIRVGLVQFSDTPKTEFSLYSYQTKSDIIQRLGQLRPKGGSVLNTGSALNFVLSNHFTEAGGSRINEQVPQVLVLVTAGRSAV---PFLQVSNDLARAGVLTFAVGV-RNADKAELEQIAFNPKMV 801          

HSP 6 Score: 65.0846 bits (157), Expect = 7.343e-10
Identity = 92/421 (21.85%), Postives = 195/421 (46.32%), Query Frame = 1
Query:   37 KIIVKLASLPAISYLVSWKV-------YEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLV-----PQMRKDAQRYVILFT-DGTNNVFPAPYIYADHLKDASVRILTVGIG-SEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIV---------DPIPNEPCKVE-QQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLR-KLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERL 1191
            + I+ + SLP IS L +  V       ++ T      K+D VF++D S  +    F L K  + +++  +       R++ + + +     F  D +++  D+V  ++ +    G+    G AL    +N+       ++ +   +++IL T D + +    P +    LK +      +GIG +++ + + I+   P+ AI+V DF +L      + + V  +          D +   P  V  ++D+V L+D S+  +  +F + +  +  +++   +G   TR+ +V FS+HP +EF L+    +++V   ++ LR + G    +G AL  V    +          G+P  ++IL+   ++    FP     + ++K+ G  +  + I ++++ +E+  IS S D +  V+S++ L
Sbjct:  996 QFILNVESLPRISELQANIVNLLKTIQFQPTVVERGEKKDVVFLIDGSDGVRRG-FPLLKTFVERVVESLDIGRDKVRVAIVQYSNAIQPEFLLDAYEDKADLVSAIQALTIMGGSPLNTGAALDYLIKNVFTVSSGSRIAEGVPQFLILLTADRSQDDVRRPSVV---LKTSGTVPFGIGIGNADLTELQTISFL-PDFAISVPDFSQLDSVQQAVSNRVIRLTKKEIESLAPDLVFTSPSPVGVKRDVVFLVDGSR-YAAQEFYLIRDLIERIVNNLDVGFDTTRISVVQFSEHPHVEFLLNAHSTKDEVQGAVRRLRPRGGQQVNVGEALEFVAKTIFTRPSGSRIEEGVPQFLVILSSRKSDDDLEFP-----SVQVKQVG--VAPMVIAKNMDPEEMVQISLSPDYVFQVSSFQEL 1403          
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Match: sp|Q70UZ7|VWA2_MOUSE (von Willebrand factor A domain-containing protein 2 OS=Mus musculus OX=10090 GN=Vwa2 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 7.514e-23
Identity = 88/368 (23.91%), Postives = 160/368 (43.48%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRH---GIPFNILILTDGY---NNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            D +F+LD+S   +   F  AK  + + +  +   ++  R+    +G +  +     +++++ D++R + ++    G T  G AL    E+      +  Q    R V+L T+  +      PA +  A  L       L +G+GSEI + EL+ +  SP   +   D Q LF  + ++   +C    P P   C+ +  DLV L+D+S S+   +F   + F+     +F + P  T+VGLV +    +  F L     R  VL  +     LG     G AL  ++ K    +R    G+P  +++LT G    +   P     A KL+  G +++ + +G  +           D ++ V +Y  L
Sbjct:  342 DVLFLLDSSAGTTLGGFRRAKAFVKRFVQAVLREDSRARVGIASYGRNLMVAVPVGEYQHVPDLIRSLDSIPFSGGPTLTGSALLQVAEHGFGSASRTGQDRPRRVVVLLTESRSQDEVSGPAAHARAREL-------LLLGVGSEILQAELVKITGSPKHVMVHTDPQDLFSQIPELQRRLCS--QPRPG--CQAQSLDLVFLLDASASVGRENFAQMQSFIRKCTLRFDVNPDVTQVGLVVYGSRVQTAFGLDTHPTRAAVLRAMSQAPYLGGVGSAGTALLHIEDKVMTVQRGARPGVPKAVVMLTGGSGAEDAAVP-----AQKLRGNGISVLVMSVGAVLREAVRRLAGPRDSLIHVAAYTDL 693          

HSP 2 Score: 65.0846 bits (157), Expect = 5.538e-10
Identity = 49/156 (31.41%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK 1161
            D++ L+D S SI    FE  KRF         I P   RVG + F   P +EF L     R +V E IK +   G  T  GLAL+ +   F   R   +P  ++I+TDG +      P     A +L+  G  + ++G+ R     EL  ++S  K
Sbjct:   51 DILFLLDGSHSIGKGSFERSKRFAIAACDALDISPGRVRVGALQFGSTPHLEFPLDSFSTRQEVKESIKGIVFKGGRTETGLALKRLSRGFPGGRNGSVPQILIIVTDGKSQGPVALP-----AKQLRERGIVVFAVGV-RFPRWDELLTLASEPK 200          

HSP 3 Score: 54.6842 bits (130), Expect = 1.192e-6
Identity = 39/150 (26.00%), Postives = 62/150 (41.33%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS 582
            D +F+LD S SI    FE +KR  +     +  +    R+  + FG    L F  D F    ++   +K +    G T  G ALK               + +I+ TDG +    A  + A  L++  + +  VG+       EL+ LAS
Sbjct:   51 DILFLLDGSHSIGKGSFERSKRFAIAACDALDISPGRVRVGALQFGSTPHLEFPLDSFSTRQEVKESIKGIVFKGGRTETGLALKRLSRGFPGGRNGSVPQILIIVTDGKSQGPVA--LPAKQLRERGIVVFAVGV-RFPRWDELLTLAS 197          
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Match: A0A401PF96 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0001701 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 2.092e-35
Identity = 118/405 (29.14%), Postives = 202/405 (49.88%), Query Frame = 1
Query:   28 NKSKIIVKLASLPAISYLVSWKVYEATSSCSWF-KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKL--TYENLVPQMRKDAQ--RYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHH-VCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVL-EKIKHLRKLGSATGLGLALREVQFKF----WPHRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQK 1197
            +++  +     L  + + +SW +  + S C W  K D +F++D S SI+S  FE  +  ++ ++          RI  ++FGD     F  D  +  +D+ +Q+ N  +  G+T   +AL+L  T        RK+A   +++IL TDG           A  ++D++V+IL VG+ + + ++  +   S +    V +F  L E L K I + +C   +P     C+V + D+V L+D S SI+  DFE  K+F+ ++I   +IGP   +  L  +S     EF L+       L EKIK++ +L + T  GLAL+ V   F       +  G+P  +L++TDG +    V P     AS L++E  N+I++G+G   N  EL  IS + D+   ++ Y+ L K
Sbjct: 1484 DRAHYVESFDGLAKMEHKISWDMCHSPSDCKWTEKADILFVIDGSGSITSHQFESMRTFMLSLVNRTNVAKNKVRIGALIFGDKPETKFELDVLQTRDDVRKQIMNWTSVGGSTYTVEALQLAKTLLGKTHGGRKEAGVPQFLILITDGQATEKKGLNSTAAAIRDSNVQILAVGVQNAVEEELRMIAGSDDKWFYVHNFTHL-EYLSKNISNLICSNTEP----DCEVHEADIVFLIDGSGSIAPNDFESIKKFLEYIIKTLRIGPTKFQFALAQYSSTQATEFYLNYTSAQTALFEKIKNIAQLKAGTNTGLALKFVSGFFEQSAGSRKLKGVPQFLLVITDGQSQDSVVVP-----ASNLRKENINVIAIGVG-EANADELLQISGAPDRKFHLSGYKELDK 1877          

HSP 2 Score: 112.079 bits (279), Expect = 1.481e-22
Identity = 91/359 (25.35%), Postives = 170/359 (47.35%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSATGLGLALREVQFKFWP----HRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            C     D VF++D S+S+S+  F   K  +V ++          +   +++GD+   +F  D+F N N +   +  +    G+T   KAL      L P      Q    ++++LFT G           A+ ++++ + I  +G+ ++ NK +L+ +A   +      +F+ L   +  +    C   D  P+  C+V + D+V L+D S S S  DF+  K  +  ++  F  GP   +  +V +S  P   F L+    ++ +L++I+ +++L   T  G AL+ V   F P     +  G+P ++L++TDG +    V P     A+ L++E  N+ ++G+G+  N  EL  IS 
Sbjct:  663 CGAQVADIVFVIDGSESLSAVQFNHMKDFMVGLVNGSDVAADKVQFGAVLYGDNPQTVFQLDQFTNKNGIQNAINGMNPVGGSTHTAKALSYAKGLLDPVEGGRKQFGVPQFLLLFTGGKMEDKQQLKSAAEVIRNSDINIYAIGVENK-NKNQLLQIAGFQDNPFYALEFETLGPLMKAMFQKFC--DDSKPD--CEVHEADVVFLIDGSGSTSASDFKRKKDILKSVVKMFNTGPTKFQFAVVEYSTTPVTIFQLNGTSGQHDLLDRIEKIQQLSQGTMTGKALQFVMDLFQPTTGSRKLQGVPQHLLVITDGKSQDSVVVP-----ANSLRKENINVFAIGVGK-ANENELLQISG 1010          

HSP 3 Score: 97.0561 bits (240), Expect = 1.171e-17
Identity = 92/383 (24.02%), Postives = 181/383 (47.26%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADN---RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDGT--NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSAT----GLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSY---ERLQKNMKTVLKAVT 1227
            K D +F++D S SI   DF+  K     M TF+  ++      +I  I F  D  L+F  +K+ +  D+   +  +    G T  G+AL  T  Y +     R    +Y+I+ TDG   + VF      A  ++D  V +  +G+ +     +L+ +   +     A + + F+ L K+ H +   +   P++    E+ D++ ++D S SI+   FE  + F+  L+++  +     R+G + F D P  +F+L ++  R+ V ++I +   +G +T     L LA   +       +  G+P  ++++TDG        +  A+ ++     I+++G+   +  +EL  I+ S+DK   V+++   E L KN+  ++ + T
Sbjct: 1331 KSDIIFLIDGSTSIKPDDFQKMKTF---MTTFLNKSDVGPNKVQIGVIQFSTDPKLMFQLNKYTSKTDLHSVIDKMPQQFGNTYTGEALTFTADYFDEAKGGRTGIPQYLIVITDGEAHDEVFQP----AKAIRDKGVTVFALGVFTA-KYSQLLKIGGSH---DRAHYVESFDGLAKMEHKISWDMCHSPSDCKWTEKADILFVIDGSGSITSHQFESMRTFMLSLVNRTNVAKNKVRIGALIFGDKPETKFELDVLQTRDDVRKQIMNWTSVGGSTYTVEALQLAKTLLGKTHGGRKEAGVPQFLILITDGQATEKKGLNSTAAAIRDSNVQILAVGVQNAVE-EELRMIAGSDDKWFYVHNFTHLEYLSKNISNLICSNT 1701          

HSP 4 Score: 90.5077 bits (223), Expect = 1.930e-15
Identity = 93/380 (24.47%), Postives = 177/380 (46.58%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCV-IVDPIPNEPCK---VEQ-----QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH----LVDRNKVLEKIKHLRKLGSA-TGLGLALREVQFKFWPHRRHGIPFNILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK 1197
            D V+++D S SI  ++FEL +  +V ++  +       +I  I +    T  F  + F+   +++  +++V    G T  G+A+    +    + R     +   +  ++ TDG + +    P   A  L+   V++   GI  E  + EL ++AS    N    + DF  L     ++   +C  IV+ +  EP +   +EQ      D++ L+D S SI   DF+  K F+   ++K  +GP   ++G++ FS  P++ F L+      D + V++K+   ++ G+  TG  L      F      R GIP  ++++TDG  ++ VF    + A  ++ +G  + +LG+      + L    S+D+   V S++ L K
Sbjct: 1128 DIVYLVDESSSIGETNFELIRNFLVNVINAMDIGPDKVQIGLIQYSTITTPEFYLNTFQQKREVLDHIRSVPYRKGGTHTGEAINYMVQTYFTESRGSRINQGIPQVAVIITDGKSADDVKVP---ASALRALGVKVFAFGI-KEAVESELQSIASYPASNYVSHIEDFDLLRNVEDQMRKKICNDIVNTLLIEPHQDHIIEQDCGPKSDIIFLIDGSTSIKPDDFQKMKTFMTTFLNKSDVGPNKVQIGVIQFSTDPKLMFQLNKYTSKTDLHSVIDKMP--QQFGNTYTGEALTFTADYFDEAKGGRTGIPQYLIVITDGEAHDEVF----QPAKAIRDKGVTVFALGVFTAKYSQLLKIGGSHDRAHYVESFDGLAK 1497          

HSP 5 Score: 88.9669 bits (219), Expect = 6.270e-15
Identity = 97/382 (25.39%), Postives = 174/382 (45.55%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK-LTYENLVP----QMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVA-----DFQKLFENLM--KIIHHVCVIVDPIP------NEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFD-LHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRR----HGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            D VF++D S SI   +F+L +  +  +++ +       +I  + +       F  + F+N  D++R V+N+    GAT  G+ALK L      P    ++ +   +  ++ TDG   ++V  A    A  L+ A V +   GI   + + EL  +AS      V      D  K  EN +  KI   V   V  +P      ++ C + E+ ++  L+D S SI    F+  KRF+ ++++ F IG    RV +V ++D+ R+EF+      + +V   IK + ++   T  G AL  ++       R     G  F ++ +TDG +    + P     A +L+++G  + ++G+G         D S N+  L   + ER+
Sbjct:  227 DIVFVVDESSSIGEINFQLIRDFLRNLISVLDVGPEKVQIGLLQYSSITRPEFYLNTFQNKPDILRSVQNMLYRGGATYTGEALKHLKQHYFSPSSGSRLNQGVPQIAVVVTDGKSQDDVSEA----ASALRHAGVSVFAFGIKDAV-ESELRKIASYPAESHVELLQDFDLLKKIENRIEKKICTEVLQQVSMVPKQTEQLHQGCVETEEANIFFLVDGSSSIRPESFQDLKRFLVNIVNIFSIGADQVRVAVVQYADNARMEFESTQYTHKTEVERAIKQIVQIKGGTNTGRALTYMKSFVIDAERSRKTRGRSF-LITVTDGKSQDDVINP-----AVELRQQGVTVYAVGVG---------DASENELQLIAGADERV 588          

HSP 6 Score: 83.1889 bits (204), Expect = 4.655e-13
Identity = 88/367 (23.98%), Postives = 171/367 (46.59%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAI--GKALKLTYENL------------VPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAI---TVADFQKLFENLMKIIHHVC---VIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREV-QFKFWPHR----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            D VF++D SQ+++   F+  + +++KM+  +       RI    +       F  ++F+  + ++  +K      G + +  G+AL   ++              +PQ+       VI      ++V       A+ LK+  ++IL++G+ +  + +EL  +A  PN      +V +   L  N+  ++H V    +I+D  P         D+V ++D S SI   +F++ + F+ +LIS   +GP+  ++GL+ +S   R EF L+   ++  +L  ++++   G AT  G AL+ + Q  F P        G+P   +++TDG +       E AS L+  G ++ + GI   +   EL  I+S
Sbjct:   26 DIVFLVDGSQNLARQGFQQIRSLLIKMVNRLDIGIDRYRIGLAQYNGQVHTEFLLNRFQRKDALLSHLKKKYQYKGGSPLKTGRALDYIHKTFFTASAGSRKHEGIPQI-----AIVITSMRSKDDVTKG----ANALKNDRIKILSIGVKNS-DLQELQTMAFLPNYVFQTKSVNNLPLLARNITAMVHTVSQPNIILDE-PRVCQSASVADIVFVVDESSSIGEINFQLIRDFLRNLISVLDVGPEKVQIGLLQYSSITRPEFYLNTFQNKPDILRSVQNMLYRGGATYTGEALKHLKQHYFSPSSGSRLNQGVPQIAVVVTDGKSQ--DDVSEAASALRHAGVSVFAFGIKDAVE-SELRKIAS 378          

HSP 7 Score: 79.7221 bits (195), Expect = 5.020e-12
Identity = 55/255 (21.57%), Postives = 124/255 (48.63%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVP----QMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEF 864
            C   + D VF++D S S S+SDF+  K ++  ++    T     + + + +      IF  +     +D++ +++ ++  +  T  GKAL+   +   P    +  +   +++++ TDG +    +  + A+ L+  ++ +  +G+G + N+ EL+ ++ +P   I V  F +L +   +I+H++CV        P   +  D+V L++ ++ I   +F+  + F+  + ++  IG    R+G   F    + EF
Sbjct:  854 CEVHEADVVFLIDGSGSTSASDFKRKKDILKSVVKMFNTGPTKFQFAVVEYSTTPVTIFQLNGTSGQHDLLDRIEKIQQLSQGTMTGKALQFVMDLFQPTTGSRKLQGVPQHLLVITDGKSQ--DSVVVPANSLRKENINVFAIGVG-KANENELLQISGAPERKIYVEKFAELDQIKSRIVHNLCVPPAEAFFPPEMADAADVVFLVEGTQDIQ--EFKQIQNFMMGITAELNIGLHKNRIGFAQFGRDIKTEF 1103          
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Match: A0A210PQ58 (Collagen alpha-6(VI) chain OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09961 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.131e-32
Identity = 116/402 (28.86%), Postives = 195/402 (48.51%), Query Frame = 1
Query:   76 YLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADN-RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK-LTYENLVPQ--MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEP--CKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRN-KVLEKIKHLRKLGSATGLGLALREV-QFKFWPHRRHGIPFN----ILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVTCG*T 1239
            + +S  V + T  C   K D +F+LD+S S    +F+  +   VK +T I     +N +I    F       F  + + N   +   + NV    G T  G+ +  +T +       MR D    +++ TDG +         A     A + ++ +GIG  ++  EL  +AS P   +TV +F  L      +    C I  P P     CK  Q D+V ++DSS S    +F+   +FV++ ++  QIGP+  +VGLV+FSD  + EF L+  +    ++ K++++   GS T   L L+   QF+F    RHG   N     ++LTDG ++  P     AS+LK+ G  IIS+GIG  ++ +E+  I+S+ +   TV +++ L   +++ L+   CG T
Sbjct:   15 FYISLIVAQGTQDCRGQKSDIIFLLDSSTSEGQQNFK-HQLDFVKNLTAIYDIGPNNVQIGLASFSSHVHNQFWLNTYHNQASLQNAIGNVPFTFGNTNTGEGINFVTTQGFTSAHGMRNDVPNILVVMTDGQSQDGTNTASMASKAHQAGIEVVAIGIGDGVSTSELQAIASDPKHILTVENFLALASIQHNVAAATCNIATPAPLTALGCKTSQADVVFILDSSGSEGQNNFQKELQFVSNFVNNVQIGPQNIQVGLVTFSDIVKNEFYLNSFNNKLDIMTKLQNVSYRGSTTYTELGLQYARQFQFT--SRHGARPNATKIAVVLTDGQSHSRPATLSEASRLKQIGVKIISVGIGTQVSQEEINGIASDSNHAFTVATFDALHT-IQSELENTACGGT 412          

HSP 2 Score: 125.561 bits (314), Expect = 2.892e-27
Identity = 108/381 (28.35%), Postives = 189/381 (49.61%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV--RNDNGATAIGKALKLTYENLVPQ-MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDR-NKVLEKIKHLRKLGSATGLGLAL---REVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVTC 1230
            C   + D VFILD+S S   ++F+   + +   +  ++    + ++  + F D     F  + F N  D++ +++NV  R     T +G      ++       R +A +  ++ TDG ++  PA    A  LK   V+I++VGIG++++++E+  +AS  N A TVA F  L     ++ +  C    P     C  +  D+V ++DSS S  G +F    +F+++ +  F IGP   + GLV+FS   R EF L+  +    +  K+ ++  +GS T   L L   R+ QF      R       +ILTDG +         A  LK+ G  IIS+GIG +I+  EL  ++++ + +LTV S++ L   +++ LK  +C
Sbjct:  225 CKTSQADVVFILDSSGSEGQNNFQKELQFVSNFVNNVQIGPQNIQVGLVTFSDIVKNEFYLNSFNNKLDIMTKLQNVSYRGSTTYTELGLQYARQFQFTSRHGARPNATKIAVVLTDGQSHSRPATLSEASRLKQIGVKIISVGIGTQVSQEEINGIASDSNHAFTVATFDALHTIQSELENTACGGTIPPVTTTCGSKPADIVFILDSSGSEGGDNFNKQLQFMSNFVKHFSIGPHDVQFGLVTFSIQARNEFYLNTYNSVQDISNKLTNIAYIGSTTHTELGLQYARQFQFSSSHGARQNAQKIAIILTDGQSQSSTDTIHQADLLKQMGVKIISIGIGSYISQTELLSMAADQQHVLTVGSFDALHT-IQSELKESSC 604          
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Match: A0A3Q1HZ41 (Collagen type VI alpha 6 chain OS=Acanthochromis polyacanthus OX=80966 GN=COL6A6 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.097e-31
Identity = 113/405 (27.90%), Postives = 208/405 (51.36%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ---MRKDA--QRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS--PNMAI----TVADFQKLFENLMKIIHHVCVIVDPIP--------NEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKF---WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQ 1194
            ++P +  +V   V  AT S +    D VFI+D S SI  ++F+L +  +  +++ ++      R+  +++ D  T     + F N +++++ +K +    G T  G ALK   E++  +    RKD   Q+  ++ TDG + +    P   A  L+ A V I +VG+  + NK +L+ +AS  PN  +    T A  + + ++L KI+ +  +I   +          E C + ++ D+  L+D S SI   DF+  K+F+   +  F+IGP+  R+G+  ++D P +EFDL      K LEK ++ +R++G  T  G AL  +   F      R H +P  ++++TDG ++        A KL+ +G  + S+G+ +  ++KEL +IS + K    VN+++ L+
Sbjct:  192 AVPTLRSIVETAVENATLSGAAKFADIVFIVDESGSIGVANFQLVRAFLHSIVSRLEINQTRVRVGIVMYNDRPTAQVYLNTFNNKDELLKFIKILPYHGGGTNTGAALKFALESVFIKEQGSRKDKGIQQVAVVITDGESQDNVSQP---ATDLRRAGVTIYSVGV-KDANKVQLVEMASHPPNKHVFIVDTFAKLKSMEQSLQKILCY-NIIRQAVSVNTRRTGIKEGCVQTDEADIFFLIDHSGSIHPTDFQDMKKFIIEFLHTFRIGPQHIRMGVTKYADSPNLEFDLTTYSDAKSLEKAVEEIRQIGGGTETGRALEFMGPCFDRAMASRGHKVPEYLVVITDGKSS--DEVKAPAEKLRSQGVIVYSIGV-KQADMKELREISGDPKRTFFVNNFDALK 588          

HSP 2 Score: 113.235 bits (282), Expect = 5.147e-23
Identity = 93/379 (24.54%), Postives = 177/379 (46.70%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGT---NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWP----HRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            K D +F++D S SI+   F   ++ +  M+          R   I++ +D   IF  +++ +  ++++ +  +++  G T  GKAL  + +    Q    A     + +++ TDG     N   AP +    L+++ V + ++G+    N  +L  +A   M   V  F  +    +   H   + V       C+ ++ DLV L+D S SI+  D+ + K+F   LI  F++     RVGL  FS   + EF L        + + I  +R+LG  T +GLAL  ++  F       R  GI  N++++TDG +       + A +L+  G  + ++GIG   +L+ L    + +++ TV ++  L++  + V+K + 
Sbjct:  795 KADIIFLVDGSTSITLQKFRNMQKFMESMVNQTTVGKDLTRFGVILYSNDPKSIFTLNQYSSKKEVLKAISGLKSPYGDTYTGKALGYSLQFFDAQHGGRAALQVPQILMVITDGDATDRNSLVAPSV---ALRNSGVSVFSIGV-EGANMTQLQIMAGRKMDGIVLYFITVINCNVDEYHVFALSV-------CQKQKADLVFLIDQSGSINSTDYTVMKKFTTELIRSFKVSEDLVRVGLAQFSSKFQNEFYLNQFYAEQAISQHILDMRQLGGGTKIGLALDSIREYFEASRGCRRSAGISQNLVLITDGESQ--DDVEDAADRLRAMGIEVFAIGIGDIHDLELLQITGTPERLFTVENFGSLERIKQKVVKTIC 1160          

HSP 3 Score: 97.4413 bits (241), Expect = 1.008e-17
Identity = 90/377 (23.87%), Postives = 180/377 (47.75%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKL---TYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIP---FNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN-DKILTVNSYERLQKNMKTVLKAVTC 1230
            D  F++D S SI  +DF+  K+ I++ +   +      R+    + D   L F+   + +   + + V+ +R   G T  G+AL+     ++  +         Y+++ TDG +++   AP   A+ L+   V + ++G+  + + KEL  ++  P     V +F  L      II  +C        + CK    D++ L+DSS SI   D++  K F+  +I K  IG     VG++ FS   ++EF L+    + ++   I +++++G  T  G A+  V  +++   R G P     ++++TDG   +   RP   A+ L+ +G  + ++G+    N  +L +IS + D++     ++ L K++++ +    C
Sbjct:  424 DIFFLIDHSGSIHPTDFQDMKKFIIEFLHTFRIGPQHIRMGVTKYADSPNLEFDLTTYSDAKSLEKAVEEIRQIGGGTETGRALEFMGPCFDRAMASRGHKVPEYLVVITDGKSSDEVKAP---AEKLRSQGVIVYSIGV-KQADMKELREISGDPKRTFFVNNFDALKPIKDDIITDIC------SQDACKDIPGDVLFLIDSSTSIESQDYDKMKDFMKSVIRKSFIGRNEVHVGVMQFSTVQKLEFPLNRFYSKEEMSRAIDNMQQIGGGTHTGEAITFVS-QYFDASRGGRPDLRQRLVVITDGEAQDEVKRP---AAALRAKGVLVYAIGV-VDANTTQLLEISGSLDRMYDERDFDAL-KDLESQVALELC 784          

HSP 4 Score: 61.2326 bits (147), Expect = 3.691e-6
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSAT----GLGLALREVQFKFWPHRRHG--IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI 1110
            D+V ++D S SI   +FE  ++F+  L++ F +GP   R+GLV +S  PR EF L+   ++  +L  I  L  LG  T    GL   LR   F      R G  +P   +++TDG +      +  A +L+R G  + ++GI
Sbjct:   27 DIVFMVDGSWSIGAENFEQIRQFLYTLVNSFDVGPDHVRIGLVQYSTDPRTEFLLNTFQNKEDILNFISRLPYLGGGTNTGKGLDFMLRN-HFVEAAGSRAGQKVPQIAVVITDGKSQDTVEFN--AEELRRRGIVLYAIGI 165          
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Match: A0A4W3GCD4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.985e-31
Identity = 109/394 (27.66%), Postives = 193/394 (48.98%), Query Frame = 1
Query:   88 WKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK-----LTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF----WPHRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAV 1224
            W++Y A +       D VF++D S SI   DFE  KR +V ++          R   +V+G    + F  +++K  +D+   +  ++ + G+T    ALK     LT E   P+  + AQ ++I+ TDG   +    P    D ++D  + I  VG+ +E N++EL  +  P        + + FE L  I   +  ++    N  CK++Q D+V L+D S+SI   DF   K F+  +++ F+I P   ++GL  FS   R EF L    +R  ++ +I+ + ++   + +G AL  V   F       +  G+P  +L++TDG +N   V P     A+ L+ E  NI +LGIG+  ++ +L  I+ S D    V + + ++K    +++ +
Sbjct:  793 WEIYCARTDVG----DIVFVIDGSGSIQQRDFESMKRFMVALVNNSDVAPDKVRFGAVVYGTTPVVQFQLNQYKTKSDVREAIYGMQREGGSTFTALALKEAKGLLTTEEGGPRSDRVAQ-FLIVITDGKATDSVNVPDTSKD-IRDEGINIFAVGV-AEANEEELQTIVGPTGNYF---YVQNFETLKSITGDISKVICANTNPECKLQQADIVFLVDGSESIEAEDFRQMKAFMKKIVNAFEIAPNKVQIGLAQFSTLFRKEFFLKDFSERTSLIAEIEGIVQMNQGSNIGFALTNVNSLFTREAGSRKADGVPQFLLLITDGRSNDEVVAP-----ANALRDENINIFALGIGKA-DINQLLQITASQDTKYFVETSKNIEKITPRIVRKI 1170          

HSP 2 Score: 96.2857 bits (238), Expect = 2.534e-17
Identity = 97/392 (24.74%), Postives = 170/392 (43.37%), Query Frame = 1
Query:  100 EATSSCSWFKQDTV---FILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSATGLGLALREVQFKFWPH----RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKEL-TDISSNDKILTVNSYERLQKNMKTVLKAVTCG*T 1239
            E  S C   K DTV   F++D S SI+  DF   K  +  ++          ++  I FG      F  +      D+ + + N++   G T  G+AL  T  Y +     R +  +Y+I+ TDG   +   AP   A  L+D  + +  +G+ +  N + L    SP+    V +F  L +   +I   +            + +  D+V ++D S SI   DFE  KRF+  L++   + P   R G V +   P ++F L+    ++ V E I  +++ G +T   LAL+E +          R   +   ++++TDG         + +  ++ EG NI ++G+    N +EL T +        V ++E L K++   +  V C  T
Sbjct:  608 EGKSLCVDLKLDTVDIIFLIDGSGSINVEDFAKMKMFMNSIVNKTSIGADKVQVGAIQFGSYPRPEFQLNTHSTKPDLQQAIYNIQQLGGGTQTGRALTFTADYFDGARGGRPNIAQYLIVITDGEAQDEVLAP---AKALRDKGITVFAIGVFNANNTQLLEIGGSPDKVHYVENFDDLDDPEKQIFWEIYC---------ARTDVGDIVFVIDGSGSIQQRDFESMKRFMVALVNNSDVAPDKVRFGAVVYGTTPVVQFQLNQYKTKSDVREAIYGMQREGGSTFTALALKEAKGLLTTEEGGPRSDRVAQFLIVITDGKATDSVNVPDTSKDIRDEGINIFAVGVA-EANEEELQTIVGPTGNYFYVQNFETL-KSITGDISKVICANT 985          

HSP 3 Score: 75.0998 bits (183), Expect = 1.365e-10
Identity = 81/351 (23.08%), Postives = 159/351 (45.30%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMA--------ITVADFQKLFEN--LMKIIHHVCVIVD--PIPNEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLE-KIKHLRKLGSATGLGLALREVQFKFWPH---RRHGIPFNILILTDGYNNVFPRPHEI-ASKLKREGANIISLGIG 1113
            D VF++D S SI + +F+L +  +   +  ++ +     I    + +     F  ++++N +D++  ++++    G      AL    +         + R    + +I+ T G +         A  L+ + V +  +GI    N+ EL ++AS P+ +        I ++  ++ F+     +I     V+ +   I  + C + E+ D+  L+D S SI   +F+  K F+  +   F+IG    R+G+V F   P+ EFD+     N  LE  +  + ++G  T  G AL  ++  F      R +G+   ++I+TDG +       EI A +L++EG    ++G G
Sbjct:  223 DIVFLVDESGSIGTVNFQLIRSFLYNFIDILEVSPDYVHIGLAQYSNSPVAEFYLNRYQNKSDVLDHIQSMTYRGGGRNTETALNFVRQTYFTDRSGSRARIGIPQLLIVITSGESEDKMGKA--AATLRRSGVIMFALGI-QNANETELRHIASYPSRSYISKIDDYIQLSAIERNFQKKVCSEIGKQTAVVSERTAILEQGCIETEEADIFFLIDGSGSIQPDNFQDMKMFMKEVAKTFRIGANKVRIGVVQFGSAPQTEFDMTQYSTNTELEMAMNQIVQIGGGTETGRALTYMKTLFSEAAKTRSYGVRRFLIIITDGQSE---DSVEIPAEELRQEGIVNYAIGAG 567          
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Match: A0A3Q1FMU4 (Collagen type VI alpha 6 chain OS=Acanthochromis polyacanthus OX=80966 GN=COL6A6 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.091e-31
Identity = 115/408 (28.19%), Postives = 209/408 (51.23%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSS--CSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ---MRKDA--QRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS--PNMAI----TVADFQKLFENLMKIIHHVCVIVDPIP--------NEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKF---WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQ 1194
            ++P +  +V   V  AT S  C   K  D VFI+D S SI  ++F+L +  +  +++ ++      R+  +++ D  T     + F N +++++ +K +    G T  G ALK   E++  +    RKD   Q+  ++ TDG + +    P   A  L+ A V I +VG+  + NK +L+ +AS  PN  +    T A  + + ++L KI+ +  +I   +          E C + ++ D+  L+D S SI   DF+  K+F+   +  F+IGP+  R+G+  ++D P +EFDL      K LEK ++ +R++G  T  G AL  +   F      R H +P  ++++TDG ++        A KL+ +G  + S+G+ +  ++KEL +IS + K    VN+++ L+
Sbjct:  394 AVPTLRSIVETAVENATLSGDCKAAKFADIVFIVDESGSIGVANFQLVRAFLHSIVSRLEINQTRVRVGIVMYNDRPTAQVYLNTFNNKDELLKFIKILPYHGGGTNTGAALKFALESVFIKEQGSRKDKGIQQVAVVITDGESQDNVSQP---ATDLRRAGVTIYSVGV-KDANKVQLVEMASHPPNKHVFIVDTFAKLKSMEQSLQKILCY-NIIRQAVSVNTRRTGIKEGCVQTDEADIFFLIDHSGSIHPTDFQDMKKFIIEFLHTFRIGPQHIRMGVTKYADSPNLEFDLTTYSDAKSLEKAVEEIRQIGGGTETGRALEFMGPCFDRAMASRGHKVPEYLVVITDGKSS--DEVKAPAEKLRSQGVIVYSIGV-KQADMKELREISGDPKRTFFVNNFDALK 793          

HSP 2 Score: 122.865 bits (307), Expect = 3.518e-26
Identity = 96/384 (25.00%), Postives = 186/384 (48.44%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDGT---NNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPNMAITVADFQKLFENLMKIIHHV-CVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWP----HRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK-NMKTVLKAVTCG 1233
            K D +F++D S SI+   F   ++ +  M+          R   I++ +D   IF  +++ +  ++++ +  +++  G T  GKAL  + +    Q    A     + +++ TDG     N   AP +    L+++ V + ++G+ G+ + + +++     +    V +F+ L E L K I  V C    P+    C+ ++ DLV L+D S SI+  D+ + K+F   LI  F++     RVGL  FS   + EF L        + + I  +R+LG  T +GLAL  ++  F       R  GI  N++++TDG +       + A +L+  G  + ++GIG   +L+ L    + +++ TV ++  L++ N++    ++  G
Sbjct:  997 KADIIFLVDGSTSITLQKFRNMQKFMESMVNQTTVGKDLTRFGVILYSNDPKSIFTLNQYSSKKEVLKAISGLKSPYGDTYTGKALGYSLQFFDAQHGGRAALQVPQILMVITDGDATDRNSLVAPSV---ALRNSGVSVFSIGVEGANMTQLQIMAGYDTSKVFYVDNFEAL-ETLYKNITQVLCKTTKPV----CQKQKADLVFLIDQSGSINSTDYTVMKKFTTELIRSFKVSEDLVRVGLAQFSSKFQNEFYLNQFYAEQAISQHILDMRQLGGGTKIGLALDSIREYFEASRGCRRSAGISQNLVLITDGESQ--DDVEDAADRLRAMGIEVFAIGIGDIHDLELLQITGTPERLFTVENFGSLERINLQYYTASIPAG 1370          

HSP 3 Score: 97.4413 bits (241), Expect = 1.016e-17
Identity = 86/351 (24.50%), Postives = 167/351 (47.58%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKL---TYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIP---FNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D  F++D S SI  +DF+  K+ I++ +   +      R+    + D   L F+   + +   + + V+ +R   G T  G+AL+     ++  +         Y+++ TDG +++   AP   A+ L+   V + ++G+  + + KEL  ++  P     V +F  L      II  +C        + CK    D++ L+DSS SI   D++  K F+  +I K  IG     VG++ FS   ++EF L+    + ++   I +++++G  T  G A+  V  +++   R G P     ++++TDG   +   RP   A+ L+ +G  + ++G+    N  +L +IS +
Sbjct:  629 DIFFLIDHSGSIHPTDFQDMKKFIIEFLHTFRIGPQHIRMGVTKYADSPNLEFDLTTYSDAKSLEKAVEEIRQIGGGTETGRALEFMGPCFDRAMASRGHKVPEYLVVITDGKSSDEVKAP---AEKLRSQGVIVYSIGV-KQADMKELREISGDPKRTFFVNNFDALKPIKDDIITDIC------SQDACKDIPGDVLFLIDSSTSIESQDYDKMKDFMKSVIRKSFIGRNEVHVGVMQFSTVQKLEFPLNRFYSKEEMSRAIDNMQQIGGGTHTGEAITFVS-QYFDASRGGRPDLRQRLVVITDGEAQDEVKRP---AAALRAKGVLVYAIGV-VDANTTQLLEISGS 964          

HSP 4 Score: 86.6557 bits (213), Expect = 2.824e-14
Identity = 90/391 (23.02%), Postives = 186/391 (47.57%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVR----NDNGATAIGKALKLTYENLVPQM---RKDA--QRYVILFT--DGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALR----EVQFKFWPHRR-HGIPFNILILTDG--YNNVFPRPHEIASKLKREGANIISLGI--GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            D  F++D+   IS SDF+  + ++V++   +    + + +    +G D  + F  + F++ +++   VK  R      N    +G AL+    N        R D   ++Y+++ +  D  + V+    +    +K   V ++ + +G+ +N+  LI+ A    P+++  V   + + E  ++         +   +  CK  +  D+V ++D S SI   +F++ + F+  ++S+ +I     RVG+V ++D P  +  L+   +++++L+ IK L   G  T  G AL+     V  K    R+  GI    +++TDG   +NV     + A+ L+R G  I S+G+     + L E+     N  +  V+++ +L K+M+  L+ + C
Sbjct:  231 DIFFLVDSG--ISQSDFQQIRSILVRLTNQLNFGASAHHLGLAQYGQDTRVEFLLNAFQSKDEIQGAVKRFRQRRLQTNEPRNLGAALQYASANFFTSAAGSRADQGYRQYLVVLSGKDSDDEVYKQSRL----IKAEGVTVVGMSLGASMNEIRLISTAPYSYPSISNAVPTLRSIVETAVE---------NATLSGDCKAAKFADIVFIVDESGSIGVANFQLVRAFLHSIVSRLEINQTRVRVGIVMYNDRPTAQVYLNTFNNKDELLKFIKILPYHGGGTNTGAALKFALESVFIKEQGSRKDKGIQQVAVVITDGESQDNV----SQPATDLRRAGVTIYSVGVKDANKVQLVEMASHPPNKHVFIVDTFAKL-KSMEQSLQKILC 601          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Match: si:ch211-62a1.3 (si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-41])

HSP 1 Score: 109.768 bits (273), Expect = 3.137e-25
Identity = 102/404 (25.25%), Postives = 189/404 (46.78%), Query Frame = 1
Query:   85 SWKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD-----AQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDP--IP-------NEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHL--RKLGSATGLGLALREVQFKFWPH-RRHGIPFNILILTDGYNNVFPRPHEI-ASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVT 1227
            S + ++ T  C   +  D VFI+D S ++   +F+L +  +   ++ +       R++ + + D+       + F N +++++ VK +    G    G+ALK   + +  + R        Q+  ++ TDG +++   AP   A  L+ + V +  VGI S  N KE+ +        +V +F KL      +   +C  +    IP        + CK   + D+  L+D S SI+  DF+  K F+   +  FQIGP   R+G+V F+D   I F L+  D    +EK +K L     G+ T LGL      FK     R+  +   ++++TDG +     P ++ A +L+++   I ++G+ ++ +  EL D+S + K    V +Y+ L+     +LK + 
Sbjct:  600 SPEGHKVTEDCRLAEVADVVFIVDKSGNMGPENFQLVRNFLQNTISGLDVGTDKVRVAIVDYSDEPRADVYLNTFSNKSEILQHVKKLSYGRGKANTGEALKYAKDYVFTKERGSRSDEYVQQIAVVVTDGKSSDDVSAP---AADLRRSGVTVFAVGIKSFDNLKEMASYPQDKFVFSVGNFTKLNALSGVVTKRICRDISSVFIPLLKNITIQKGCKFTAEADIYFLLDESGSITYDDFDDMKAFILEFLHMFQIGPDQVRIGVVKFADRATIVFRLNTYDSKSAVEKAVKDLFMEGGGTRTDLGLYAMIPLFKQAEQTRKEKVRELLIVITDGKSEPVGTPVKVPAEELRKQNVTIYAVGV-KNADTAELEDMSGSPKRTFYVQNYDALKLIKTKILKEIC 999          

HSP 2 Score: 96.6709 bits (239), Expect = 5.690e-21
Identity = 85/383 (22.19%), Postives = 169/383 (44.13%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINK--KELINLASPNMAITVADFQKLFENLMKIIHHVCVIVD--------PIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREG--ANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D VF++D S SI  ++F+  +  +  ++T         RI  + + D     F+ + +++  +++  +K +    G T  G+ LK        E    + +K   +  ++ TDG +     PY  A+ L++  ++I  +GI     K  KE+          +V+DF+ L   ++ +   +C  V+        P  NE       D+V+L+DSS +I    F   + F+   I    +     ++GL  +SD P  EF L    D+  +L K+  +R        G AL  ++  F+   R  +P   +++TDG ++      E A KL+ +G    ++  G    + L+ + +    + + + +S ++LQ+  + + + V 
Sbjct:   34 DIVFLVDGSASIGLTNFQQIREFLSSLVTHFDIAPNKVRIGLVQYSDTPRTEFSLNTYEDKQEILDFIKVLPYKTGGTNTGEGLKFLLQHHFVEAAGSRAKKGVPQIAVVITDGNSQDEVEPY--AEELREKGIKIYAIGIKDADEKLLKEIATQPYDQHLFSVSDFEALQGIMLNVTQEICTTVEREGEINSVPECNE---FAAADIVLLVDSSDNIGENYFREIQSFLRVFIQDLDVNVGKVKIGLAQYSDRPYPEFLLGEYTDKADLLRKLGSIRYRRGRANTGAALDFIREGFFSQARKNVPHIAVLITDGVSS--DAVEEPAQKLRMQGVITFVVKTGEANILQLRAIANSPQQEFLFSGDSNQKLQELAENLRRKVC 409          

HSP 3 Score: 92.0485 bits (227), Expect = 2.061e-19
Identity = 96/380 (25.26%), Postives = 172/380 (45.26%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK--LTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYAD---HLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMK-IIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKFWPHRRHG------IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKT--VLKAVT 1227
            D +F++D + +I+   F+  K  +  ++T  +      R   +++ D A  +F  +++ N ++++  +  +R   G     +ALK  L Y +     R+      +LF   T       +  AD   +L  + V +  VG+     + EL  +A  N      D     E L K I   +C +  P+    C+ E  DLV+L+D S+S+S  D+   K  + +L+ K +I     RV +  F D     F L+  +    +E+ I+ L +   +T    ALR +Q  F P   HG      +  N+L++TDG          +AS L+ +   I ++GIG++IN   L  I+ + + + + S+E L     T  VL+A+ 
Sbjct: 1195 DIIFLVDGAGAINKETFQDIKIFMETVVTKTEVGEKRVRFGLVIYADRAQSVFTLNQYYNKSEVLEAISKLRTIGGRRNTAQALKSTLPYFSAAYGGRRAQHVPQVLFLI-TEGPVADSFSLADWPANLAASEVNMFAVGVAG-AREAELRRIAGNNQRAFYVDTYSQLETLCKPITQQLCNLTKPV----CEKEVADLVILIDGSESVSALDWGTLKSSLINLVRKLEIAQDRWRVSVAQFGDAAPDRFYLNKYNNLAGVEQGIRALSQRRQSTNTWTALRFLQDYFEPE--HGSRMNARVSQNLLLITDGRATDKEDLGVLAS-LRAKNVEIFAVGIGKNINRHALLKIAGSKERVFLESFESLPLKTTTAKVLQAIC 1565          

HSP 4 Score: 90.8929 bits (224), Expect = 5.214e-19
Identity = 94/362 (25.97%), Postives = 173/362 (47.79%), Query Frame = 1
Query:  112 SCSWFKQ-DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA--IGKALKLTYENLVPQMRKDAQR-YVILFTDGTNNVFPAPY-IYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNIL----ILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
             C +  + D  F+LD S SI+  DF+  K  I++ +   +      RI  + F D AT++F  + + + + + + VK++  + G T   +G    +       Q RK+  R  +I+ TDG +     P  + A+ L+  +V I  VG+    +  EL +++ SP     V ++  L     KI+  +C        E C     D+V L+D + ++   DF+  K  +   + K  I     R+ +V +S + ++EF L+   D++++ ++I  +++L   T  G AL EV ++ +   R G P N+L    ++TD  +    V P     A  L+ +  N+ ++G+G H +  EL DIS +
Sbjct:  813 GCKFTAEADIYFLLDESGSITYDDFDDMKAFILEFLHMFQIGPDQVRIGVVKFADRATIVFRLNTYDSKSAVEKAVKDLFMEGGGTRTDLGLYAMIPLFKQAEQTRKEKVRELLIVITDGKSEPVGTPVKVPAEELRKQNVTIYAVGV-KNADTAELEDMSGSPKRTFYVQNYDALKLIKTKILKEICSF------EACNDLLADVVFLIDGADAVDAADFQQAKDLIDFAVEKLPIRENRVRLAVVQYSTNTKVEFALNEFYDKDRIQKQIVAIKQLKGKTYTGRALTEV-WQAFEESRGGRP-NVLRFLVVVTDSSSKDDVVAP-----AMALREKNVNVYAVGMG-HASQSELLDISGS 1159          

HSP 5 Score: 75.0998 bits (183), Expect = 6.272e-14
Identity = 87/389 (22.37%), Postives = 178/389 (45.76%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVR-NDNGATAIGKAL-----KLTYENLVPQMRKDAQRYVILFTDGT---NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKII-HHVCVIVDPIPN----EPCKV-EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATG---LGLALREVQFKFWPHRRHG-----IPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D  F++D++ S   S  +  +  I +++  +      NRI    F ++    F FD  K  N++V  ++N++    G   IG A+     +        ++ +  ++++++ T G+   + V P+       +K   V ++ VG+G   +  EL ++ASP ++       KL    M ++   +  ++D        E C++ E  D+V ++D S ++   +F++ + F+ + IS   +G    RV +V +SD PR   D++L   +   E ++H++KL    G    G AL+  +   +   R       +    +++TDG  ++    P   A+ L+R G  + ++GI    NLKE+     +  + +V ++ +L      V K + 
Sbjct:  425 DIFFLVDSAASRQES--QQIRNFISRLVNQLNVGKNTNRIGLAQFSENVEEEFLFDNDKTKNEIVASIRNLQLKPKGLRRIGNAINHARTRFFTPAAGSRIAEGFKQFLLVATAGSSVDDVVQPS-----RQIKKEPVNLIAVGVGRP-DMDELKDIASPTLSY------KLDSRTMPVLPQQIKAVIDSPEGHKVTEDCRLAEVADVVFIVDKSGNMGPENFQLVRNFLQNTISGLDVGTDKVRVAIVDYSDEPRA--DVYLNTFSNKSEILQHVKKLSYGRGKANTGEALKYAKDYVFTKERGSRSDEYVQQIAVVVTDGKSSDDVSAP---AADLRRSGVTVFAVGIKSFDNLKEMASYPQDKFVFSVGNFTKLNALSGVVTKRIC 794          

HSP 6 Score: 74.3294 bits (181), Expect = 1.056e-13
Identity = 84/390 (21.54%), Postives = 184/390 (47.18%), Query Frame = 1
Query:  112 SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM--RKDAQRYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREV----QFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI--GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG*TK 1242
            +C+    D VF++D + ++ ++DF+ AK +I   +  +       R++ + +  +  + F  ++F + + + +Q+  ++   G T  G+AL   ++        R +  R++++ TD ++    V P     A  L++ +V +  VG+G   ++ EL++++    +   A  +  F +L  +   +  +   I N  CK  E  D++ L+D + +I+   F+  K F+  +++K ++G K  R GLV ++D  +  F L    ++++VLE I  LR +G       AL+         +   R   +P  + ++T+G         +  + L     N+ ++G+   R   L+ +    +N +   V++Y +L+   K + + + C  TK
Sbjct: 1003 ACNDLLADVVFLIDGADAVDAADFQQAKDLIDFAVEKLPIRENRVRLAVVQYSTNTKVEFALNEFYDKDRIQKQIVAIKQLKGKTYTGRALTEVWQAFEESRGGRPNVLRFLVVVTDSSSKDDVVAP-----AMALREKNVNVYAVGMG-HASQSELLDISG---SYETAYLENPFGSLQVLGSELVFM---ICNTECKRPELIDIIFLVDGAGAINKETFQDIKIFMETVVTKTEVGEKRVRFGLVIYADRAQSVFTLNQYYNKSEVLEAISKLRTIGGRRNTAQALKSTLPYFSAAYGGRRAQHVPQVLFLITEGPVADSFSLADWPANLAASEVNMFAVGVAGAREAELRRIA--GNNQRAFYVDTYSQLETLCKPITQQL-CNLTK 1377          

HSP 7 Score: 58.5362 bits (140), Expect = 9.728e-9
Identity = 81/366 (22.13%), Postives = 158/366 (43.17%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ----MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLF--ENLMKIIHHVCV---IVDPIPNEPCKVEQQDLVVLMD-----SSKSISGPDFEIGKRFVAH---LISKFQIGPK---ATRVG--LVSFSDHPRI--EFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGAN-IISLGIGRHINLKEL 1137
            C     D V ++D S+S+S+ D+   K  ++ ++  ++      R+S   FGD A   F  +K+ NL  + + ++ +     +T    AL+   +   P+    M     + ++L TDG         + A  L+  +V I  VGIG  IN+  L+ +A     + +  F+ L       K++  +C    I DP   + C +   D+ +  D     SS+ + GP  E       H   ++      P     T++G  +VS  D  R+  +F+    D N V+ K+  LR   + T     L     +     + G+   +++ TDG+++      E +  L++ G + ++ + +  ++N ++L
Sbjct: 1380 CEKEVADLVILIDGSESVSALDWGTLKSSLINLVRKLEIAQDRWRVSVAQFGDAAPDRFYLNKYNNLAGVEQGIRALSQRRQSTNTWTALRFLQDYFEPEHGSRMNARVSQNLLLITDGRATDKEDLGVLA-SLRAKNVEIFAVGIGKNINRHALLKIAGSKERVFLESFESLPLKTTTAKVLQAICSPDEIRDP---QGCSI---DIGIGFDVSRRTSSQPLLGPHSEPLVAAAIHHLSMMGALCCLPADKIETKIGFRVVSGRDG-RVLDDFNFEKYDEN-VVRKVLELRP-ATPTAFNAFLLNSFMQKLSSSQAGVKV-VILFTDGFDDTLEHLKESSESLRKSGVDALLIVALNGNVNYQQL 1734          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Match: si:ch211-62a1.3 (si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-41])

HSP 1 Score: 109.768 bits (273), Expect = 3.137e-25
Identity = 102/404 (25.25%), Postives = 189/404 (46.78%), Query Frame = 1
Query:   85 SWKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKD-----AQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDP--IP-------NEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHL--RKLGSATGLGLALREVQFKFWPH-RRHGIPFNILILTDGYNNVFPRPHEI-ASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERLQKNMKTVLKAVT 1227
            S + ++ T  C   +  D VFI+D S ++   +F+L +  +   ++ +       R++ + + D+       + F N +++++ VK +    G    G+ALK   + +  + R        Q+  ++ TDG +++   AP   A  L+ + V +  VGI S  N KE+ +        +V +F KL      +   +C  +    IP        + CK   + D+  L+D S SI+  DF+  K F+   +  FQIGP   R+G+V F+D   I F L+  D    +EK +K L     G+ T LGL      FK     R+  +   ++++TDG +     P ++ A +L+++   I ++G+ ++ +  EL D+S + K    V +Y+ L+     +LK + 
Sbjct:  600 SPEGHKVTEDCRLAEVADVVFIVDKSGNMGPENFQLVRNFLQNTISGLDVGTDKVRVAIVDYSDEPRADVYLNTFSNKSEILQHVKKLSYGRGKANTGEALKYAKDYVFTKERGSRSDEYVQQIAVVVTDGKSSDDVSAP---AADLRRSGVTVFAVGIKSFDNLKEMASYPQDKFVFSVGNFTKLNALSGVVTKRICRDISSVFIPLLKNITIQKGCKFTAEADIYFLLDESGSITYDDFDDMKAFILEFLHMFQIGPDQVRIGVVKFADRATIVFRLNTYDSKSAVEKAVKDLFMEGGGTRTDLGLYAMIPLFKQAEQTRKEKVRELLIVITDGKSEPVGTPVKVPAEELRKQNVTIYAVGV-KNADTAELEDMSGSPKRTFYVQNYDALKLIKTKILKEIC 999          

HSP 2 Score: 96.6709 bits (239), Expect = 5.690e-21
Identity = 85/383 (22.19%), Postives = 169/383 (44.13%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINK--KELINLASPNMAITVADFQKLFENLMKIIHHVCVIVD--------PIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREG--ANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D VF++D S SI  ++F+  +  +  ++T         RI  + + D     F+ + +++  +++  +K +    G T  G+ LK        E    + +K   +  ++ TDG +     PY  A+ L++  ++I  +GI     K  KE+          +V+DF+ L   ++ +   +C  V+        P  NE       D+V+L+DSS +I    F   + F+   I    +     ++GL  +SD P  EF L    D+  +L K+  +R        G AL  ++  F+   R  +P   +++TDG ++      E A KL+ +G    ++  G    + L+ + +    + + + +S ++LQ+  + + + V 
Sbjct:   34 DIVFLVDGSASIGLTNFQQIREFLSSLVTHFDIAPNKVRIGLVQYSDTPRTEFSLNTYEDKQEILDFIKVLPYKTGGTNTGEGLKFLLQHHFVEAAGSRAKKGVPQIAVVITDGNSQDEVEPY--AEELREKGIKIYAIGIKDADEKLLKEIATQPYDQHLFSVSDFEALQGIMLNVTQEICTTVEREGEINSVPECNE---FAAADIVLLVDSSDNIGENYFREIQSFLRVFIQDLDVNVGKVKIGLAQYSDRPYPEFLLGEYTDKADLLRKLGSIRYRRGRANTGAALDFIREGFFSQARKNVPHIAVLITDGVSS--DAVEEPAQKLRMQGVITFVVKTGEANILQLRAIANSPQQEFLFSGDSNQKLQELAENLRRKVC 409          

HSP 3 Score: 92.0485 bits (227), Expect = 2.061e-19
Identity = 96/380 (25.26%), Postives = 172/380 (45.26%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK--LTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYAD---HLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMK-IIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKFWPHRRHG------IPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKT--VLKAVT 1227
            D +F++D + +I+   F+  K  +  ++T  +      R   +++ D A  +F  +++ N ++++  +  +R   G     +ALK  L Y +     R+      +LF   T       +  AD   +L  + V +  VG+     + EL  +A  N      D     E L K I   +C +  P+    C+ E  DLV+L+D S+S+S  D+   K  + +L+ K +I     RV +  F D     F L+  +    +E+ I+ L +   +T    ALR +Q  F P   HG      +  N+L++TDG          +AS L+ +   I ++GIG++IN   L  I+ + + + + S+E L     T  VL+A+ 
Sbjct: 1195 DIIFLVDGAGAINKETFQDIKIFMETVVTKTEVGEKRVRFGLVIYADRAQSVFTLNQYYNKSEVLEAISKLRTIGGRRNTAQALKSTLPYFSAAYGGRRAQHVPQVLFLI-TEGPVADSFSLADWPANLAASEVNMFAVGVAG-AREAELRRIAGNNQRAFYVDTYSQLETLCKPITQQLCNLTKPV----CEKEVADLVILIDGSESVSALDWGTLKSSLINLVRKLEIAQDRWRVSVAQFGDAAPDRFYLNKYNNLAGVEQGIRALSQRRQSTNTWTALRFLQDYFEPE--HGSRMNARVSQNLLLITDGRATDKEDLGVLAS-LRAKNVEIFAVGIGKNINRHALLKIAGSKERVFLESFESLPLKTTTAKVLQAIC 1565          

HSP 4 Score: 90.8929 bits (224), Expect = 5.214e-19
Identity = 94/362 (25.97%), Postives = 173/362 (47.79%), Query Frame = 1
Query:  112 SCSWFKQ-DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA--IGKALKLTYENLVPQMRKDAQR-YVILFTDGTNNVFPAPY-IYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNIL----ILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
             C +  + D  F+LD S SI+  DF+  K  I++ +   +      RI  + F D AT++F  + + + + + + VK++  + G T   +G    +       Q RK+  R  +I+ TDG +     P  + A+ L+  +V I  VG+    +  EL +++ SP     V ++  L     KI+  +C        E C     D+V L+D + ++   DF+  K  +   + K  I     R+ +V +S + ++EF L+   D++++ ++I  +++L   T  G AL EV ++ +   R G P N+L    ++TD  +    V P     A  L+ +  N+ ++G+G H +  EL DIS +
Sbjct:  813 GCKFTAEADIYFLLDESGSITYDDFDDMKAFILEFLHMFQIGPDQVRIGVVKFADRATIVFRLNTYDSKSAVEKAVKDLFMEGGGTRTDLGLYAMIPLFKQAEQTRKEKVRELLIVITDGKSEPVGTPVKVPAEELRKQNVTIYAVGV-KNADTAELEDMSGSPKRTFYVQNYDALKLIKTKILKEICSF------EACNDLLADVVFLIDGADAVDAADFQQAKDLIDFAVEKLPIRENRVRLAVVQYSTNTKVEFALNEFYDKDRIQKQIVAIKQLKGKTYTGRALTEV-WQAFEESRGGRP-NVLRFLVVVTDSSSKDDVVAP-----AMALREKNVNVYAVGMG-HASQSELLDISGS 1159          

HSP 5 Score: 75.0998 bits (183), Expect = 6.272e-14
Identity = 87/389 (22.37%), Postives = 178/389 (45.76%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVR-NDNGATAIGKAL-----KLTYENLVPQMRKDAQRYVILFTDGT---NNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKII-HHVCVIVDPIPN----EPCKV-EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATG---LGLALREVQFKFWPHRRHG-----IPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D  F++D++ S   S  +  +  I +++  +      NRI    F ++    F FD  K  N++V  ++N++    G   IG A+     +        ++ +  ++++++ T G+   + V P+       +K   V ++ VG+G   +  EL ++ASP ++       KL    M ++   +  ++D        E C++ E  D+V ++D S ++   +F++ + F+ + IS   +G    RV +V +SD PR   D++L   +   E ++H++KL    G    G AL+  +   +   R       +    +++TDG  ++    P   A+ L+R G  + ++GI    NLKE+     +  + +V ++ +L      V K + 
Sbjct:  425 DIFFLVDSAASRQES--QQIRNFISRLVNQLNVGKNTNRIGLAQFSENVEEEFLFDNDKTKNEIVASIRNLQLKPKGLRRIGNAINHARTRFFTPAAGSRIAEGFKQFLLVATAGSSVDDVVQPS-----RQIKKEPVNLIAVGVGRP-DMDELKDIASPTLSY------KLDSRTMPVLPQQIKAVIDSPEGHKVTEDCRLAEVADVVFIVDKSGNMGPENFQLVRNFLQNTISGLDVGTDKVRVAIVDYSDEPRA--DVYLNTFSNKSEILQHVKKLSYGRGKANTGEALKYAKDYVFTKERGSRSDEYVQQIAVVVTDGKSSDDVSAP---AADLRRSGVTVFAVGIKSFDNLKEMASYPQDKFVFSVGNFTKLNALSGVVTKRIC 794          

HSP 6 Score: 74.3294 bits (181), Expect = 1.056e-13
Identity = 84/390 (21.54%), Postives = 184/390 (47.18%), Query Frame = 1
Query:  112 SCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM--RKDAQRYVILFTDGTNN---VFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCK-VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREV----QFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI--GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG*TK 1242
            +C+    D VF++D + ++ ++DF+ AK +I   +  +       R++ + +  +  + F  ++F + + + +Q+  ++   G T  G+AL   ++        R +  R++++ TD ++    V P     A  L++ +V +  VG+G   ++ EL++++    +   A  +  F +L  +   +  +   I N  CK  E  D++ L+D + +I+   F+  K F+  +++K ++G K  R GLV ++D  +  F L    ++++VLE I  LR +G       AL+         +   R   +P  + ++T+G         +  + L     N+ ++G+   R   L+ +    +N +   V++Y +L+   K + + + C  TK
Sbjct: 1003 ACNDLLADVVFLIDGADAVDAADFQQAKDLIDFAVEKLPIRENRVRLAVVQYSTNTKVEFALNEFYDKDRIQKQIVAIKQLKGKTYTGRALTEVWQAFEESRGGRPNVLRFLVVVTDSSSKDDVVAP-----AMALREKNVNVYAVGMG-HASQSELLDISG---SYETAYLENPFGSLQVLGSELVFM---ICNTECKRPELIDIIFLVDGAGAINKETFQDIKIFMETVVTKTEVGEKRVRFGLVIYADRAQSVFTLNQYYNKSEVLEAISKLRTIGGRRNTAQALKSTLPYFSAAYGGRRAQHVPQVLFLITEGPVADSFSLADWPANLAASEVNMFAVGVAGAREAELRRIA--GNNQRAFYVDTYSQLETLCKPITQQL-CNLTK 1377          

HSP 7 Score: 58.5362 bits (140), Expect = 9.728e-9
Identity = 81/366 (22.13%), Postives = 158/366 (43.17%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ----MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLF--ENLMKIIHHVCV---IVDPIPNEPCKVEQQDLVVLMD-----SSKSISGPDFEIGKRFVAH---LISKFQIGPK---ATRVG--LVSFSDHPRI--EFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGAN-IISLGIGRHINLKEL 1137
            C     D V ++D S+S+S+ D+   K  ++ ++  ++      R+S   FGD A   F  +K+ NL  + + ++ +     +T    AL+   +   P+    M     + ++L TDG         + A  L+  +V I  VGIG  IN+  L+ +A     + +  F+ L       K++  +C    I DP   + C +   D+ +  D     SS+ + GP  E       H   ++      P     T++G  +VS  D  R+  +F+    D N V+ K+  LR   + T     L     +     + G+   +++ TDG+++      E +  L++ G + ++ + +  ++N ++L
Sbjct: 1380 CEKEVADLVILIDGSESVSALDWGTLKSSLINLVRKLEIAQDRWRVSVAQFGDAAPDRFYLNKYNNLAGVEQGIRALSQRRQSTNTWTALRFLQDYFEPEHGSRMNARVSQNLLLITDGRATDKEDLGVLA-SLRAKNVEIFAVGIGKNINRHALLKIAGSKERVFLESFESLPLKTTTAKVLQAICSPDEIRDP---QGCSI---DIGIGFDVSRRTSSQPLLGPHSEPLVAAAIHHLSMMGALCCLPADKIETKIGFRVVSGRDG-RVLDDFNFEKYDEN-VVRKVLELRP-ATPTAFNAFLLNSFMQKLSSSQAGVKV-VILFTDGFDDTLEHLKESSESLRKSGVDALLIVALNGNVNYQQL 1734          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Match: col6a4a (collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-041111-303])

HSP 1 Score: 104.76 bits (260), Expect = 1.324e-23
Identity = 96/377 (25.46%), Postives = 178/377 (47.21%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYE-----NLVPQMRKDAQRYVILFTDGTNNVFPAPYIY-ADHLKDASVRILTVGIGSEINKKELINLAS--PNMAI-TVADFQKL--FENLMK------IIHHVCVIVDP--IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRR---HGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQ 1194
            D VFI+DAS +IS S+F L +  + +++  +   +   RI  +++G++    F    F N  D+++ ++ +    G     KALK   E      L  +  +   +   + T+G +   P      A  L+ + VR+  +GI  + N  +L+ +AS  P   +  V  F KL   E  ++      ++      ++   I     + E+ D+  L+D S SI  PDF+  K+F+  ++  F IGPK  RVG+V F   P +EF +    DR  +   + ++ ++G  T  G AL  ++  F   R+     +   ++++TDG +       + A+ LK +G +I ++G+ +    + L   SS  K+  V +Y+ L+
Sbjct:  635 DIVFIVDASDAISDSNFNLVRDFLHRLIKGLDVGSDSMRIGMVLYGNEPKAEFYLKTFDNKPDILQYIQILPYKGGKANTSKALKFAREKVFSKELGSRRARGVLQIAFVITEGES---PDDVTSEASKLRRSGVRVYALGIQHK-NVTQLMQIASYPPRKYVYNVDSFAKLTIMEQFLRKTLCNNVMRRTVAKINQFNIKQGCVQTEEADIYFLIDHSGSIDPPDFQDMKKFILEVLLHFNIGPKQVRVGVVKFESTPTLEFTVTQYGDRASIEGAVSNIVQIGGGTETGRALTFMRPYFIEARKTRDTRVREILIVITDGEST--DEVKQPAAALKSQGVSIYAVGVKQANKTQLLEMASSPSKMFFVENYDSLK 1005          

HSP 2 Score: 103.219 bits (256), Expect = 4.841e-23
Identity = 96/352 (27.27%), Postives = 160/352 (45.45%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRY---VILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIP-FNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK 1161
            D  F++D S SI   DF+  K+ I++++          R+  + F    TL F   ++ +   +   V N+    G T  G+AL       +   +    R    +I+ TDG + +    P   A  LK   V I  VG+  + NK +L+ +AS P+    V ++  L     +I+  +C        + CK    D++ L+D S SI    F   K+FV + +S+ +IG  + +VGL+ F  +PR EF L+   D+ +++  +       +   +G AL E+   F P +  R   P F ILI      +    P   A  L+ +G  I S+GIG   +L +L +IS + K
Sbjct:  841 DIYFLIDHSGSIDPPDFQDMKKFILEVLLHFNIGPKQVRVGVVKFESTPTLEFTVTQYGDRASIEGAVSNIVQIGGGTETGRALTFMRPYFIEARKTRDTRVREILIVITDGESTDEVKQP---AAALKSQGVSIYAVGV-KQANKTQLLEMASSPSKMFFVENYDSLKPLKDEIVTDIC------SEDACKQMMADIIFLVDGSWSIGAEGFSKIKKFVNNTVSRLKIGKDSVQVGLMQFGTNPRTEFQLNSYYDKVQMMRAVSQTVHAETNPEIGKALNELPKFFGPTKGGRQNAPKFLILITGAESKDDVNAP---AKALRDKGVTIYSIGIGEAKSL-QLRNISGSPK 1178          

HSP 3 Score: 89.7373 bits (221), Expect = 9.547e-19
Identity = 91/364 (25.00%), Postives = 167/364 (45.88%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNV--RNDNGATAIGKALKLTY---ENLVPQMRKDAQRYVILFTDGT--NNVFPAPYIYADHLKDASVRILTVGI-GSEINK-KELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDP--------IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWP-----HRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            D VF++D S SI + +F+  +  +  ++          RI  + +       F  + + +  +++  + N+  R     T +G    L Y   E    + +K   +  ++ TDG   +NV P    YA  LK   + +  +GI  +++++ KE+ +        +V+DF  L       I  +C  V+         +P+  C+    D+V L+D S SI   DF   KRF+   I   +I   + RV +V FS++P  +  L    D+N++LEK+  L     +T  G AL  ++ +++        R  +P   +++TDG   +    P   A +L+REG  I ++G+G  +N+ EL  I++
Sbjct:   34 DIVFLVDGSWSIGTENFQRMREFLFTLVDSFDVGLEKVRIGLVQYSTTVHTEFLLNGYNSKQEILDYISNLPYRGGGTKTGLGLDFLLRYHFKEEAGSRAKKGTPQIAVVITDGQSQDNVEP----YAQELKQKGIILYAIGIKDADMDQLKEIASQPHDQHIYSVSDFTALQGISQSFITVLCSTVEEEAKRQVTQVPD--CRANLADIVFLVDGSSSIGDADFLRMKRFLHAFIQGLEISADSIRVAVVQFSNNPHEDIPLGDYADKNELLEKVDRLVYHRGSTETGKALNFIKDRYFTQAGRIQARANVPRIAVVITDGDSTDDMKTP---AQELRREGVLIFTIGVG-EVNMAELQSIAN 387          

HSP 4 Score: 87.8113 bits (216), Expect = 4.523e-18
Identity = 97/389 (24.94%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISF--IVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT-----------YENLVPQMRKDAQRYVILFTDGTNNV-FPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKL---FENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQ--FKFWPHRR--HGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVT 1227
            D VF++D S SI+  DF+  K  I   +    T   +N + F  IV+ +   + FN  K     ++   +  ++   G T    AL+ +            E+ VPQ+      +VI   + T++   P+P   A  L    + +  +G+G E  + EL+ +AS P     V +++ L    +N+ K++   C    P     C     DLV+L+D S+SI    +     F+   +   ++     R+G+  FS   + EF L+  ++   + + IK ++++   T +G AL +V   F+     R   GI  N+L++TDG +N     +    +L+    N+  +GIG  I++K++  I+ S D++  ++S++ L+ N  T+L+ ++
Sbjct: 1214 DVVFLVDGSTSIAEEDFDKMK--IFMNLVVNNTEVGENYVRFCTIVYSNTPEVKFNLKKHYTKREVNNAISELKAPTGDTYTASALQYSIRFFSKAEGGRAEDGVPQLM-----FVITDGEATDHWDLPSP---AGKLHALGINVFGIGVG-EAKEDELMTIASDPKNVFKVDNYEALKALHQNISKVL---CNNSKP----ECSKVAADLVILIDGSESIEDAPWNTMINFMMRFVDSLRVREDLFRIGVAQFSTVYKKEFYLNEHMEPAAIKKAIKDIKQMKDGTNIGNALYQVDEFFQSAAGSRINSGISQNLLLITDGKSN--DNIYNATDRLRARNINMFVIGIG-QISMKQIEYIAGSQDRVFVLDSFDALKLNT-TILEVIS 1580          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Match: col6a4a (collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-041111-303])

HSP 1 Score: 104.76 bits (260), Expect = 1.495e-23
Identity = 96/377 (25.46%), Postives = 178/377 (47.21%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYE-----NLVPQMRKDAQRYVILFTDGTNNVFPAPYIY-ADHLKDASVRILTVGIGSEINKKELINLAS--PNMAI-TVADFQKL--FENLMK------IIHHVCVIVDP--IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRR---HGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQ 1194
            D VFI+DAS +IS S+F L +  + +++  +   +   RI  +++G++    F    F N  D+++ ++ +    G     KALK   E      L  +  +   +   + T+G +   P      A  L+ + VR+  +GI  + N  +L+ +AS  P   +  V  F KL   E  ++      ++      ++   I     + E+ D+  L+D S SI  PDF+  K+F+  ++  F IGPK  RVG+V F   P +EF +    DR  +   + ++ ++G  T  G AL  ++  F   R+     +   ++++TDG +       + A+ LK +G +I ++G+ +    + L   SS  K+  V +Y+ L+
Sbjct:  395 DIVFIVDASDAISDSNFNLVRDFLHRLIKGLDVGSDSMRIGMVLYGNEPKAEFYLKTFDNKPDILQYIQILPYKGGKANTSKALKFAREKVFSKELGSRRARGVLQIAFVITEGES---PDDVTSEASKLRRSGVRVYALGIQHK-NVTQLMQIASYPPRKYVYNVDSFAKLTIMEQFLRKTLCNNVMRRTVAKINQFNIKQGCVQTEEADIYFLIDHSGSIDPPDFQDMKKFILEVLLHFNIGPKQVRVGVVKFESTPTLEFTVTQYGDRASIEGAVSNIVQIGGGTETGRALTFMRPYFIEARKTRDTRVREILIVITDGEST--DEVKQPAAALKSQGVSIYAVGVKQANKTQLLEMASSPSKMFFVENYDSLK 765          

HSP 2 Score: 103.219 bits (256), Expect = 4.158e-23
Identity = 95/352 (26.99%), Postives = 160/352 (45.45%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRY---VILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWP---HRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK 1161
            D  F++D S SI   DF+  K+ I++++          R+  + F    TL F   ++ +   +   V N+    G T  G+AL       +   +    R    +I+ TDG + +    P   A  LK   V I  VG+  + NK +L+ +AS P+    V ++  L     +I+  +C        + CK    D++ L+D S SI    F   K+FV + +S+ +IG  + +VGL+ F  +PR EF L+   D+ +++  +       +   +G AL E+   F P    R++   F ILI      +    P   A  L+ +G  I S+GIG   +L +L +IS + K
Sbjct:  601 DIYFLIDHSGSIDPPDFQDMKKFILEVLLHFNIGPKQVRVGVVKFESTPTLEFTVTQYGDRASIEGAVSNIVQIGGGTETGRALTFMRPYFIEARKTRDTRVREILIVITDGESTDEVKQP---AAALKSQGVSIYAVGV-KQANKTQLLEMASSPSKMFFVENYDSLKPLKDEIVTDIC------SEDACKQMMADIIFLVDGSWSIGAEGFSKIKKFVNNTVSRLKIGKDSVQVGLMQFGTNPRTEFQLNSYYDKVQMMRAVSQTVHAETNPEIGKALNELPKFFGPTKGGRQNAPKFLILITGAESKDDVNAP---AKALRDKGVTIYSIGIGEAKSL-QLRNISGSPK 938          

HSP 3 Score: 90.8929 bits (224), Expect = 4.073e-19
Identity = 98/390 (25.13%), Postives = 183/390 (46.92%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISF--IVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT-----------YENLVPQMRKDAQRYVILFTDGTNNV-FPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKL---FENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQ--FKFWPHRR--HGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            D VF++D S SI+  DF+  K  I   +    T   +N + F  IV+ +   + FN  K     ++   +  ++   G T    AL+ +            E+ VPQ+      +VI   + T++   P+P   A  L    + +  +G+G E  + EL+ +AS P     V +++ L    +N+ K++   C    P     C     DLV+L+D S+SI    +     F+   +   ++     R+G+  FS   + EF L+  ++   + + IK ++++   T +G AL +V   F+     R   GI  N+L++TDG +N     +    +L+    N+  +GIG  I++K++  I+ S D++  ++S++ L+ N  T+L+ + C
Sbjct:  974 DVVFLVDGSTSIAEEDFDKMK--IFMNLVVNNTEVGENYVRFCTIVYSNTPEVKFNLKKHYTKREVNNAISELKAPTGDTYTASALQYSIRFFSKAEGGRAEDGVPQLM-----FVITDGEATDHWDLPSP---AGKLHALGINVFGIGVG-EAKEDELMTIASDPKNVFKVDNYEALKALHQNISKVL---CNNSKP----ECSKVAADLVILIDGSESIEDAPWNTMINFMMRFVDSLRVREDLFRIGVAQFSTVYKKEFYLNEHMEPAAIKKAIKDIKQMKDGTNIGNALYQVDEFFQSAAGSRINSGISQNLLLITDGKSN--DNIYNATDRLRARNINMFVIGIG-QISMKQIEYIAGSQDRVFVLDSFDALKLNT-TILEVINC 1341          

HSP 4 Score: 77.0258 bits (188), Expect = 1.225e-14
Identity = 83/366 (22.68%), Postives = 158/366 (43.17%), Query Frame = 1
Query:   70 ISYLVSWKVYEATSS----CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVP-----QMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIG--KRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIK--HLRKLGSATGLGLALREVQFKFW---PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISL 1104
            +S+ +    Y ++S+    C     D VF++D S SI  +DF   KR +   +  ++ +    R++ + F ++         + + N+++ +V  +    G+T  GKAL    +         Q R +  R  ++ TDG + +    P   A  L+   V I T+G+G E+N  EL ++A+       I+  +++ L      +++ VC+ ++         +  D+ VL+DSS        +I   ++F+  L ++  +G K  R+ L+ F     +EF L+  + R + +  I+   LR  G +  LG A+  V+ +        R    F   +L  G              LK EG  I+ +
Sbjct:    8 LSFFILSSCYLSSSAQKTDCRANLADIVFLVDGSSSIGDADFLRMKRFLHAFIQGLEISADSIRVAVVQFSNNPHEDIPLGDYADKNELLEKVDRLVYHRGSTETGKALNFIKDRYFTQAGRIQARANVPRIAVVITDGDSTDDMKTP---AQELRREGVLIFTIGVG-EVNMAELQSIANKPHQRFVISFVNYEALVNAASNMMNTVCISMED-KQRALAPKYSDVFVLVDSSSQ------QIANIRKFLIQLATQLDVGAKVNRMALIQFGGEVNVEFLLNAYNTRREAIALIQKFQLRSSGRSN-LGQAMDYVRTRLLNSESGSRIAQGFKQYLLVVGKGETDTAVLRATRALKAEGVKIVEV 361          

HSP 5 Score: 73.559 bits (179), Expect = 1.513e-13
Identity = 51/173 (29.48%), Postives = 86/173 (49.71%), Query Frame = 1
Query:  655 CVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWP-----HRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            C +        C+    D+V L+D S SI   DF   KRF+   I   +I   + RV +V FS++P  +  L    D+N++LEK+  L     +T  G AL  ++ +++        R  +P   +++TDG   +    P   A +L+REG  I ++G+G  +N+ EL  I++
Sbjct:   16 CYLSSSAQKTDCRANLADIVFLVDGSSSIGDADFLRMKRFLHAFIQGLEISADSIRVAVVQFSNNPHEDIPLGDYADKNELLEKVDRLVYHRGSTETGKALNFIKDRYFTQAGRIQARANVPRIAVVITDGDSTDDMKTP---AQELRREGVLIFTIGVG-EVNMAELQSIAN 184          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Match: si:ch1073-291c23.1 (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 79.337 bits (194), Expect = 1.750e-15
Identity = 82/361 (22.71%), Postives = 155/361 (42.94%), Query Frame = 1
Query:   91 KVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQM---RKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPN------------MAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDG--YNNVFPRPHEIASKLKREGANIISLGI 1110
            K++  TS     K D  F++D S SI    F++ K  + ++   I    A   +  I +GDD    F+  ++ N  ++   +  +    G + +GKAL    ++        R  A    ++  DG  T+ V  A    +   +++ + I  V I G + N+K   N+  PN             ++ VA +  L + +  ++  VC     + ++ C +   D+  ++D S S+   +F    +FVA++  +F+I    TRVG V ++   R+EF     + +  +L  IK +      T  G A+     + +   +      ++++TDG  Y++V       A  + R G    S+GI
Sbjct:  396 KLHPETSHTRDCKVDIAFLMDGSWSIGKRRFKIQKDFLAEVSQVINVGVAGPMMGIIQYGDDPVTEFSLRQYSNSKELKPAIDKIMQKGGLSNVGKALSYINKHYFSDANGNRGGAPNVAVVLVDGWPTDKVEEA----SRQARESGINIFFVTIEGPDDNEKH--NVVEPNFVDKAVCRTNGFFSLPVASWFALRKAVQPLVKRVCDTDRLVCSKTC-LNANDIAFVIDGSSSVGTGNFRTVLQFVANVTREFEISDTDTRVGAVQYTYEQRLEFAFGQHNTKADLLNAIKRINYWSGGTSTGAAITYAAEQLFSKSKPNKRKIMIVITDGRSYDDV----RAPALAVHRSGVIAYSIGI 745          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009632.1 (pep scaffold:Pmarinus_7.0:GL479939:9900:31909:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 8.134e-24
Identity = 93/364 (25.55%), Postives = 168/364 (46.15%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVDP--------IPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            D   ++D S S+   +F L  + + K++  +       R+  + +  D         F+  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        DF  L   +  +   VC +V P        +    C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EFD+    D+ K+   I+  + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:    2 DLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATDFAGLDSIITALTSTVCTVVQPEKTLAGPTLALTECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 358          

HSP 2 Score: 94.7449 bits (234), Expect = 4.936e-21
Identity = 92/375 (24.53%), Postives = 173/375 (46.13%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVD------PIPNEPCKV---EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            A + CS  +   +++L D S S+   +F L  R + K++  +       R+  + +  +         F+  ++ +   +   ++  +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   +C +V       P+      V    + DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:  196 ALTECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITALTSTICTVVQEAQTPAPVTAATQAVTLPSKADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 563          

HSP 3 Score: 92.8189 bits (229), Expect = 2.060e-20
Identity = 90/358 (25.14%), Postives = 165/358 (46.09%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            K D   ++D S S+   +F L  R + K++  +       R+  + +  +         FN  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +M +      + +      C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:  410 KADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIIMTLAGPTLALTE------CSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 754          

HSP 4 Score: 77.7962 bits (190), Expect = 1.373e-15
Identity = 74/336 (22.02%), Postives = 138/336 (41.07%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKV-----EQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF--------WPHRRHGIPFNILILTDGYNN 1038
            A + CS  +   +++L D S S+   +F L  R + K++  +       R+  + +  +         FN  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   VC +V                + D++  +D S  ++  DF + K FVA ++    +G    RVGLV        EF L     R +V+  +  +   G    +G     VQF                G+P  ++I+T G ++
Sbjct:  592 ALTECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITALTSTVCTVVQEAQTPAPTPPPGPFAKLDVIFAIDGSAGVAAADFTLMKGFVAQIVQGLSVGAAQVRVGLVQLCGKQGSEFKLGQFSSRQEVVAAVGKVSAHGGGRAIG---ATVQFALATAFSQAEGGRAGEGVPQVLVIITGGASS 920          

HSP 5 Score: 77.411 bits (189), Expect = 1.791e-15
Identity = 66/286 (23.08%), Postives = 121/286 (42.31%), Query Frame = 1
Query:  121 WFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVC-VIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHP--RIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLAL 954
            + K D +F +D S  ++++DF L K  + +++  +    A  R+  +         F   +F +  ++V  V  V    G  AIG  ++        Q       +   + +++ T G ++   A   Y   L+   VR   +GIG+     +L  L S  + + +      +  L+ I   V  VIV P  N        D+V  +DSS ++    F   K F+  ++S  Q+G    RV +V     P    +F+ H  +R+ ++  +  L+ +G A  +G AL
Sbjct:  800 FAKLDVIFAIDGSAGVAAADFTLMKGFVAQIVQGLSVGAAQVRVGLVQLCGKQGSEFKLGQFSSRQEVVAAVGKVSAHGGGRAIGATVQFALATAFSQAEGGRAGEGVPQVLVIITGGASS--DAVAHYRGLLRAHGVRSFVIGIGA-FQLLDLQRLPSDPIGLHLYAVGG-YAQLLGIAGQVTSVIVRPGGNGALGPRYADIVFYLDSSATLGAAGFVSLKAFLVQVLSYLQVGRYTVRVAVVQVGGAPVAAFQFNSH-SERSALVAAVSQLKAVGGARNVGAAL 1080          

HSP 6 Score: 73.1738 bits (178), Expect = 5.130e-14
Identity = 75/326 (23.01%), Postives = 144/326 (44.17%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDA---QRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAI---TVADFQKL----FENLMKIIHHVCVI--VDPIPNEPCK----VEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPH-------RRHGIPFNILILTDGYNN 1038
            D VF LD+S ++ ++ F   K  +V+++++++      R++ +  G      F F+     + +V  V  ++   GA  +G AL L Y     Q         +  IL T G +         A  L+ + VR+  VG+GS +++  +  +AS   A+   TV+D+  L      +L+K I     +     +P++       ++  DLV L+D S S+    F + K+FV  +I+ +     + RV +  F    R+E  L +  D + +   I ++ K+     LG +L  V    +         +R  +  +I I++ G ++
Sbjct:  997 DIVFYLDSSATLGAAGFVSLKAFLVQVLSYLQVGRYTVRVAVVQVGGAPVAAFQFNSHSERSALVAAVSQLKAVGGARNVGAALSLGYTTYFSQASDAGLQPAQVGILLTGGASAD--NAAKAAAQLQASGVRLFVVGVGSGVDQALIQGVASFPYALHSFTVSDYTGLSTVVVTSLVKYIFRPGKMGGTRKLPSDSAAAGRGLDDVDLVFLIDGSTSVEQQTFHLIKKFVERIITNYYYIGGSLRVAVYQFGGAGRLEVPLGNQNDADSLTHTISNIEKVSGPRNLGASLTYVLSNIYKETTTTKLSQRGNVQQSIFIISGGKSD 1320          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009633.1 (pep scaffold:Pmarinus_7.0:GL479939:15464:32536:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009633.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 8.442e-23
Identity = 98/387 (25.32%), Postives = 178/387 (45.99%), Query Frame = 1
Query:   43 IVKLASLPAISYLVSWKVYEATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            +V+ A  PA     +  V   +  CS  +   +++L D S S+   +F L  R + K++  +       R+  + +  +         FN  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   VC +V       C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:  413 VVQEAQTPAPVTAATQAVTLPSKECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITTLTSTVCTVVQ------CSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 786          

HSP 2 Score: 97.4413 bits (241), Expect = 5.909e-22
Identity = 93/382 (24.35%), Postives = 176/382 (46.07%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVD---------------PIPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            A + CS  +   +++L D S S+   +F L  R + K++  +       R+  + +  +         F+  ++ +   +   ++  +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   +C +V                 +P++ C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:  221 ALTECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITALTSTICTVVQEAQTPAPVTAATQAVTLPSKECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 595          

HSP 3 Score: 94.7449 bits (234), Expect = 4.978e-21
Identity = 95/376 (25.27%), Postives = 172/376 (45.74%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQR-----YVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASP------NMAITVADFQKLFENLMKIIHHVCVIVDP-IPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            A + CS  +   +++L D S S+   +F L  + + K++  +       R+  + +  D         F+  ++ +   +   +   +   G T  G AL+ T +    Q R    +      ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP            A F    E  +K I  +  +  P +    C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EFD+    D+ K+   I+  + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:   15 ALTECSDKQTADLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKPQVPFILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDNLLRFCXDTAIFAVYLEQTVKPIVQLSTLAGPTLALTECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGKA-DRKELALMAS 383          

HSP 4 Score: 81.2629 bits (199), Expect = 1.175e-16
Identity = 72/320 (22.50%), Postives = 133/320 (41.56%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF--------WPHRRHGIPFNILILTDGYNN 1038
            D   ++D S S+   +F L  R + K++  +       R+  + +  +         FN  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   VC +V     E     + D++  +D S  ++  DF + K FVA ++    +G    RVGLV        EF L     R +V+  +  +   G    +G     VQF                G+P  ++I+T G ++
Sbjct:  635 DLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITALTSTVCTVV----QEARPFAKLDVIFAIDGSAGVAAADFTLMKGFVAQIVQGLSVGAAQVRVGLVQLCGKQGSEFKLGQFSSRQEVVAAVGKVSAHGGGRAIGAT---VQFALATAFSQAEGGRAGEGVPQVLVIITGGASS 943          

HSP 5 Score: 71.633 bits (174), Expect = 1.538e-13
Identity = 72/337 (21.36%), Postives = 136/337 (40.36%), Query Frame = 1
Query:   61 LPAISYLVSWKVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMR-----KDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHP--RIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-------RHGIPFNILILTDG 1029
            + A++  V   V EA     + K D +F +D S  ++++DF L K  + +++  +    A  R+  +         F   +F +  ++V  V  V    G  AIG  ++        Q       +   + +++ T G ++   A   Y   L+   VR   +GIG+     +L  L S  + + +      +  L+ I   V  ++          +  D+V  +DSS ++    F   K F+  ++S  Q+G    RV +V     P    +F+ H  +R+ ++  +  L+ +G A  +G AL      ++          R G P  + IL  G
Sbjct:  806 ITALTSTVCTVVQEARP---FAKLDVIFAIDGSAGVAAADFTLMKGFVAQIVQGLSVGAAQVRVGLVQLCGKQGSEFKLGQFSSRQEVVAAVGKVSAHGGGRAIGATVQFALATAFSQAEGGRAGEGVPQVLVIITGGASS--DAVAHYRGLLRAHGVRSFVIGIGA-FQLLDLQRLPSDPIGLHLYAVGG-YAQLLGIAGQVTSVIVRSSCVTRGAQYADIVFYLDSSATLGAAGFVSLKAFLVQVLSYLQVGRYTVRVAVVQVGGAPVAAFQFNSH-SERSALVAAVSQLKAVGGARNVGAALSLGYTTYFSQASDAGLQVRPGPPAQVGILLTG 1134          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009635.1 (pep scaffold:Pmarinus_7.0:GL479939:22902:31906:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.184e-22
Identity = 96/380 (25.26%), Postives = 172/380 (45.26%), Query Frame = 1
Query:   61 LPAISYLVSWKVYEATSSCSWFKQDTVFIL-DASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLI-----FNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNM---AITVADFQKLFENLMKIIHHVCVIVD----PIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELT 1140
            +PA   L      + +S CS  +   +++L D S S+   +F L  R + K++  +       R+  + +  +         FN  ++ +   +   +   +   G T  G AL+ T +    Q R    + ++L TDG  N+    P   +D +K + + + +VG+G + ++KEL  +ASP +        +F  L   +  +   VC +V     P P         DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL 
Sbjct:  272 VPAGGRLQQRGAPQLSSECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVG-KADRKELALMASPPVDKHMFHATNFAGLDSIITTLTSTVCTVVQEAQTPAPTA-------DLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGK-ADRKELA 637          

HSP 2 Score: 61.2326 bits (147), Expect = 1.985e-10
Identity = 51/168 (30.36%), Postives = 86/168 (51.19%), Query Frame = 1
Query:  670 PIPNEPCKVEQ-QDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDH---PRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            P  +  C  +Q  DL +L+D S S+   +F +  RF+A L+ K  IG    RVG+V +S +   PRI  EF++    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:  284 PQLSSECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGK-ADRKELALMAS 448          

HSP 3 Score: 59.3066 bits (142), Expect = 9.554e-10
Identity = 47/155 (30.32%), Postives = 80/155 (51.61%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSD---HPRI--EFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            DL +L+D S S+   +F +  +F+A L+ K  IG    RVG+V +S     P+I  EFD+    D+ K+   I   + +   T  G ALR     F    R G+   ++++TDG  N   +  + + ++K  G  + S+G+G+  + KEL  ++S
Sbjct:    1 DLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKILVLVTDGEAN--DKVKDPSDEVKSSGIVLFSVGVGK-ADRKELALMAS 152          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007296.1 (pep scaffold:Pmarinus_7.0:GL477669:89164:98084:1 gene:ENSPMAG00000006585.1 transcript:ENSPMAT00000007296.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 1.673e-17
Identity = 84/371 (22.64%), Postives = 158/371 (42.59%), Query Frame = 1
Query:   88 WKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASP---NMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR---RHGIPF-NILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            W      ++CS     D VF++D S SI + +F+  +  +  ++  +       R+    +  DA   F  + + +   ++  +K +    G T  G  ++   +N +      +  ++  + VI+ TDG + +    P +    +++    +  +GI  + +  EL  +AS         V DF  L     +I+  VCV V+ I  E  K +  D+V +MD S ++    FE  ++ V  + S   + P   R+G+V ++D+   EF L+    +  VL+ I+  +  G     G  +R  + + +  +   R    F  I +L  G  +        A  LK  G  + +LG  +  NL EL  I S+
Sbjct:   20 WPTAAQKTACSKASVADIVFLIDGSWSIGNINFQQMRSFLYTLVEGLDVAPDKVRVGMAQYSGDARTEFLMNTYADKASLLNYLKTLPYKGGNTKTGLGIEFLMQNHLTDAAGSRKAQNVPQVVIIITDGKSQDDVAGPAV---KMRNMGASVYAIGI-KDADISELGQMASSPASKFVYNVDDFSALAGISEQILQTVCVTVEEIVTEIRKPKFADIVFIMDGSDNVGKAGFEDMRKVVYKIASILDVAPDQNRIGVVQYNDNGHAEFLLNTHSSKEDVLKNIRQFKFRGGIANTGAGIRFAEERLFTEQAGSRKAEGFAQIAVLLTGSASQ-DEVERRAKALKDSGVTVFALGANK-ANLNELNLIGSD 384          

HSP 2 Score: 73.9442 bits (180), Expect = 2.444e-14
Identity = 79/355 (22.25%), Postives = 152/355 (42.82%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVR-NDNGATAI---GKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQFKFW-----PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D VF++D S ++   +F  +  ++ +++  +       RI    +  D    F         D+   ++ +R   NG++     GK + L +    P   KD    ++  +   ++V  +    A  LK+    +  +G G+     EL+   S    +      DF+ L     ++   +  ++     E C KV++ D+V+L+D S SI   +F+  + F+  ++    +G    R+G+  FS  PR EF L      K +L+ IK L   G  T  G AL  +    +       +   +P   +++TDG +       + A KL++ G  + ++GI ++ +  EL  I+S 
Sbjct:  842 DVVFLVDGSDAVGQENFRHSLGLVSRVVDALDVDKDHIRIGLAQYSGDPRAEFFLSTHAAKKDVTDAIRGIRFKGNGSSRPKYPGKMVPLCHSVTGPD--KDNIAVLVAGSGSGDDVLAS----AQALKNDGTTVFAIGAGAA-KLGELVTAGSDPEKDYVFYQRDFRALSGLSGQLAEGLSSLMKQESEEQCTKVDKADIVLLVDGSWSIGLANFQQMREFLYSIVDGLTVGKDQVRIGMAQFSGDPRTEFFLKTFSSQKDILDYIKTLPYKGGNTMTGRALEFISDNHFTAAAGSRKAQNVPQIAVVITDGKSQ--DDVEDAAEKLRKLGIAVYAIGI-KNADFHELQQIASQ 1186          

HSP 3 Score: 66.6254 bits (161), Expect = 5.320e-12
Identity = 89/386 (23.06%), Postives = 156/386 (40.41%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYEN-LVPQ----MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINL----ASP--NMAITV---ADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKL--GSATGLGLALRE-VQFKFWPH----RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI--GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLK 1218
            D VF+LD + ++ S++FE  +++++ ++  +       RI    +G   +  F  +      ++   V++     G  A  G  ++   EN  V Q    +R+   +  +L T   +       + A+ +K A   +  +G     N+  L  L    +SP  N A  V    D   L+  LM   +   ++      E  +    D+V L+DSS ++   +FE  K FV  ++    +     RVGL  +SD+PR EF L+       ++    L +   G     G A+R  +Q  F       +  G     +ILT   +      H  A  LK+EG  + +LG    R   L  L  + S   +L   ++  L  +    LK
Sbjct:  427 DIVFLLDDTDNVGSANFEELRKLVIMLIEGLNVGKDKVRIGMAQYGRQPSTTFFLNAHGTKEEVAAGVRSAVFRGGPRANTGSGMRFLQENHFVEQAGSRVRQGFPQIAVLLTGSASQ--DNASMGAEAIKGAGGTVFAIGA----NRARLAELNRVASSPPDNHAFYVNNFGDLSGLYTQLMGGFN--TLLRRDEEEEEVEKPYADVVFLLDSSDAVGRKNFEGMKTFVGQIVEYLDVDASKVRVGLAQYSDNPRNEFFLNTHGTKPDVQAAIQLARFTGGRGANTGEAVRSLLQNHFTAQAGSRKDEGYTQIAVILTGSDSQDVVEQH--AGALKQEGVKVFALGAEQARLPQLNALGSLPSEQHVLYAPNFSELFSSFDRFLK 802          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007304.1 (pep scaffold:Pmarinus_7.0:GL477669:89164:98057:1 gene:ENSPMAG00000006585.1 transcript:ENSPMAT00000007304.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 1.958e-17
Identity = 84/371 (22.64%), Postives = 158/371 (42.59%), Query Frame = 1
Query:   88 WKVYEATSSCSWFK-QDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASP---NMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHL-VDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR---RHGIPF-NILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            W      ++CS     D VF++D S SI + +F+  +  +  ++  +       R+    +  DA   F  + + +   ++  +K +    G T  G  ++   +N +      +  ++  + VI+ TDG + +    P +    +++    +  +GI  + +  EL  +AS         V DF  L     +I+  VCV V+ I  E  K +  D+V +MD S ++    FE  ++ V  + S   + P   R+G+V ++D+   EF L+    +  VL+ I+  +  G     G  +R  + + +  +   R    F  I +L  G  +        A  LK  G  + +LG  +  NL EL  I S+
Sbjct:   20 WPTAAQKTACSKASVADIVFLIDGSWSIGNINFQQMRSFLYTLVEGLDVAPDKVRVGMAQYSGDARTEFLMNTYADKASLLNYLKTLPYKGGNTKTGLGIEFLMQNHLTDAAGSRKAQNVPQVVIIITDGKSQDDVAGPAV---KMRNMGASVYAIGI-KDADISELGQMASSPASKFVYNVDDFSALAGISEQILQTVCVTVEEIVTEIRKPKFADIVFIMDGSDNVGKAGFEDMRKVVYKIASILDVAPDQNRIGVVQYNDNGHAEFLLNTHSSKEDVLKNIRQFKFRGGIANTGAGIRFAEERLFTEQAGSRKAEGFAQIAVLLTGSASQ-DEVERRAKALKDSGVTVFALGANK-ANLNELNLIGSD 384          

HSP 2 Score: 73.559 bits (179), Expect = 3.379e-14
Identity = 79/358 (22.07%), Postives = 151/358 (42.18%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYENLVPQMRKD------AQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQFKFW-----PHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN 1155
            D VF++D S ++   +F  +  ++ +++  +       RI    +  D    F         D+   ++ +R   G +  +G AL+   +N   +           Q  V++   G+ +   A    A  LK+    +  +G G+     EL+   S    +      DF+ L     ++   +  ++     E C KV++ D+V+L+D S SI   +F+  + F+  ++    +G    R+G+  FS  PR EF L      K +L+ IK L   G  T  G AL  +    +       +   +P   +++TDG +       + A KL++ G  + ++GI ++ +  EL  I+S 
Sbjct:  830 DVVFLVDGSDAVGQENFRHSLGLVSRVVDALDVDKDHIRIGLAQYSGDPRAEFFLSTHAAKKDVTDAIRGIRFKGGRSGNMGAALQHLKDNHFVEAAGSRVKEGFPQIAVLVAGSGSGDDVLAS---AQALKNDGTTVFAIGAGAA-KLGELVTAGSDPEKDYVFYQRDFRALSGLSGQLAEGLSSLMKQESEEQCTKVDKADIVLLVDGSWSIGLANFQQMREFLYSIVDGLTVGKDQVRIGMAQFSGDPRTEFFLKTFSSQKDILDYIKTLPYKGGNTMTGRALEFISDNHFTAAAGSRKAQNVPQIAVVITDGKSQ--DDVEDAAEKLRKLGIAVYAIGI-KNADFHELQQIASQ 1180          

HSP 3 Score: 70.8626 bits (172), Expect = 2.399e-13
Identity = 86/391 (21.99%), Postives = 159/391 (40.66%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATA-IGKALKLTYEN-LVPQ----MRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIG----SEINKKE----------LINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKL--GSATGLGLALRE-VQFKFWPH----RRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI--GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLK 1218
            D VF+LD + ++ S++FE  +++++ ++  +       RI    +G   +  F  +      ++   V++     G  A  G  ++   EN  V Q    +R+   +  +L T   +       + A+ +K A   +  +G      +E+N+            + N   P M + ++D    F  L  ++ H+   ++    +P      D+V L+DSS ++   +FE  K FV  ++    +     RVGL  +SD+PR EF L+       ++    L +   G     G A+R  +Q  F       +  G     +ILT   +      H  A  LK+EG  + +LG    R   L  L  + S   +L   ++  L  +    LK
Sbjct:  428 DIVFLLDDTDNVGSANFEELRKLVIMLIEGLNVGKDKVRIGMAQYGRQPSTTFFLNAHGTKEEVAAGVRSAVFRGGPRANTGSGMRFLQENHFVEQAGSRVRQGFPQIAVLLTGSASQ--DNASMGAEAIKGAGGTVFAIGANRARLAELNRVASSPPDNHAFYVNNFGFPPMWVCLSD---TFSPLFTMLGHLPSWINTEVEKPYA----DVVFLLDSSDAVGRKNFEGMKTFVGQIVEYLDVDASKVRVGLAQYSDNPRNEFFLNTHGTKPDVQAAIQLARFTGGRGANTGEAVRSLLQNHFTAQAGSRKDEGYTQIAVILTGSDSQDVVEQH--AGALKQEGVKVFALGAEQARLPQLNALGSLPSEQHVLYAPNFSELFSSFDRFLK 807          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Match: EDO47555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM80])

HSP 1 Score: 96.2857 bits (238), Expect = 7.783e-22
Identity = 100/406 (24.63%), Postives = 178/406 (43.84%), Query Frame = 1
Query:  127 KQDTVFILDASQSI---SSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ-MRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVCVIVD----------PIPNEPCKVEQQ---------------DLVVLMDSSKSI---SGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIE--FDLHLVDRNKVLEKIK--HLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN---DKILTVNSYERLQKNMKTV 1212
            K D  F+LD S S+   +  +F+  K  I K +     +  D+    ++F  D+ + F FD   +   +   V   +     T  GK L L  ++L    +R    R +I+ TDG +++    P   A  L+D  V I  +GIG   ++ +L ++ S   P+  +T ADF KL   +  I    C  +D          P+ +   K + Q               D+  L+D S S+   +  +F+  K F+   +  F +    +  GLV FS    +E  FD H  D   +   +   +   +G+  G GL L +      P  R G+P  ++++TDG  ++    P   A  L+  G  I +LGIG++ +  +L  + S+   D ++T + +++L   ++T+
Sbjct:    5 KVDVGFLLDGSGSVEFYAKGNFQRCKNFINKFVKSFMVSKDDSHFGLVLFSSDSNVEFKFDDHYDAASITAAVNATKYPGMGTYAGKGLTLAKDDLYSAPVRSGVPRILIVMTDGISSDDVAGP---AKALRDMGVEIFALGIGKNYDQGQLDSMGSDPKPDHVVT-ADFDKLDPVIQTIKDKACNGIDKEQTESHSASPVDDGALKTKNQNRFRSSSVTVCKAKVDVGFLLDGSGSVEFYAKGNFQRCKNFINKFVKSFMVSKDDSHFGLVLFSSDSNVEFKFDDHY-DAASITAAVNATNYPGMGTYAGKGLTLAKDDLYSAP-VRSGVPRILIVMTDGISSDDVAGP---AKALRDMGVEIFALGIGKNYDQGQLDSMGSDPKPDHVVTAD-FDKLDPVIQTI 400          

HSP 2 Score: 51.9878 bits (123), Expect = 2.213e-7
Identity = 48/186 (25.81%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  688 CKVEQQDLVVLMDSSKSI---SGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIE--FDLHLVDRNKVLEKIKHLR--KLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSN---DKILTVNSYERLQKNMKTV 1212
            CK  + D+  L+D S S+   +  +F+  K F+   +  F +    +  GLV FS    +E  FD H  D   +   +   +   +G+  G GL L +      P  R G+P  ++++TDG  ++    P   A  L+  G  I +LGIG++ +  +L  + S+   D ++T + +++L   ++T+
Sbjct:    2 CKA-KVDVGFLLDGSGSVEFYAKGNFQRCKNFINKFVKSFMVSKDDSHFGLVLFSSDSNVEFKFDDHY-DAASITAAVNATKYPGMGTYAGKGLTLAKDDLYSAP-VRSGVPRILIVMTDGISSDDVAGP---AKALRDMGVEIFALGIGKNYDQGQLDSMGSDPKPDHVVTAD-FDKLDPVIQTI 180          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Match: EDO46550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ5])

HSP 1 Score: 91.6633 bits (226), Expect = 1.005e-19
Identity = 96/388 (24.74%), Postives = 174/388 (44.85%), Query Frame = 1
Query:  145 ILDASQSISSSDFELAK--RVIVKMMTFIKTTNADNRISFIVFGDDATL-IFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTN-NVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMA--ITVADFQKLFENLMKIIHHVCVIVDPIPNE-------PCKVEQ-QDLVVLMDSSKSIS---GPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQFKFWPHR--RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS--NDKILTVNSYERLQKNMKTVLKAVTCG*TK 1242
            +LD+  +  SSD    K  +   K+      +   NR+  +V+     L + +FD F + + M + + +    N     GK L    E+L  ++    Q  ++L TDG + +    P +    L+   V I  VG+G  + +KEL  +AS   +  + +  +  L   L +I   VC       N        P   +Q  D+  L+D S++I      +F     FV ++   F +   A  VG V +   P +E  L   + +K +L+ +  ++  G+AT  G AL   +   +  R  R  +P  +++LT G +    R  E +  L R+G +++S+G+G   +  EL +++S  N   + V+ Y +L  N+K  L+ + C  T+
Sbjct: 1453 VLDSKTTAYSSDDNARKMLQFAKKVTHLFPVSPEGNRVGMMVYSGSPKLKVVHFDHFLDQDTMDKAIDSASYLNMEIKTGKVLNFAQEHLFSRVPAGKQNVLLLITDGVSYDDVTKPAV---QLQHKGVEIFCVGVGDNVVRKELETIASSPQSDHVIMTSYNMLEATLEQIKQKVCSSAAKKENTHRASNRMPHDCDQAADIGFLIDGSRTIEVMGKGNFGTIIEFVKNVTKMFPLSRDAFSVGAVVYGSEPSLEIPLGSHNTSKGLLKALSKIKYPGTATKTGKALEYARLNLFGSRNARRKVPKILVVLTKGSSRDDIR--EASEDLHRDGVHVVSVGMGPVNDRMELANMASLPNKDNIVVSDYSKLSSNVKR-LRDIICKATR 1834          

HSP 2 Score: 53.5286 bits (127), Expect = 1.278e-7
Identity = 48/179 (26.82%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADN-RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVP-QMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMA--ITVADFQKLFENLMKIIHHVC 657
            D  F++D S  I    F     V+  +    +  NA   ++S + +GDDAT  FNF      +++   +  V    G    G AL    + L     R      ++L T G+ +    P   A  L++A V++  +G+G   N KELI +AS   +  +  A    L E + +I+  VC
Sbjct:  624 DLAFVIDGSSDIPQMYFS---HVLDYLKALARGFNASQTQVSLMAYGDDATAAFNFGSVNTTSEIDDGIDAVSYMGGEPKTGNALYKAKKGLFEVSSRPGVSHALVLLTSGSASDEIGP--PALELRNAGVKVTAIGLGKLANVKELIEIASEPKSSHVFTAFLDTLPERMDEIVTGVC 797          

HSP 3 Score: 51.6026 bits (122), Expect = 4.760e-7
Identity = 49/193 (25.39%), Postives = 92/193 (47.67%), Query Frame = 1
Query:  673 IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGK--RFVAHLISKFQIGPKATRVGLVSFSDHPR---IEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDG--YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKI--LTVNSYERLQKNMKTVLKAV 1224
            +  E C V   +L V++DS  +    D    K  +F   +   F + P+  RVG++ +S  P+   + FD H +D++ + + I     L      G  L   Q   +     G    +L++TDG  Y++V  +P   A +L+ +G  I  +G+G ++  KEL  I+S+ +   + + SY  L+  ++ + + V
Sbjct: 1441 VKREDCSV---NLGVVLDSKTTAYSSDDNARKMLQFAKKVTHLFPVSPEGNRVGMMVYSGSPKLKVVHFD-HFLDQDTMDKAIDSASYLNMEIKTGKVLNFAQEHLFSRVPAGKQNVLLLITDGVSYDDV-TKP---AVQLQHKGVEIFCVGVGDNVVRKELETIASSPQSDHVIMTSYNMLEATLEQIKQKV 1625          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Match: EDO50077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFD6])

HSP 1 Score: 80.4925 bits (197), Expect = 3.686e-18
Identity = 56/159 (35.22%), Postives = 94/159 (59.12%), Query Frame = 1
Query:  688 CKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLE---KIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            CK  + DL  L+D S SI    F+  KRF+ ++IS+F I PK TRVGLV +S++P   F  +   ++N  ++   +I + R+ G+ TG  LA    ++ F   +R  +   +++LTDG +  + R    A KL++ G +I ++G+GR+ N+K+L  I+S
Sbjct:    6 CKA-RLDLGFLVDGSGSIKAARFKGVKRFIQNVISRFHISPKHTRVGLVLYSNNPYKIFGFNKYTNKNAAMKATGRIPYPRR-GTKTGRALAY-TGRYLFRSSKRRRV---LILLTDGRS--YDRVSAPARKLRQAGIHIYAVGVGRNYNIKQLRSIAS 156          

HSP 2 Score: 66.2402 bits (160), Expect = 3.585e-13
Identity = 43/151 (28.48%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTN-NVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS 582
            D  F++D S SI ++ F+  KR I  +++    +    R+  +++ ++   IF F+K+ N N  ++    +      T  G+AL  T   L    ++  +R +IL TDG + +   AP   A  L+ A + I  VG+G   N K+L ++AS
Sbjct:   11 DLGFLVDGSGSIKAARFKGVKRFIQNVISRFHISPKHTRVGLVLYSNNPYKIFGFNKYTNKNAAMKATGRIPYPRRGTKTGRALAYTGRYLFRSSKR--RRVLILLTDGRSYDRVSAP---ARKLRQAGIHIYAVGVGRNYNIKQLRSIAS 156          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Match: NVBF-2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYW2])

HSP 1 Score: 86.2705 bits (212), Expect = 4.520e-18
Identity = 54/200 (27.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTT--NADNRISFIVFGDDATLIFNFDKFKNLN--DMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASP---NMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDL 711
            D VF+ DAS SI   DF L     ++++  + T+       ++ I +G ++ L FN      L    ++ ++  ++   G TA   AL  T   +VP  R+ +Q+ +   TDG +N+  +P   A  LKD   +I  +G+G ++ ++EL+ +AS       I+V  +++L   + K +H   + +D     PC   Q +L
Sbjct:  386 DVVFVFDASSSIKMDDFRLGLDFSIELVKLLGTSWKPGGTHVAAITYGTESHLEFNLGDAGALTAKSVIAKIGKIKRSGGGTASRLALDTTIRQVVPFTREGSQKALFFITDGHSNIGGSPRKAAKILKDKGFQIYAIGVGKKVRRRELMEIASEPEDEYVISVRKYKQLLSAVKKAVH---IKID---YSPCGESQTNL 579          

HSP 2 Score: 74.3294 bits (181), Expect = 2.610e-14
Identity = 51/181 (28.18%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIG--PKATRVGLVSFSDHPRIEFDLH---LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS---NDKILTVNSYERLQKNMKTVLKAV 1224
            D+V + D+S SI   DF +G  F   L+        P  T V  +++     +EF+L     +    V+ KI  +++ G  T   LAL     +  P  R G    +  +TDG++N+   P + A  LK +G  I ++G+G+ +  +EL +I+S   ++ +++V  Y++L   +  V KAV
Sbjct:  386 DVVFVFDASSSIKMDDFRLGLDFSIELVKLLGTSWKPGGTHVAAITYGTESHLEFNLGDAGALTAKSVIAKIGKIKRSGGGTASRLALDTTIRQVVPFTREGSQKALFFITDGHSNIGGSPRKAAKILKDKGFQIYAIGVGKKVRRRELMEIASEPEDEYVISVRKYKQL---LSAVKKAV 563          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Match: EDO50079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFD8])

HSP 1 Score: 76.6406 bits (187), Expect = 1.733e-16
Identity = 47/177 (26.55%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDG--TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVC 657
            D VF +DAS S+   +FE  K  I +++     +    R++ IV+     + F+F+++ +       VK +R   G T+ G+AL+L    L  +  +  ++ ++L TDG  +++V       +  LK   V+I  VG+G  +++ ELI +AS    +  A F  L   +  +    C
Sbjct:    7 DLVFAIDASSSVGKVNFERVKGFIRRLVESFHISRTSTRVAAIVYSSRPRVAFDFNRYTSARRAAHAVKRLRFLRGGTSTGRALRLASSRLFRRYGRKRRKVLMLITDGKSSDDVLKP----SKALKRKGVQIFAVGVGMSVSRNELILIASHPSQVYQASFTSLSAIVKSLARKTC 179          

HSP 2 Score: 73.1738 bits (178), Expect = 2.995e-15
Identity = 53/179 (29.61%), Postives = 91/179 (50.84%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN--ILILTDG-YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            DLV  +D+S S+   +FE  K F+  L+  F I   +TRV  + +S  PR+ FD +      +    +K LR L   T  G ALR    + +  RR+G      ++++TDG  ++   +P +    LKR+G  I ++G+G  ++  EL  I+S+   +   S+  L   +K++ +  TC
Sbjct:    7 DLVFAIDASSSVGKVNFERVKGFIRRLVESFHISRTSTRVAAIVYSSRPRVAFDFNRYTSARRAAHAVKRLRFLRGGTSTGRALRLASSRLF--RRYGRKRRKVLMLITDGKSSDDVLKPSKA---LKRKGVQIFAVGVGMSVSRNELILIASHPSQVYQASFTSLSAIVKSLARK-TC 179          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Match: COL6A6 (collagen type VI alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:27023])

HSP 1 Score: 132.109 bits (331), Expect = 1.059e-32
Identity = 110/415 (26.51%), Postives = 204/415 (49.16%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFKQ-DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADN--RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDG-----TNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPNMAITVADFQKLFENLMK-IIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF----WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL----QKNMKTVLKAVTCG 1233
            +L  +  L++ ++ +    C   ++ D +F++D S SIS  +F+  ++ ++ M+   +TT  +N  R   +++ +D  ++F  ++FK   ++++ +  ++  +G T  GKALK   +    +    A+    + +++ TDG      N V P+     + L+   V I ++G+ G+ + + E++     +    V +F  L E L K I   +C    P+    C+ +Q DLV L+D S SI   D+++ K F   L+  F IG K  RVGL  FS   + EF L    +  +V E I  + + G  T +GLAL+ ++  F       R  GI  N++++TDG +       + A  L+  G  I ++GIG   +L+ L    +  ++ TV ++  L    QK + T+ K+   G
Sbjct:  955 ALKDLESLLALQLCDPQRDCKKTERADIIFLVDGSTSISLENFKSMQKFMLSMVN--QTTVGENLTRFGVLLYSNDPKMMFKLNQFKTRQEVLKAISGLKPPSGDTYTGKALKFCLQFFSAENGGRAELQVPQILMVITDGDATDRNNLVEPS-----EALRSKGVNIFSIGVKGANMTQLEIMAGQDKSKVFFVDNFAAL-EGLYKNISKELCNSTKPV----CEKQQADLVFLVDQSGSIQTGDYDLMKNFTTELVKSFSIGQKLVRVGLAQFSSSFQHEFYLNQFSEDTEVSEHILEMTQTGGGTNIGLALKSIREYFETSRGSRRSEGISQNLVLITDGESQ--DDVEDPADDLRALGIEIFAIGIGDVHDLELLQITGTPQRLFTVQNFGSLENIKQKVVDTICKSKPSG 1355          

HSP 2 Score: 117.472 bits (293), Expect = 8.781e-28
Identity = 107/381 (28.08%), Postives = 184/381 (48.29%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ-----RYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF------WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            D  F++D S+SI  SDF+     I++ +   +      R+  + + D   L F  + + +  ++   V+ ++   G T  G+AL  T+   +    KD++      Y+++ TDG +++   +P   A+ L+   V I T+G+  E +KKEL  ++  P     V DF  L     K+I  +C        E CK    DLV L+DSS SI   D+E  K F+  +IS+  IG     VG++ FS  P+ EFDL     +  +L+ I  +++LG  T  G AL  V   F       PH +      ++++TDG      R    A  L+ +G  I ++G+    N  +L +IS S+D++ +   ++ L K+++++L    C
Sbjct:  606 DIFFLIDHSRSIYPSDFKDMINFIIEFIQTFRIGPQYVRMGVVKYADLPELEFGLETYMDAENLETAVRTIQQRGGGTETGRAL--TFMGSLFDKAKDSRGHKVPEYLVVITDGKSSDEVKSP---AEKLRSKGVTIYTIGV-KEADKKELEEISGDPKRMFFVNDFDALNPIKDKVITDIC----SADGEVCKDLSGDLVFLIDSSGSIYPQDYEKMKDFMKFVISRSFIGRNEVHVGVLQFSSSPQPEFDLRSFFSKEDMLQAINGMQQLGGGTLTGDALTAVSQYFDSALGGRPHLQQ----RLVVVTDGQAQDEVRGP--AEALREKGVKIYAIGV-VDANTTQLLEISGSHDRMYSGRDFDAL-KDLESLLALQLC 968          

HSP 3 Score: 111.309 bits (277), Expect = 8.545e-26
Identity = 95/377 (25.20%), Postives = 182/377 (48.28%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLV-----PQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVC--VIVDPIP--------NEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF---WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERL 1191
            D VF++D S SI +++F+L +  +  +++ +       R+  +V+ D    +   + FKN  +++  ++ +    G T  G AL  T +++       +     Q+  ++ TDG +    +    A  L+ + V + +VG+  + N+ ELI +AS         V  F +L    +K+   +C  +I   +          E C + E+ D+  L+D S+SI   DF+    F+   I  F+IGP+  R+G+V ++D P +EF L   +D   +   ++ +++ G  T  G AL  +   F      R H +P  ++++TDG ++        A KL+ +G  I ++G+ +  + KEL +IS + K +  VN ++ L
Sbjct:  399 DIVFVIDQSGSIGTANFQLVRMFVHSIVSGLDVGQNRVRVGVVVYNDKPEALVYLNTFKNKQNLLNFIQILPYVGGGTKTGAALNFTLQSVFTKESGSRTNTGVQQVAVVITDGESQ--DSVREAAASLRRSGVIVYSVGV-DKANETELIQIASHPPKEHVFIVKSFAELTPLKVKLQKVLCYNIIRQAVTVAGRSSAIKEGCLQTEEADIFFLIDHSRSIYPSDFKDMINFIIEFIQTFRIGPQYVRMGVVKYADLPELEFGLETYMDAENLETAVRTIQQRGGGTETGRALTFMGSLFDKAKDSRGHKVPEYLVVITDGKSS--DEVKSPAEKLRSKGVTIYTIGV-KEADKKELEEISGDPKRMFFVNDFDAL 769          

HSP 4 Score: 98.2117 bits (243), Expect = 1.893e-21
Identity = 101/399 (25.31%), Postives = 189/399 (47.37%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNR----ISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKL--FENLMKIIHHVCVIVDPIPNEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDG----YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSND--KILTVNSYERLQKNMKTVLKAVTCG*TK 1242
            C     D VF++D+S SI   D+E  K      M F+ + +   R    +  + F       F+   F +  DM++ +  ++   G T  G AL     Y +     R   Q+ +++ TDG   +    P   A+ L++  V+I  +G+  + N  +L+ ++ S +   +  DF  L   E+L+ +   +C      P   C K E+ D++ L+D S SIS  +F+  ++F+  ++++  +G   TR G++ +S+ P++ F L     R +VL+ I  L+     T  G AL+    +F+     G     +P  ++++TDG     NN+     E +  L+ +G NI S+G+ +  N+ +L  ++  D  K+  V+++  L+   K + K + C  TK
Sbjct:  788 CKDLSGDLVFLIDSSGSIYPQDYEKMK----DFMKFVISRSFIGRNEVHVGVLQFSSSPQPEFDLRSFFSKEDMLQAINGMQQLGGGTLTGDALTAVSQYFDSALGGRPHLQQRLVVVTDGQAQDEVRGP---AEALREKGVKIYAIGV-VDANTTQLLEISGSHDRMYSGRDFDALKDLESLLAL--QLC-----DPQRDCKKTERADIIFLVDGSTSISLENFKSMQKFMLSMVNQTTVGENLTRFGVLLYSNDPKMMFKLNQFKTRQEVLKAISGLKPPSGDTYTGKALK-FCLQFFSAENGGRAELQVPQILMVITDGDATDRNNLV----EPSEALRSKGVNIFSIGV-KGANMTQLEIMAGQDKSKVFFVDNFAALEGLYKNISKEL-CNSTK 1164          

HSP 5 Score: 67.3958 bits (163), Expect = 1.476e-11
Identity = 52/183 (28.42%), Postives = 92/183 (50.27%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL--HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK---ILTVNSYERLQKNMKTVLKAV 1224
            D+V L+D S SI   +FE  + F+  ++S   IGP   RVGL  +SD P  EF L  H  D + +L  I+ L      T  G A+  +  +++        R  +P   +++TDG ++      E A +L+ +G  +  +G+G+  NL EL  I++      + T+ +Y+ LQ    ++++ +
Sbjct:   23 DIVFLVDGSSSIGIDNFEEVRLFLREVVSGLDIGPDKVRVGLAQYSDEPYQEFLLKDHF-DASSLLAAIERLPYRTGQTETGKAISFLLSQYFTEEAGSRARQRVPQIAVVITDGDSS--DDVEEPAQQLREQGVIVFGIGVGQA-NLGELQLIANRPAQRFLFTIENYQALQTLTSSLMQTI 201          

HSP 6 Score: 55.8398 bits (133), Expect = 6.220e-8
Identity = 55/273 (20.15%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIG-SEINKKELI-NLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQ--DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVD-RNKVLEKIKHLR 918
            D VF++D S SI   +FE  +  + ++++ +       R+    + D+    F      + + ++  ++ +    G T  GKA+         E    + R+   +  ++ TDG +++    P   A  L++  V +  +G+G + + + +LI N  +     T+ ++Q L      ++  +CV ++   ++   + ++  D+ VL+DS   IS  +F+  +  +  L ++  +G    R+GL  +    ++EF L+  + + ++L+ +K  R
Sbjct:   23 DIVFLVDGSSSIGIDNFEEVRLFLREVVSGLDIGPDKVRVGLAQYSDEPYQEFLLKDHFDASSLLAAIERLPYRTGQTETGKAISFLLSQYFTEEAGSRARQRVPQIAVVITDGDSSDDVEEP---AQQLREQGVIVFGIGVGQANLGELQLIANRPAQRFLFTIENYQALQTLTSSLMQTICVSME---DQRLALAERFADIFVLVDS--GISQTEFQQVRLLLNRLTNQLNLGASTNRLGLAQYGKVVKVEFLLNKHNTKEEILDSLKRFR 287          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Match: COL6A6 (collagen type VI alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:27023])

HSP 1 Score: 131.339 bits (329), Expect = 1.710e-32
Identity = 108/408 (26.47%), Postives = 201/408 (49.26%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEATSSCSWFKQ-DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADN--RISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ----RYVILFTDG-----TNNVFPAPYIYADHLKDASVRILTVGI-GSEINKKELINLASPNMAITVADFQKLFENLMK-IIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF----WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAV 1224
            +L  +  L++ ++ +    C   ++ D +F++D S SIS  +F+  ++ ++ M+   +TT  +N  R   +++ +D  ++F  ++FK   ++++ +  ++  +G T  GKALK   +    +    A+    + +++ TDG      N V P+     + L+   V I ++G+ G+ + + E++     +    V +F  L E L K I   +C    P+    C+ +Q DLV L+D S SI   D+++ K F   L+  F IG K  RVGL  FS   + EF L    +  +V E I  + + G  T +GLAL+ ++  F       R  GI  N++++TDG +       + A  L+  G  I ++GIG   +L+ L    +  ++ TV ++  L+   + VL  V
Sbjct:  769 ALKDLESLLALQLCDPQRDCKKTERADIIFLVDGSTSISLENFKSMQKFMLSMVN--QTTVGENLTRFGVLLYSNDPKMMFKLNQFKTRQEVLKAISGLKPPSGDTYTGKALKFCLQFFSAENGGRAELQVPQILMVITDGDATDRNNLVEPS-----EALRSKGVNIFSIGVKGANMTQLEIMAGQDKSKVFFVDNFAAL-EGLYKNISKELCNSTKPV----CEKQQADLVFLVDQSGSIQTGDYDLMKNFTTELVKSFSIGQKLVRVGLAQFSSSFQHEFYLNQFSEDTEVSEHILEMTQTGGGTNIGLALKSIREYFETSRGSRRSEGISQNLVLITDGESQ--DDVEDPADDLRALGIEIFAIGIGDVHDLELLQITGTPQRLFTVQNFGSLENIKQKVLCVV 1162          

HSP 2 Score: 117.087 bits (292), Expect = 1.184e-27
Identity = 107/381 (28.08%), Postives = 184/381 (48.29%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ-----RYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS-PNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF------WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            D  F++D S+SI  SDF+     I++ +   +      R+  + + D   L F  + + +  ++   V+ ++   G T  G+AL  T+   +    KD++      Y+++ TDG +++   +P   A+ L+   V I T+G+  E +KKEL  ++  P     V DF  L     K+I  +C        E CK    DLV L+DSS SI   D+E  K F+  +IS+  IG     VG++ FS  P+ EFDL     +  +L+ I  +++LG  T  G AL  V   F       PH +      ++++TDG      R    A  L+ +G  I ++G+    N  +L +IS S+D++ +   ++ L K+++++L    C
Sbjct:  420 DIFFLIDHSRSIYPSDFKDMINFIIEFIQTFRIGPQYVRMGVVKYADLPELEFGLETYMDAENLETAVRTIQQRGGGTETGRAL--TFMGSLFDKAKDSRGHKVPEYLVVITDGKSSDEVKSP---AEKLRSKGVTIYTIGV-KEADKKELEEISGDPKRMFFVNDFDALNPIKDKVITDIC----SADGEVCKDLSGDLVFLIDSSGSIYPQDYEKMKDFMKFVISRSFIGRNEVHVGVLQFSSSPQPEFDLRSFFSKEDMLQAINGMQQLGGGTLTGDALTAVSQYFDSALGGRPHLQQ----RLVVVTDGQAQDEVRGP--AEALREKGVKIYAIGV-VDANTTQLLEISGSHDRMYSGRDFDAL-KDLESLLALQLC 782          

HSP 3 Score: 98.2117 bits (243), Expect = 2.135e-21
Identity = 101/399 (25.31%), Postives = 189/399 (47.37%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNR----ISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLT--YENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLA-SPNMAITVADFQKL--FENLMKIIHHVCVIVDPIPNEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHG-----IPFNILILTDG----YNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSND--KILTVNSYERLQKNMKTVLKAVTCG*TK 1242
            C     D VF++D+S SI   D+E  K      M F+ + +   R    +  + F       F+   F +  DM++ +  ++   G T  G AL     Y +     R   Q+ +++ TDG   +    P   A+ L++  V+I  +G+  + N  +L+ ++ S +   +  DF  L   E+L+ +   +C      P   C K E+ D++ L+D S SIS  +F+  ++F+  ++++  +G   TR G++ +S+ P++ F L     R +VL+ I  L+     T  G AL+    +F+     G     +P  ++++TDG     NN+     E +  L+ +G NI S+G+ +  N+ +L  ++  D  K+  V+++  L+   K + K + C  TK
Sbjct:  602 CKDLSGDLVFLIDSSGSIYPQDYEKMK----DFMKFVISRSFIGRNEVHVGVLQFSSSPQPEFDLRSFFSKEDMLQAINGMQQLGGGTLTGDALTAVSQYFDSALGGRPHLQQRLVVVTDGQAQDEVRGP---AEALREKGVKIYAIGV-VDANTTQLLEISGSHDRMYSGRDFDALKDLESLLAL--QLC-----DPQRDCKKTERADIIFLVDGSTSISLENFKSMQKFMLSMVNQTTVGENLTRFGVLLYSNDPKMMFKLNQFKTRQEVLKAISGLKPPSGDTYTGKALK-FCLQFFSAENGGRAELQVPQILMVITDGDATDRNNLV----EPSEALRSKGVNIFSIGV-KGANMTQLEIMAGQDKSKVFFVDNFAALEGLYKNISKEL-CNSTK 978          

HSP 4 Score: 93.2041 bits (230), Expect = 9.153e-20
Identity = 91/378 (24.07%), Postives = 173/378 (45.77%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTY-----ENLVPQMRKDAQRYVILFTDG-TNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKIIHHVC--VIVDPIP--------NEPC-KVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLH-LVDRNKVLEKIKHLRKLGSATGLGLALREVQFKF---WPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDK-ILTVNSYERL 1191
            D VF++D S SI   +FE  +  + ++++ +       R+    + D+    F      + + ++  ++ +    G T  GKA+         E    + R+   +  ++ TDG +++    P   A  L++  V +  +      N+ ELI +AS         V  F +L    +K+   +C  +I   +          E C + E+ D+  L+D S+SI   DF+    F+   I  F+IGP+  R+G+V ++D P +EF L   +D   +   ++ +++ G  T  G AL  +   F      R H +P  ++++TDG ++        A KL+ +G  I ++G+ +  + KEL +IS + K +  VN ++ L
Sbjct:  217 DIVFLVDGSSSIGIDNFEEVRLFLREVVSGLDIGPDKVRVGLAQYSDEPYQEFLLKDHFDASSLLAAIERLPYRTGQTETGKAISFLLSQYFTEEAGSRARQRVPQIAVVITDGDSSDDVEEP---AQQLREQGVIVFGIA-----NETELIQIASHPPKEHVFIVKSFAELTPLKVKLQKVLCYNIIRQAVTVAGRSSAIKEGCLQTEEADIFFLIDHSRSIYPSDFKDMINFIIEFIQTFRIGPQYVRMGVVKYADLPELEFGLETYMDAENLETAVRTIQQRGGGTETGRALTFMGSLFDKAKDSRGHKVPEYLVVITDGKSS--DEVKSPAEKLRSKGVTIYTIGV-KEADKKELEEISGDPKRMFFVNDFDAL 583          

HSP 5 Score: 76.6406 bits (187), Expect = 1.963e-14
Identity = 96/382 (25.13%), Postives = 163/382 (42.67%), Query Frame = 1
Query:  127 KQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALK-LTYENLVPQMRKDAQRYV----ILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPI--PNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL--HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHR-----RHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            K D VF++D S SI   +F+  +  +  +++    +    RI    + DD+   F    F+N  D+++ +  +    G T  GK L  L  E+ V      A   V    ++ TDG +         A+ LK   + +  +GI + I   +L  +A      TV+DF    +   + +  V      +    E       D+V L+D S SI   +FE  + F+  ++S   IGP   RVGL  +SD P  EF L  H  D + +L  I+ L      T  G A+  +  +++        R  +P   +++TDG ++      E A +L+ +G  +I  GI     L ++      + +  V S+  L   +K  L+ V C
Sbjct:   20 KADIVFLVDGSWSIGRPNFQQVRHFLSTLVSSFDVSPDHVRIGLAQYSDDSRTEFLLRTFQNNRDVLQYIARLPYKGGGTMTGKGLDFLLQEHFVEAAGSRASSGVTQIAVVITDGKSQ--DEVKSQAEKLKQRGIILYAIGIKNAI-LTQLKEIADEQNIYTVSDFSAPSQGTDRFLFVVSGSDSYLFFSAECAMATVADIVFLVDGSSSIGIDNFEEVRLFLREVVSGLDIGPDKVRVGLAQYSDEPYQEFLLKDHF-DASSLLAAIERLPYRTGQTETGKAISFLLSQYFTEEAGSRARQRVPQIAVVITDGDSS--DDVEEPAQQLREQG--VIVFGIANETELIQIASHPPKEHVFIVKSFAELTP-LKVKLQKVLC 392          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Match: MATN2 (matrilin 2 [Source:NCBI gene;Acc:101164835])

HSP 1 Score: 107.071 bits (266), Expect = 7.392e-25
Identity = 99/411 (24.09%), Postives = 178/411 (43.31%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ------MRKDAQRYVILFTDGTNNVFPAPYI--YADHLKDASVRILTVGIGSEINKKELINLAS-------------PNMAITVADFQ-KLFENLMKIIHHVC--------------------VIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN---ILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK 1197
            A + C     D VF++D+S+SI S+D+E  K  I+ ++ F+   +   R+  + +G      F+ + + +  ++ + VKN+ +    T  G A++ T E    +      +     R  ++ TDG     P   +   A   + A ++I  +G+G  ++ K L  + S               +   ++ FQ KL  ++ + + H C                    +  D    + C     DLV ++D SKS+   +FE+ K+FV  ++    I    T VGL+ +S   R EF L   V  + + + +  ++ +G  +  G ALR +    +  R  G P      ++ TDG +       E ASK K  G  I +LGIG+ I  +EL +I+S    + +   E  +K
Sbjct:   38 AENPCKAIPLDFVFVIDSSRSIRSNDYEKVKTFIINLLQFLDIGHDATRVGLLQYGSVVQPEFSLNTYGSRAEVEQAVKNMEHLATGTMTGLAIQYTMETAFTEDHGARPLNMHIPRIAMIVTDGR----PQDTVKEVAAEARKAGIQIFAIGVG-RVDMKILKTIGSEPHSEHVHLVANFSQIESLISVFQSKLCVDVCQTLEHGCEHQCVANGSSYMCKCFEGFILAEDKRSCKKCHDGVMDLVFVIDGSKSLGPANFELVKQFVNSIVDSLDISRTGTHVGLIQYSTKVRTEFTLGQYVTGDSIKQAVGRMQYMGRGSRTGSALRHMFESSFSSREGGRPNTQQVTIVFTDGRSQ--DDVSEWASKAKSSGITIYALGIGKAIE-QELREIASEPNEMYLYYAESFEK 440          

HSP 2 Score: 78.5666 bits (192), Expect = 2.426e-15
Identity = 53/171 (30.99%), Postives = 88/171 (51.46%), Query Frame = 1
Query:  673 IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNI------LILTDGYNNVFPRPH----EIASKLKREGANIISLGIGRHINLKELTDISS 1152
            +   PCK    D V ++DSS+SI   D+E  K F+ +L+    IG  ATRVGL+ +    + EF L+    R +V + +K++  L + T  GLA++      +       P N+      +I+TDG      RP     E+A++ ++ G  I ++G+GR +++K L  I S
Sbjct:   37 VAENPCKAIPLDFVFVIDSSRSIRSNDYEKVKTFIINLLQFLDIGHDATRVGLLQYGSVVQPEFSLNTYGSRAEVEQAVKNMEHLATGTMTGLAIQYTMETAFTEDHGARPLNMHIPRIAMIVTDG------RPQDTVKEVAAEARKAGIQIFAIGVGR-VDMKILKTIGS 200          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Match: MATN2 (matrilin 2 [Source:NCBI gene;Acc:101164835])

HSP 1 Score: 107.071 bits (266), Expect = 8.496e-25
Identity = 107/440 (24.32%), Postives = 190/440 (43.18%), Query Frame = 1
Query:  103 ATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQ------MRKDAQRYVILFTDGTNNVFPAPYI--YADHLKDASVRILTVGIGSEINKKELINLAS---PNMAITVADFQKLFENLMKI---------------IH---HVCVIV----------------DPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFN---ILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK--NMKTVLKAVTCG*TKFMNRIETTV 1269
            A + C     D VF++D+S+SI S+D+E  K  I+ ++ F+   +   R+  + +G      F+ + + +  ++ + VKN+ +    T  G A++ T E    +      +     R  ++ TDG     P   +   A   + A ++I  +G+G  ++ K L  + S         VA+F ++ E+L+ +               IH   H C+ +                D      C     DLV ++D SKS+   +FE+ K+FV  ++    I    T VGL+ +S   R EF L   V  + + + +  ++ +G  +  G ALR +    +  R  G P      ++ TDG +       E ASK K  G  I +LGIG+ I  +EL +I+S    + +   E  +K   +   LK+  C   + M + E  +
Sbjct:   18 AENPCKAIPLDFVFVIDSSRSIRSNDYEKVKTFIINLLQFLDIGHDATRVGLLQYGSVVQPEFSLNTYGSRAEVEQAVKNMEHLATGTMTGLAIQYTMETAFTEDHGARPLNMHIPRIAMIVTDGR----PQDTVKEVAAEARKAGIQIFAIGVG-RVDMKILKTIGSEPHSEHVHLVANFSQI-ESLISVFQSKLCGGIDYCDLGIHGCEHSCISLPESFVCRCMKGYSLNLDGKTCSKCHDGVMDLVFVIDGSKSLGPANFELVKQFVNSIVDSLDISRTGTHVGLIQYSTKVRTEFTLGQYVTGDSIKQAVGRMQYMGRGSRTGSALRHMFESSFSSREGGRPNTQQVTIVFTDGRSQ--DDVSEWASKAKSSGITIYALGIGKAIE-QELREIASEPNEMYLYYAESFEKMGEITQKLKSRMCKADESMCQCENMI 448          

HSP 2 Score: 80.1073 bits (196), Expect = 6.969e-16
Identity = 57/201 (28.36%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  673 IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLV-DRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNI------LILTDGYNNVFPRPH----EIASKLKREGANIISLGIGRHINLKELTDISS---NDKILTVNSYERLQKNMKTVLKAVTCG 1233
            +   PCK    D V ++DSS+SI   D+E  K F+ +L+    IG  ATRVGL+ +    + EF L+    R +V + +K++  L + T  GLA++      +       P N+      +I+TDG      RP     E+A++ ++ G  I ++G+GR +++K L  I S   ++ +  V ++ +++ ++ +V ++  CG
Sbjct:   17 VAENPCKAIPLDFVFVIDSSRSIRSNDYEKVKTFIINLLQFLDIGHDATRVGLLQYGSVVQPEFSLNTYGSRAEVEQAVKNMEHLATGTMTGLAIQYTMETAFTEDHGARPLNMHIPRIAMIVTDG------RPQDTVKEVAAEARKAGIQIFAIGVGR-VDMKILKTIGSEPHSEHVHLVANFSQIE-SLISVFQSKLCG 209          
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Match: vwa2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101156854])

HSP 1 Score: 92.8189 bits (229), Expect = 9.240e-20
Identity = 96/387 (24.81%), Postives = 174/387 (44.96%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKF-KNLNDMVRQVKNVRNDNGATAIGKALK-LTYENLV-----PQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASV-----RILTVGIGSEINKKELINL-ASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK-VLEKIKHLRKLGSATGLGLALREVQ---FKFWPHRRHGIPFNILILTDGYNN---VFPRPHEIASKLKREGANIISLGIGRHINLKELTDIS-SNDKILTVNSYERLQKNMKTVLKAVTC 1230
            D +F+L+ S S++   F   K  + + +  +  +++ +++   VFG +  L     KF +NL   +R V  +++  G T  G+AL+  T    V       +  D  R V+L T       PA    AD + +AS       I  +G+G +  K +L N+  +P   +T +   +L E L ++   +C     +  + C  +  DLV  +D+S ++   +F + + FV  +  +F I     +V LV++S      F L   +    VL+ +     +G     G AL  +           R G+   +++LTDG      V P     A K++  G ++  +G+G  +  ++L  I+ S D +++V SYE L K  + VL  + C
Sbjct:  409 DLLFLLEGSSSLTLEGFLRFKSFLKRFLQTVIGSDSPSKVGLAVFGAETRLEVQVGKFRRNLGGFLRAVDALQSPGGQTLTGQALRHATRHGFVSAPAFADVTDDLPRVVVLLTAN-----PA----ADEVIEASKYARDREIFLIGVGPDFLKGQLNNMTGNPQRTLTYSSPDRLSEKLPELKAKIC----SVDTQGCLGQAVDLVFALDASAAVGRENFAVLRDFVRSITVQFDINRDVAQVALVAYSRKASTVFRLDAHETGSVVLKAVGDASYMGGVASSGAALLHIYSNVLTVANGARPGVNKAVVVLTDGSGGEDAVVP-----AQKIRDSGVSVFIVGVGA-VQREKLARIAGSEDHMISVPSYEEL-KYFEDVLVQMLC 775          

HSP 2 Score: 73.1738 bits (178), Expect = 1.657e-13
Identity = 56/179 (31.28%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  706 DLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKL---GSATGLGLALREVQFKFWPHRRH--GIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVT 1227
            D++ LMDSS S+    FE  K F   L     IGP   RVGL+ F   PR+EF L      + L+  KH++K+   G  T  GLAL+ +  K +P  R+   +P   ++L+DG +       + A++LK  G  + ++G+ R+   +EL  ++S      V   E  Q  +  V   +T
Sbjct:  117 DILFLMDSSYSMGKGSFERSKHFAVKLSQALDIGPDKVRVGLIQFGSVPRLEFSLDSFSNKQELK--KHMKKISFRGGGTQTGLALKYILRKGFPGGRNSSSVPRIAILLSDGRSQ--GSVAQTAAELKETGMVLFAVGL-RYPKWEELHALASEPIESHVFFAEHFQDAVNGVFTTLT 290          

HSP 3 Score: 58.5362 bits (140), Expect = 9.075e-9
Identity = 39/138 (28.26%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ--RYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGI 540
            D +F++D+S S+    FE +K   VK+   +       R+  I FG    L F+ D F N  ++ + +K +    G T  G ALK       P  R  +   R  IL +DG +    A    A  LK+  + +  VG+
Sbjct:  117 DILFLMDSSYSMGKGSFERSKHFAVKLSQALDIGPDKVRVGLIQFGSVPRLEFSLDSFSNKQELKKHMKKISFRGGGTQTGLALKYILRKGFPGGRNSSSVPRIAILLSDGRSQGSVAQ--TAAELKETGMVLFAVGL 252          
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Match: SMESG000046770.1 (SMESG000046770.1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 337/341 (98.83%), Postives = 338/341 (99.12%), Query Frame = 1
Query:  211 MMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG 1233
            MMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKF+IGPKATRVGLVSFSDHPRIEFDLHLVDRNK   KIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG
Sbjct:    1 MMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFKIGPKATRVGLVSFSDHPRIEFDLHLVDRNK---KIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG 338          

HSP 2 Score: 103.219 bits (256), Expect = 2.159e-24
Identity = 57/180 (31.67%), Postives = 98/180 (54.44%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHV 654
            C   +QD V ++D+S+SIS  DFE+ KR +  +++  K      R+  + F D   + F+     +L D  +++K++R    AT +G AL+       P  R      +++ TDG NNVFP P+  A  LK     I+++GIG  IN KEL +++S +  +TV  +++L +N+  ++  V
Sbjct:  160 CKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFKIGPKATRVGLVSFSDHPRIEFDL----HLVDRNKKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAV 335          
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Match: SMESG000024982.1 (SMESG000024982.1)

HSP 1 Score: 414.075 bits (1063), Expect = 7.992e-143
Identity = 202/384 (52.60%), Postives = 270/384 (70.31%), Query Frame = 1
Query:   91 KVYEATSSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNK---VLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG 1233
            ++   T++C++  +D +FILD SQSIS  DFELAK+    MMT IK +N +NRI+FI FGDDA ++F F  +  L +M+  V N RN   +T IGKAL LT + + P MRK+ ++ V+LFTDGTNN++PAPY+YAD LK+A+V+ILT+GIGS+IN  EL  LASP +++ V  F  L +   +++ H+C I DP   +PC +EQQDLVV++DSS SIS  D+E GK F+   +S F++GP+  RV ++SFSD   I FD    D  K   ++ K+K L K G ATG+G ALREV  K    +R  +PFNILI+TDG NN+FPRP E A++LK +GANIISLGIG  INLKEL  ISS DKILTV +Y  L+K++KTV+K V CG
Sbjct:   27 QITSLTAACTFIIRDVLFILDGSQSISKDDFELAKKFTKDMMTIIKNSNTENRIAFIKFGDDAEIVFEFQTYTKLKEMLLDVTNTRNLYSSTGIGKALNLTLKEVYPTMRKEVEKLVVLFTDGTNNMYPAPYVYADKLKEANVQILTIGIGSDININELTRLASPGLSLQVESFTGLLKTQSQVVSHICPIPDPGLEKPCTLEQQDLVVILDSSNSISEEDYEQGKNFLVKFLSNFELGPEKNRVAMLSFSDE--IRFDFGFTDYYKSDDMINKVKSLIKFGGATGIGKALREVDSKLISQQRPNVPFNILIITDGVNNMFPRPLEYANRLKMKGANIISLGIGEEINLKELKMISSEDKILTVETYGDLKKSLKTVMKTVICG 408          
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Match: SMESG000046768.1 (SMESG000046768.1)

HSP 1 Score: 122.865 bits (307), Expect = 8.097e-30
Identity = 103/392 (26.28%), Postives = 183/392 (46.68%), Query Frame = 1
Query:   58 SLPAISYLVSWKVYEAT--SSCSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPR----IEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK-NMKTV 1212
            SL   S  VS K   A    +CS    D VF++D S   ++  ++  + +++  +  +  +   +RIS I + D+ T  F  D+     D+   +K +R++     +  AL    +      R D  + V+LFTD            A+ LK   V+I+ VG+          NLAS   +I + +  K+ +N  +I + +C       +E C +++ D++V +D S S+   +F+I   FV  ++    +    TR+G+ +F+        I+ +    D  K + KI  +      T +G A+       +   R  +P  +++LTDG N++   P   A K K  G  IIS+G+G+ I+ KEL DI+S+ +   V ++  L+K N KT+
Sbjct:  665 SLLEKSVKVSCKTTPAIKPQTCSS-NGDIVFVVDKSTDNTNEIWDGIRSLMLTTLQSLNISRTTSRISIIDYSDETTTEFRLDEAFTKRDIYVAIKQLRSNGNGGDLNTALNRARQVFKIDYRADVAKIVVLFTDKLPTNQKDSLSEAEILKGDGVKIIFVGLSKNSPYNFYENLASKKSSIKIENINKIDKNKEQIKNMICDAFKQRQDE-CTMKKLDVIVTIDKSTSLGPENFQIELDFVNRIVQNLDLRKDRTRIGIFTFNSEVYLNVPIDSNFENADMQKEINKIPFIE---GNTAIGWAIGNATDYLFTKGREDVPKVLVVLTDGANDIGESPQISAVKAKLGGIKIISVGVGQQISEKELNDIASSGEFYNVKTFTDLEKFNAKTI 1051          

HSP 2 Score: 107.842 bits (268), Expect = 8.728e-25
Identity = 99/395 (25.06%), Postives = 190/395 (48.10%), Query Frame = 1
Query:    4 YTIYYS*VNKSKIIVKLASLPAISYLVSWKVYEATSS----CSWFKQDTVFILDASQSISSS-DFELA--KRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPA--PYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQK--LFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISS 1152
            YT   S + K+ +     S+P  +   +   Y   S+    C+  + D +F+LDAS S++   D ELA    VI  +   IK +    ++  +++ D   +       +N  ++ + V  +    GAT I  AL+ + E  + + R+ A++ VIL TDG +N  P   P + A+ LK   +R++ +G+G  + K +L  ++S      + D  K  LF+    +    C I  P P   C   + D+ +++D S  +   ++     F    I +F++G   TR  LVSF++   +E +  H+ D   +L+K++ L+ +G  T +  AL      F+   ++     +++LT+G +    +  + A  L+  G +I+++G+G   + +EL  +S+
Sbjct:  268 YTSQSSSIQKTSVKQTTKSIPVETKRTTTSNYIEISTPDQNCNNQQLDLIFVLDASSSLALYWDQELAFTNNVIKSLQIDIKFS----QVGVLIYSDILEMSLPLGSKQNKTEIQKFVSKLELLEGATFISNALRRSGEEFISKGREGAKKTVILVTDGADNS-PTMKPEVEAEKLKKMGIRVIVIGLGLSVIKDQLNKMSSTETYYPIEDMSKMALFDT-TDLAQDACQI--PKPKRICSA-KLDIALIVDCSSQVQLHEWVNQLLFAKRFIEQFELGINKTRFSLVSFANEAVVEEEFTHIYD--DILKKVESLKHVGGFTRIDKALNIASRSFYLKSKNSKRL-VVLLTNGLSMERVQTIQAAYDLQESGVDIVTIGLGDKADREELKILST 650          

HSP 3 Score: 106.301 bits (264), Expect = 2.793e-24
Identity = 91/365 (24.93%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDK-FKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFE-NLMKIIHHVCVIVDPIPNEP--CKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQK 1197
            C+  K D +  +D S S+   +F++    + +++  +       RI    F  +  L    D  F+N  DM +++  +    G TAIG A+    + L  + R+D  + +++ TDG N++  +P I A   K   ++I++VG+G +I++KEL ++AS      V  F  L + N   I +  C     IP +P  CK    DL+ +M SS + +   F+    F+  L     +  + TRV ++ F+    I+      D       I+ +    +   +G AL   +  F    R      ++I+ DG         E A+ LK++G  + ++G+    +  +L  ++S DK L V+++  LQ+
Sbjct:  875 CTMKKLDVIVTIDKSTSLGPENFQIELDFVNRIVQNLDLRKDRTRIGIFTFNSEVYLNVPIDSNFENA-DMQKEINKIPFIEGNTAIGWAIGNATDYLFTKGREDVPKVLVVLTDGANDIGESPQISAVKAKLGGIKIISVGVGQQISEKELNDIASSGEFYNVKTFTDLEKFNAKTISNDAC----QIPQKPTICKA-AGDLIFVMGSSANKTSERFKQMSDFMKSLTKLTVVDKENTRVAILKFNRGNYIDSGFK-EDYKNFESSIEDMTTSTNGVFIGKALTSARVLFKSDTRKNATKTVIIIIDGEITDRNETFEEANLLKKDGIKVFTIGLTGKTSESDLKSVASPDKALFVDNFSNLQR 1232          

HSP 4 Score: 99.7525 bits (247), Expect = 4.756e-22
Identity = 79/319 (24.76%), Postives = 149/319 (46.71%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNF-DKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDF-EIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKR 1080
            D +F++ +S + +S  F+     +  +         + R++ + F     +   F + +KN    +  +    N      IGKAL           RK+A + VI+  DG        +  A+ LK   +++ T+G+  + ++ +L ++ASP+ A+ V +F  L      I   +C ++    N+ C  +Q DL+  +DSS SI GPD+ +    FV  ++    I    T+VG+V+F+   R EF L    ++  ++  +K +     AT +G ALRE + +     R  +P  I+++TDG +     P   ++ +K+
Sbjct: 1070 DLIFVMGSSANKTSERFKQMSDFMKSLTKLTVVDKENTRVAILKFNRGNYIDSGFKEDYKNFESSIEDMTTSTN---GVFIGKALTSARVLFKSDTRKNATKTVIIIIDGEITDRNETFEEANLLKKDGIKVFTIGLTGKTSESDLKSVASPDKALFVDNFSNLQRYNAYISSELCDVIKG-TNKECSTKQLDLMFALDSSSSI-GPDYWQTELDFVERIVRDMDINANFTKVGVVTFNTDARKEFGLDQFTEKYAMISAVKRIIFDDGATDIGEALRECKNELLNSTRKEVPKVIVLVTDGVSTGGLSPELESTLIKK 1383          

HSP 5 Score: 75.485 bits (184), Expect = 2.625e-14
Identity = 85/377 (22.55%), Postives = 166/377 (44.03%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFE----LAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            CS  K D   I+D S  +   ++      AKR I +    I  T    R S + F ++A +   F      +D++++V+++++  G T I KAL +   +   +  K+++R V+L T+G +         A  L+++ V I+T+G+G + +++EL  L++        DF++    L K +   C     I  + C     D+V ++D S   +   ++  +  +   +    I    +R+ ++ +SD    EF L     +  +   IK LR  G+   L  AL   +  F    R  +   +++ TD            A  LK +G  II +G+ ++       +++S    + + +  ++ KN K  +K + C
Sbjct:  499 CSA-KLDIALIVDCSSQVQLHEWVNQLLFAKRFIEQFELGINKT----RFSLVSFANEAVVEEEFTHI--YDDILKKVESLKHVGGFTRIDKALNIASRSFYLK-SKNSKRLVVLLTNGLSMERVQTIQAAYDLQESGVDIVTIGLGDKADREELKILSTFPNPFLRQDFKEEKSLLEKSVKVSCKTTPAIKPQTCS-SNGDIVFVVDKSTDNTNEIWDGIRSLMLTTLQSLNISRTTSRISIIDYSDETTTEFRLDEAFTKRDIYVAIKQLRSNGNGGDLNTALNRARQVFKIDYRADVAKIVVLFTDKLPTNQKDSLSEAEILKGDGVKIIFVGLSKNSPYNFYENLASKKSSIKIENINKIDKN-KEQIKNMIC 865          

HSP 6 Score: 74.7146 bits (182), Expect = 5.571e-14
Identity = 52/188 (27.66%), Postives = 99/188 (52.66%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKN---LNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQ--RYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVI 663
            C    +D   ILD+S SI++ +F+ +   I + ++F      + R+SF+ +GD     F F K  +   LN  VR  + V  D  ++ +G+AL  T  ++VP+MR  ++  R +++ +DG+N    +    A  +++  V I TV IGS +N   L++++S    +   +FQ +  +   ++  +CV+
Sbjct:   26 CIGKPRDIAVILDSSSSITNGEFQSSLIAINQFLSFFLIMPNNTRVSFMGYGDTLKTEFLFTKHTSSPTLNFAVRLHRKVGGD--SSVLGRALNSTLYDIVPEMRPTSEIDRILLILSDGSNTDELSVKDLATKIQEKGVTIYTVAIGSNLNIPLLLSISSKKNVVMFPEFQTMRGDSENLVSVICVV 211          

HSP 7 Score: 66.6254 bits (161), Expect = 1.982e-11
Identity = 48/188 (25.53%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  679 NEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLE-KIKHLRKLGSATG-LGLALREVQFKFWPHRRHGIPFN--ILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            ++ C  + +D+ V++DSS SI+  +F+     +   +S F I P  TRV  + + D  + EF       +  L   ++  RK+G  +  LG AL    +   P  R     +  +LIL+DG N       ++A+K++ +G  I ++ IG ++N+  L  ISS   ++    ++ ++ + + ++ +V C
Sbjct:   23 DQRCIGKPRDIAVILDSSSSITNGEFQSSLIAINQFLSFFLIMPNNTRVSFMGYGDTLKTEFLFTKHTSSPTLNFAVRLHRKVGGDSSVLGRALNSTLYDIVPEMRPTSEIDRILLILSDGSNTDELSVKDLATKIQEKGVTIYTVAIGSNLNIPLLLSISSKKNVVMFPEFQTMRGDSENLV-SVIC 209          

HSP 8 Score: 63.1586 bits (152), Expect = 2.810e-10
Identity = 47/164 (28.66%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  676 PNEPCKVEQQDLVVLMDSSKSISGP-DFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEK-IKHLRKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNV-FPRPHEIASKLKREGANIISLGIGRHINLKELTDISSND 1158
            P++ C  +Q DL+ ++D+S S++   D E+   F  ++I   QI  K ++VG++ +SD   +   L        ++K +  L  L  AT +  ALR    +F    R G    ++++TDG +N    +P   A KLK+ G  +I +G+G  +   +L  +SS +
Sbjct:  305 PDQNCNNQQLDLIFVLDASSSLALYWDQELA--FTNNVIKSLQIDIKFSQVGVLIYSDILEMSLPLGSKQNKTEIQKFVSKLELLEGATFISNALRRSGEEFISKGREGAKKTVILVTDGADNSPTMKPEVEAEKLKKMGIRVIVIGLGLSVIKDQLNKMSSTE 466          

HSP 9 Score: 59.3066 bits (142), Expect = 4.195e-9
Identity = 49/174 (28.16%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSIS----SSDFELAKRVIVKMMTFIKTTNAD-NRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKL 621
            CS  + D +F LD+S SI      ++ +  +R++  M       NA+  ++  + F  DA   F  D+F     M+  VK +  D+GAT IG+AL+     L+   RK+  + ++L TDG +    +P + +  +K   ++I+ +GIG   +  +L  L+S      + DF+ L
Sbjct: 1252 CSTKQLDLMFALDSSSSIGPDYWQTELDFVERIVRDM-----DINANFTKVGVVTFNTDARKEFGLDQFTEKYAMISAVKRIIFDDGATDIGEALRECKNELLNSTRKEVPKVIVLVTDGVSTGGLSPELESTLIKKLGIKIIVIGIGDSTSPSQLKILSSSGTFYRILDFKTL 1420          
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Match: SMESG000043380.1 (SMESG000043380.1)

HSP 1 Score: 113.62 bits (283), Expect = 7.258e-27
Identity = 92/358 (25.70%), Postives = 174/358 (48.60%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLR-------KLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKIL 1167
            CS  + +   +LDAS SI    F+LAK+ IV ++         +R   I F DDA L+F     K + +  + + + +   GATA+GKA++L    ++ + R    + ++L TDG NN FP         K+A V I+ +GIGSEI+ +EL  +ASP +   +  +  L   +  +    C  ++ I  + C+ E  D+  +++S +  +G   +     + H++++ +I     RV +V       +E +  LV  NK   + ++ +       K+GS    GL       +     R  IP  ++++    +  F    + A  L+ +GAN++++ IG ++++ +L ++S+  K +
Sbjct:   31 CSKNRIEMAIVLDASSSIEPDHFKLAKQFIVDVIGDFVVGPDHSRFGMISFSDDAELLFTLTTHKTIEETKKAILDAKFLTGATAMGKAIQLAGTGILQESRTGIPKVILLITDGKNNKFPNAAQMGKLQKEAGVTIIGIGIGSEISPQELTEIASPGLYYQLDTYPSLIGLVKTLKTSFCKKLENIQIDTCETE-GDISFVIESQQK-AGDLHKKQIELITHVLNRLEISEGKQRVAIV-------VENEGILVPLNKFSSRSEYTQYLKKGDFKVGSKISSGLV---ESGRLLAENRTDIPKLVVLMRTQKSENFENDVKAALALRNQGANVLTVAIGLNVDVSQLNELSTTRKTV 376          

HSP 2 Score: 90.5077 bits (223), Expect = 2.680e-19
Identity = 51/194 (26.29%), Postives = 100/194 (51.55%), Query Frame = 1
Query:  115 CSWFKQDTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFE-NLMKIIHHVCVIVDPIPNEPCK 693
            C   K D VF+LD S SI   ++    + + +++  +       R+  + F  +A + F+ DK+   +++++ ++N+    G TAIG AL L ++ +   +R +    +IL TDG +N+   P   A  +++  V I+ +GI +EI+K +LI +++ N    + DF  L   ++  +    C  V+  P + C+
Sbjct:  406 CIAKKLDVVFVLDCSSSIGPENWMNQLQFVSRIVQMMDVGKDSTRVGSVYFNSEAYVGFSLDKYGTKDEVIKAIRNLPFSEGGTAIGDALNLAHDQMKASLRNNTVPVMILVTDGQSNMGRKPESEALEIRNDGVHIICIGITNEISKDQLIRISTSNRYYHINDFDSLNSVSVEAMTKESCQAVNNKPKKSCR 599          

HSP 3 Score: 90.1225 bits (222), Expect = 4.139e-19
Identity = 69/266 (25.94%), Postives = 134/266 (50.38%), Query Frame = 1
Query:  403 LVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCVIVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDL-HLVDRNKVLEKIKHL--RKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERL 1191
            L+ + R D  + V+L     +  F      A  L++    +LTV IG  ++  +L  L++    +   DF      + +I  ++C  +  +  E C  ++ D+V ++D S SI   ++    +FV+ ++    +G  +TRVG V F+    + F L     +++V++ I++L   + G+A G  L L   Q K    R + +P  IL+ TDG +N+  +P   A +++ +G +II +GI   I+  +L  IS++++   +N ++ L
Sbjct:  312 LLAENRTDIPKLVVLMRTQKSENFENDVKAALALRNQGANVLTVAIGLNVDVSQLNELSTTRKTVIFKDFNFQVSFVNEIAENICQNLKKVYVE-CIAKKLDVVFVLDCSSSIGPENWMNQLQFVSRIVQMMDVGKDSTRVGSVYFNSEAYVGFSLDKYGTKDEVIKAIRNLPFSEGGTAIGDALNLAHDQMK-ASLRNNTVPVMILV-TDGQSNMGRKPESEALEIRNDGVHIICIGITNEISKDQLIRISTSNRYYHINDFDSL 574          

HSP 4 Score: 87.4261 bits (215), Expect = 3.309e-18
Identity = 62/190 (32.63%), Postives = 100/190 (52.63%), Query Frame = 1
Query:  673 IPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGPKATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHL----RKLGSATGLGLALREVQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGIGRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTC 1230
            + N  C   + ++ +++D+S SI    F++ K+F+  +I  F +GP  +R G++SFSD   + F L     +K +E+ K      + L  AT +G A++          R GIP  IL++TDG NN FP   ++    K  G  II +GIG  I+ +ELT+I+S      +++Y  L   +KT LK   C
Sbjct:   26 VDNYDCSKNRIEMAIVLDASSSIEPDHFKLAKQFIVDVIGDFVVGPDHSRFGMISFSDDAELLFTLT---THKTIEETKKAILDAKFLTGATAMGKAIQLAGTGILQESRTGIPKVILLITDGKNNKFPNAAQMGKLQKEAGVTIIGIGIGSEISPQELTEIASPGLYYQLDTYPSLIGLVKT-LKTSFC 211          
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Match: SMESG000033673.1 (SMESG000033673.1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.073e-17
Identity = 44/175 (25.14%), Postives = 83/175 (47.43%), Query Frame = 1
Query:  133 DTVFILDASQSISSSDFELAKRVIVKMMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNGATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKDASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVC 657
            + +FILD S S+   +F   K    +++  +   N   R++ I +     L+FN DK+ N  D+ R++       G T +G AL +   ++  + R+   + +IL +DG  N    P + A  LK  S  ++T+G+  E ++  +I ++       + DF  L + +  I+   C
Sbjct:   47 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 221          
The following BLAST results are available for this feature:
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL6A61.850e-2826.67collagen type VI alpha 6 chain [Source:HGNC Symbol... [more]
COL6A54.241e-2225.20collagen type VI alpha 5 chain [Source:HGNC Symbol... [more]
COL6A54.521e-2225.20collagen type VI alpha 5 chain [Source:HGNC Symbol... [more]
VWA21.632e-1924.12von Willebrand factor A domain containing 2 [Sourc... [more]
VWA25.137e-1924.12von Willebrand factor A domain containing 2 [Sourc... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cutl-235.247e-1825.27CUTiclin-Like [Source:UniProtKB/TrEMBL;Acc:A0A168... [more]
mup-42.463e-1630.54Transmembrane matrix receptor MUP-4 [Source:UniPr... [more]
dig-18.039e-1520.64Mesocentin [Source:UniProtKB/Swiss-Prot;Acc:Q0916... [more]
dig-18.039e-1520.64Mesocentin [Source:UniProtKB/Swiss-Prot;Acc:Q0916... [more]
mua-33.698e-1431.25Transmembrane cell adhesion receptor mua-3 [Sourc... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col6a4a9.604e-2325.00collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-G... [more]
col6a4a1.460e-2224.93collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-G... [more]
si:ch211-62a1.31.853e-2123.31si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-4... [more]
col6a34.305e-1725.25collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GE... [more]
VIT5.472e-1622.86si:ch1073-291c23.1 [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000014315.19.703e-2626.68collagen type VI alpha 5 chain [Source:NCBI gene;A... [more]
ENSXETT00000014273.11.038e-2526.68collagen type VI alpha 5 chain [Source:NCBI gene;A... [more]
ENSXETT00000014204.11.064e-2526.68collagen type VI alpha 5 chain [Source:NCBI gene;A... [more]
VWA29.799e-2122.63von Willebrand factor A domain containing 2 [Sourc... [more]
VWA21.018e-2022.63von Willebrand factor A domain containing 2 [Sourc... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col6a64.014e-3027.01collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:... [more]
Col6a61.887e-2927.01collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:... [more]
Col6a61.995e-2927.01collagen, type VI, alpha 6 [Source:MGI Symbol;Acc:... [more]
Col6a41.962e-2727.30collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:... [more]
Vwa21.074e-2323.91von Willebrand factor A domain containing 2 [Sourc... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C6K9|CO6A6_MOUSE1.395e-2827.01Collagen alpha-6(VI) chain OS=Mus musculus OX=1009... [more]
sp|A6NMZ7|CO6A6_HUMAN8.882e-2826.67Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606... [more]
sp|A2AX52|CO6A4_MOUSE1.372e-2627.30Collagen alpha-4(VI) chain OS=Mus musculus OX=1009... [more]
sp|P15989|CO6A3_CHICK1.926e-2325.91Collagen alpha-3(VI) chain OS=Gallus gallus OX=903... [more]
sp|Q70UZ7|VWA2_MOUSE7.514e-2323.91von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401PF962.092e-3529.14Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A210PQ581.131e-3228.86Collagen alpha-6(VI) chain OS=Mizuhopecten yessoen... [more]
A0A3Q1HZ411.097e-3127.90Collagen type VI alpha 6 chain OS=Acanthochromis p... [more]
A0A4W3GCD42.985e-3127.66Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A3Q1FMU43.091e-3128.19Collagen type VI alpha 6 chain OS=Acanthochromis p... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-62a1.33.137e-2525.25si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-4... [more]
si:ch211-62a1.33.137e-2525.25si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-4... [more]
col6a4a1.324e-2325.46collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-G... [more]
col6a4a1.495e-2325.46collagen, type VI, alpha 4a [Source:ZFIN;Acc:ZDB-G... [more]
si:ch1073-291c23.11.750e-1522.71vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009632.18.134e-2425.55pep scaffold:Pmarinus_7.0:GL479939:9900:31909:-1 g... [more]
ENSPMAT00000009633.18.442e-2325.32pep scaffold:Pmarinus_7.0:GL479939:15464:32536:-1 ... [more]
ENSPMAT00000009635.11.184e-2225.26pep scaffold:Pmarinus_7.0:GL479939:22902:31906:-1 ... [more]
ENSPMAT00000007296.11.673e-1722.64pep scaffold:Pmarinus_7.0:GL477669:89164:98084:1 g... [more]
ENSPMAT00000007304.11.958e-1722.64pep scaffold:Pmarinus_7.0:GL477669:89164:98057:1 g... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475557.783e-2224.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465501.005e-1924.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500773.686e-1835.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVBF-24.520e-1827.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500791.733e-1626.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL6A61.059e-3226.51collagen type VI alpha 6 chain [Source:HGNC Symbol... [more]
COL6A61.710e-3226.47collagen type VI alpha 6 chain [Source:HGNC Symbol... [more]
MATN27.392e-2524.09matrilin 2 [Source:NCBI gene;Acc:101164835][more]
MATN28.496e-2524.32matrilin 2 [Source:NCBI gene;Acc:101164835][more]
vwa29.240e-2024.81von Willebrand factor A domain containing 2 [Sourc... [more]
back to top
BLAST of Collagen alpha-6(VI) chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046770.12.159e-2498.83SMESG000046770.1[more]
SMESG000024982.17.992e-14352.60SMESG000024982.1[more]
SMESG000046768.18.097e-3026.28SMESG000046768.1[more]
SMESG000043380.17.258e-2725.70SMESG000043380.1[more]
SMESG000033673.11.073e-1725.14SMESG000033673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007780 ID=SMED30007780|Name=Collagen alpha-6(VI) chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1269bp
TTTTATACGATTTATTACTCATGAGTAAATAAAAGTAAAATAATTGTGAA
ACTAGCTTCATTACCCGCAATTTCATATTTAGTTTCATGGAAGGTCTACG
AAGCAACCTCATCCTGTTCATGGTTCAAACAAGACACCGTGTTCATCCTT
GATGCTTCTCAATCCATCTCTTCAAGCGATTTTGAACTGGCTAAAAGAGT
CATCGTAAAAATGATGACTTTTATTAAAACTACCAATGCGGATAATCGTA
TTTCCTTTATCGTTTTTGGAGATGACGCAACTTTAATATTTAACTTTGAT
AAGTTCAAGAATCTCAACGATATGGTTAGACAAGTAAAAAATGTCAGAAA
TGATAATGGCGCGACAGCAATCGGAAAAGCTTTAAAATTAACTTACGAAA
ATTTGGTACCTCAAATGCGAAAAGATGCTCAAAGATATGTGATTTTATTT
ACAGATGGGACAAATAATGTATTTCCAGCGCCATATATTTATGCCGACCA
CTTGAAAGATGCATCGGTTCGCATTCTGACGGTCGGTATTGGCTCAGAAA
TAAATAAAAAAGAACTTATCAACCTTGCTTCTCCGAATATGGCAATAACT
GTGGCGGATTTTCAGAAGTTGTTTGAAAATTTAATGAAAATAATTCATCA
CGTTTGCGTTATCGTAGATCCAATTCCAAACGAGCCTTGTAAAGTGGAAC
AGCAAGATCTGGTTGTTTTGATGGACTCTTCAAAGTCCATTTCAGGGCCA
GATTTCGAAATTGGAAAACGATTTGTTGCTCATTTAATATCAAAATTTCA
AATTGGTCCAAAAGCCACCCGAGTTGGCTTAGTTTCGTTTTCAGATCACC
CGAGAATTGAATTCGACCTCCATTTGGTAGATCGAAATAAAGTCCTAGAA
AAAATCAAACATTTACGAAAACTCGGAAGCGCAACCGGGTTGGGATTGGC
ATTGCGTGAAGTCCAATTTAAATTCTGGCCCCACAGACGACATGGAATTC
CGTTCAACATTTTAATTTTAACGGACGGATATAATAATGTGTTTCCAAGA
CCTCATGAAATTGCCAGCAAACTAAAAAGAGAGGGAGCAAACATTATTTC
TTTAGGCATTGGAAGACACATTAATTTAAAGGAACTAACTGATATTTCAT
CAAATGATAAAATCCTGACTGTAAATTCATATGAAAGATTACAGAAAAAT
ATGAAAACAGTATTAAAAGCAGTTACATGTGGTTAAACAAAGTTTATGAA
CCGTATTGAAACAACAGTG
back to top

protein sequence of SMED30007780-orf-1

>SMED30007780-orf-1 ID=SMED30007780-orf-1|Name=SMED30007780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MMTFIKTTNADNRISFIVFGDDATLIFNFDKFKNLNDMVRQVKNVRNDNG
ATAIGKALKLTYENLVPQMRKDAQRYVILFTDGTNNVFPAPYIYADHLKD
ASVRILTVGIGSEINKKELINLASPNMAITVADFQKLFENLMKIIHHVCV
IVDPIPNEPCKVEQQDLVVLMDSSKSISGPDFEIGKRFVAHLISKFQIGP
KATRVGLVSFSDHPRIEFDLHLVDRNKVLEKIKHLRKLGSATGLGLALRE
VQFKFWPHRRHGIPFNILILTDGYNNVFPRPHEIASKLKREGANIISLGI
GRHINLKELTDISSNDKILTVNSYERLQKNMKTVLKAVTCG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR002035VWF_A
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005581collagen trimer
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion