LIM and SH3 domain protein 1

Overview
NameLIM and SH3 domain protein 1
Smed IDSMED30007755
Length (bp)923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM and SH3 domain protein 1 (SMED30007755) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM and SH3 domain protein 1 (SMED30007755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM and SH3 domain protein 1 (SMED30007755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM and SH3 domain protein 1 (SMED30007755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000002154.1 Contig24377uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000002154.1 Contig24377newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000002154.1 Contig46078uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000002154.1 Contig46078newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000031386.1 SMESG000002154.1 Contig4442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000031386.1 SMESG000002154.1 Contig4442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000052707.1 Contig4442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007755SMESG000052707.1 Contig4442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007755SMESG000002154.1 dd_Smed_v4_1218_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Match: LASP1 (LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC:6513])

HSP 1 Score: 191.045 bits (484), Expect = 5.616e-59
Identity = 106/261 (40.61%), Postives = 135/261 (51.72%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQ-----NSIPRAP--------------------------------SPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ + P +      S  R P                                 P   V+ Q         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 261          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Match: LASP1 (LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC:6513])

HSP 1 Score: 191.045 bits (484), Expect = 5.616e-59
Identity = 106/261 (40.61%), Postives = 135/261 (51.72%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQ-----NSIPRAP--------------------------------SPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ + P +      S  R P                                 P   V+ Q         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 261          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Match: NEBL (nebulette [Source:HGNC Symbol;Acc:HGNC:16932])

HSP 1 Score: 173.326 bits (438), Expect = 5.239e-52
Identity = 104/280 (37.14%), Postives = 133/280 (47.50%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQ------------------------------------DISNINYHKQFNENRNR--------------------ISET---GAPPARYDSDYNQNSGI-------NANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDKYWHK CF C  C + L M NYKGY K PYC+ HYP Q FTTV DTPEN RL Q ++                                     ISN+ YH+ F + + R                    +S+    G  P   + D  +  GI        A Q   S     M+ Q  + S  S+  +P+           Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTV+RTG  GM+P NY+E +
Sbjct:    1 MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMD--RRPGIIVAPVLPGAYQQSHSQGYGYMH-QTSVSSMRSMQHSPN--------LRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFV 269          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Match: LASP1 (LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC:6513])

HSP 1 Score: 118.242 bits (295), Expect = 5.680e-33
Identity = 52/84 (61.90%), Postives = 60/84 (71.43%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNI 333
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S +
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQM 84          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Match: LASP1 (LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC:6513])

HSP 1 Score: 101.679 bits (252), Expect = 3.150e-25
Identity = 63/164 (38.41%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  265 FTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISE-TGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSI--------PRAPSPVE--VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            F+ V DTPE +R+ +    ISNI YH++F ++R   S   G  P R DS    +      Q    H  +     +    Q           P AP  ++         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:   42 FSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 205          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 123.635 bits (309), Expect = 8.590e-33
Identity = 63/160 (39.38%), Postives = 91/160 (56.88%), Query Frame = 1
Query:   82 MNPLCGR--CNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPR-APSPVEVVTQQA 552
            M+  C R  C KTVYPVE+L CLDK WHK CFKCT C +TL MKNYKGY+K PYC  HYP    + + DTPE +R+A+ T++ SNI YH ++ + +    E    P        +N+ + +N +       +   ++V P +   P   P+P+  +  Q+
Sbjct:    1 MSKKCAREDCGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHYPKTVASVMADTPEMRRIAENTKNQSNIKYHAEYEKMKGTKIEIADDPEM--ERLKKNTQVQSNVSYHGVLDQKARQEEVRPKEEISPNPTPTPISPMNHQS 158          

HSP 2 Score: 82.0333 bits (201), Expect = 1.316e-17
Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 1
Query:  562 KCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            K +YDYAA D DE+SF+EGDII+N E ID GWMTGTV+RT   GM+P NYV+
Sbjct:  256 KAIYDYAAADKDEISFLEGDIIVNCEKIDDGWMTGTVQRTLQWGMLPANYVQ 307          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 123.635 bits (309), Expect = 9.639e-33
Identity = 63/160 (39.38%), Postives = 91/160 (56.88%), Query Frame = 1
Query:   82 MNPLCGR--CNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPR-APSPVEVVTQQA 552
            M+  C R  C KTVYPVE+L CLDK WHK CFKCT C +TL MKNYKGY+K PYC  HYP    + + DTPE +R+A+ T++ SNI YH ++ + +    E    P        +N+ + +N +       +   ++V P +   P   P+P+  +  Q+
Sbjct:    1 MSKKCAREDCGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHYPKTVASVMADTPEMRRIAENTKNQSNIKYHAEYEKMKGTKIEIADDPEM--ERLKKNTQVQSNVSYHGVLDQKARQEEVRPKEEISPNPTPTPISPMNHQS 158          

HSP 2 Score: 82.0333 bits (201), Expect = 1.669e-17
Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 1
Query:  562 KCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            K +YDYAA D DE+SF+EGDII+N E ID GWMTGTV+RT   GM+P NYV+
Sbjct:  272 KAIYDYAAADKDEISFLEGDIIVNCEKIDDGWMTGTVQRTLQWGMLPANYVQ 323          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Match: cdap-2 (CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573])

HSP 1 Score: 52.373 bits (124), Expect = 2.248e-7
Identity = 27/67 (40.30%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  514 RAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYV 714
            RAP P      QA  Y   Y Y++   DE+SFV GD+I     ++ GW  G ++ TG  GM P N+V
Sbjct:   40 RAPPP----QPQAQIYVATYAYSSKQDDELSFVVGDLIELISDVEDGWSKGKLKSTGAVGMFPTNFV 102          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Match: sorb-1 (SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O62482])

HSP 1 Score: 51.6026 bits (122), Expect = 4.470e-7
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  535 VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            ++ + +  Y+ +Y Y     DE+     DII   E  D GW  GT  RTGD G+ P NYV++
Sbjct:  943 LIPKGSEMYRAVYPYQPQKEDELQLYTNDIIFVVEKCDDGWFIGTSLRTGDFGIFPGNYVKR 1004          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Match: sorb-1 (SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O62482])

HSP 1 Score: 50.8322 bits (120), Expect = 6.820e-7
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  535 VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            ++ + +  Y+ +Y Y     DE+     DII   E  D GW  GT  RTGD G+ P NYV++
Sbjct:  411 LIPKGSEMYRAVYPYQPQKEDELQLYTNDIIFVVEKCDDGWFIGTSLRTGDFGIFPGNYVKR 472          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0306152)

HSP 1 Score: 170.629 bits (431), Expect = 3.719e-51
Identity = 104/279 (37.28%), Postives = 129/279 (46.24%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENK-----------------------------------RLAQLTQDISNINYHKQFNENRNRISETGAP-----------PARYDS--DYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRA---------------PSPVEVVTQQATK---YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            MN  C RC K VYP+E+L CLDK WHK CFKCT+C +TL MK YKGYNKMPYC  H P  K T + DTPE K                                   R+ Q T+ ISN+ YH    +      + G+            P R  S  D +  +GI  + T       +   Q+       + +                 S  E  ++Q+T    Y+ +YDY A D DEVSF EGD+I   E ID GWMTG VERTG  GM+P NYVEQ
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIADTPELKRIAENTKIQSNVKYHADFEKAKGKFTQVADDPETLRIKQNTKHISNVAYHGDLEKKAAMEKQRGSAEVSDSSSNSVYPKRIGSVSDIDPANGIYGSLTAAEQAHQQQKHQQYYQQVQMMQQQEHPPQQQQMRQQPSYSSLQEKQSRQSTAMRVYRAIYDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYVEQ 279          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0075350)

HSP 1 Score: 136.732 bits (343), Expect = 2.327e-36
Identity = 56/104 (53.85%), Postives = 70/104 (67.31%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPP 393
            MN  C RC K VYP+E+L CLDK WHK CFKCT+C +TL MK YKGYNKMPYC  H P  K T + DTPE KR+A+ T+  SN+ YH  F + + + ++    P
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIADTPELKRIAENTKIQSNVKYHADFEKAKGKFTQVADDP 104          

HSP 2 Score: 84.3445 bits (207), Expect = 7.034e-18
Identity = 36/54 (66.67%), Postives = 40/54 (74.07%), Query Frame = 1
Query:  559 YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            Y+ +YDY A D DEVSF EGD+I   E ID GWMTG VERTG  GM+P NYVEQ
Sbjct:  448 YRAIYDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYVEQ 501          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0100145)

HSP 1 Score: 136.346 bits (342), Expect = 1.233e-35
Identity = 56/104 (53.85%), Postives = 70/104 (67.31%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPP 393
            MN  C RC K VYP+E+L CLDK WHK CFKCT+C +TL MK YKGYNKMPYC  H P  K T + DTPE KR+A+ T+  SN+ YH  F + + + ++    P
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIADTPELKRIAENTKIQSNVKYHADFEKAKGKFTQVADDP 104          

HSP 2 Score: 84.7297 bits (208), Expect = 6.570e-18
Identity = 36/54 (66.67%), Postives = 40/54 (74.07%), Query Frame = 1
Query:  559 YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            Y+ +YDY A D DEVSF EGD+I   E ID GWMTG VERTG  GM+P NYVEQ
Sbjct:  601 YRAIYDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYVEQ 654          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0306151)

HSP 1 Score: 135.961 bits (341), Expect = 1.323e-35
Identity = 56/104 (53.85%), Postives = 70/104 (67.31%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPP 393
            MN  C RC K VYP+E+L CLDK WHK CFKCT+C +TL MK YKGYNKMPYC  H P  K T + DTPE KR+A+ T+  SN+ YH  F + + + ++    P
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIADTPELKRIAENTKIQSNVKYHADFEKAKGKFTQVADDP 104          

HSP 2 Score: 84.3445 bits (207), Expect = 7.028e-18
Identity = 36/54 (66.67%), Postives = 40/54 (74.07%), Query Frame = 1
Query:  559 YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            Y+ +YDY A D DEVSF EGD+I   E ID GWMTG VERTG  GM+P NYVEQ
Sbjct:  580 YRAIYDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYVEQ 633          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Match: CAP (gene:FBgn0033504 transcript:FBtr0301965)

HSP 1 Score: 58.5362 bits (140), Expect = 3.660e-9
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  559 YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            Y+ LY Y   +SDE+  +EGD++   E  D GW  GT +RTG  G  P NYVE+
Sbjct: 1689 YRALYKYRPQNSDELELLEGDVVHVLEKCDDGWFVGTSQRTGCFGTFPGNYVER 1742          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Match: lasp1 (LIM and SH3 protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1936])

HSP 1 Score: 199.519 bits (506), Expect = 8.126e-63
Identity = 102/234 (43.59%), Postives = 136/234 (58.12%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPS------------PVE-----VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNPLC RCN+ VYP EK++CLDKYWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT+V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R+       + P  N+ P  PS            PV             +Y+ +YDY A D DEVSF++GD+I++ + ID+GWM G VERTG QGM+P NYVE +
Sbjct:    1 MNPLCSRCNRVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTSFTSVADTPENLRLKQQSKMQSQVLYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEDFEKSRSGGDTPLPLTPQLNTPPAYPSSAASQNYHYEPEPVRPAAAAPPPSSGKRYRAVYDYTAADEDEVSFMDGDMIVDVQQIDEGWMYGRVERTGQQGMLPANYVEAM 234          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Match: nebl (nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151])

HSP 1 Score: 177.178 bits (448), Expect = 1.215e-53
Identity = 109/279 (39.07%), Postives = 138/279 (49.46%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNEN---------------RNRISETGAPPARYDSDYNQNSGI--------------------NANQTDQSHRT--------SRMNGQKVLPSQNSIPRAPSP--------------------VEVVTQQA--TKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VY  EK++CLDKYWHK CF C  C +TL M NYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y K F ++               R R ++     A+Y  D+ + SG+                    N    + +H+          R  G  V P    +P A  P                    +++ +QQ   T Y+ LYDY A D DEVSF +GDII N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct:    1 MNPHCARCGKIVYATEKVNCLDKYWHKGCFHCEVCKMTLNMNNYKGYEKKPYCNAHYPKQTFTIVADTPENLRLRQQSELQSQVKYRKDFEQSKGRGLKFVLDTPELQRLRKAQDQISNAKYHKDF-EVSGLQGVTQGMRGTYAVRSQMTPNNETVANSTHKAVHQYIMEMDRRPGVIVAPV---LPGAYYPNSHSHGHSYMHQTSMHSLRSMQLRSQQMSMTVYRALYDYMAQDYDEVSFRDGDIIQNVQPIDEGWMYGTVQRTGRSGMLPANYVEGI 275          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Match: lasp1 (LIM and SH3 protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1936])

HSP 1 Score: 159.458 bits (402), Expect = 1.675e-47
Identity = 85/211 (40.28%), Postives = 116/211 (54.98%), Query Frame = 1
Query:  151 YWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPS------------PVE-----VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            YWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT+V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R+       + P  N+ P  PS            PV             +Y+ +YDY A D DEVSF++GD+I++ + ID+GWM G VERTG QGM+P NYVE +
Sbjct:    2 YWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTSFTSVADTPENLRLKQQSKMQSQVLYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEDFEKSRSGGDTPLPLTPQLNTPPAYPSSAASQNYHYEPEPVRPAAAAPPPSSGKRYRAVYDYTAADEDEVSFMDGDMIVDVQQIDEGWMYGRVERTGQQGMLPANYVEAM 212          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Match: CABZ01092072.2 (pep scaffold:GRCz11:KN150170.1:36770:44030:1 gene:ENSDARG00000113614.1 transcript:ENSDART00000187672.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01092072.2)

HSP 1 Score: 117.857 bits (294), Expect = 8.213e-33
Identity = 53/79 (67.09%), Postives = 58/79 (73.42%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQ 318
            MNP C RC KT YP EK+SCLDK WHK CF C  C +TL MKNYKGY+K PYCS HYP   FT VTDTPEN RL Q ++
Sbjct:    1 MNPPCARCGKTAYPTEKISCLDKNWHKGCFHCEVCKMTLNMKNYKGYDKKPYCSAHYPKTSFTIVTDTPENLRLKQQSE 79          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Match: neb (nebulin [Source:ZFIN;Acc:ZDB-GENE-041111-216])

HSP 1 Score: 87.4261 bits (215), Expect = 1.617e-19
Identity = 57/145 (39.31%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  292 NKRLAQLTQDISNINYHK-QFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            +K  ++ T  +S +   K + +EN +R S   A  A +   Y Q   I   Q     R+S +  Q+   S  S+P  PS            + +YDYAA DSDEVSF +GD+I+N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct:  161 SKEHSRSTSAMSGVGDEKSEVSENVDRYSNGFAISALHG--YTQTKTIEVQQ-----RSSSVATQQTTVS--SVPSHPSTT------GKTVRAMYDYAAADSDEVSFKDGDVIVNVQSIDEGWMYGTVQRTGKTGMLPANYVEAI 290          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Match: lasp1 (LIM and SH3 protein 1 [Source:NCBI gene;Acc:493322])

HSP 1 Score: 194.126 bits (492), Expect = 2.690e-60
Identity = 113/260 (43.46%), Postives = 138/260 (53.08%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQL-----------------------------------TQD-ISNINYHKQFNENR--NRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAP--SPVEVVTQQ------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY+K PYC+ HYP Q FTTV DTPEN RL Q                                    TQD ISNI YH++F+++R  N + + G    R  SD   N   ++  T Q H     +     P     P+     P   V+ Q        +Y+ +YDY A D DEVSF +GD IIN + ID GWM GTVERTGD GM+P NYVE +
Sbjct:    1 MNPSCARCGKIVYPTEKVNCLDKFWHKACFHCEICKMTLNMKNYKGYDKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVRYKEDFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFDKSRMGNPLVD-GDDFDRRGSDDGANYRRSSQSTPQQHHPPPASS-SAYPQHQPQPKYGYQEPAAPVSSQRSAPAGGKRYRAVYDYNAADEDEVSFQDGDTIINVQQIDDGWMYGTVERTGDTGMLPANYVEAM 258          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000052352.1 (nebulette [Source:NCBI gene;Acc:100496676])

HSP 1 Score: 173.326 bits (438), Expect = 6.748e-52
Identity = 99/279 (35.48%), Postives = 134/279 (48.03%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQ------------------------------------DISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHR-----TSRMNGQKVLPSQNSIPRA------------------------PSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC + VYP EK++CLDK+WHK CF+C  C +TL M NYKGY+K PYC+ HYP Q FTTVTDTPEN RL Q ++                                     ISNI YH+ F + + +    G  P   D   ++        +D ++R        M+ +  +     +P A                        P     ++     Y+ +YDY A D DEVSF EGD I+N + ID+GWM GTV+R+G  GM+P NY+E +
Sbjct:    1 MNPQCARCGRVVYPTEKVNCLDKFWHKGCFQCEVCKMTLNMNNYKGYDKKPYCNAHYPKQSFTTVTDTPENLRLKQQSEIQSQVKYKKDFEESKGRGFSIVTDALELQRLKKTQEQISNIKYHEDFEKTKGK----GFTPVVDDPITDRVRRNTQIVSDAAYRNVHPHVVEMDRRPGMVVGQGMPGAYPQHHPGYGYMHPSSAASSVRSAQPQHAPPLSPSMRTYRAMYDYCAQDEDEVSFREGDYIVNVQPIDEGWMYGTVQRSGKNGMLPANYIELV 275          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:Xenbase;Acc:XB-GENE-947075])

HSP 1 Score: 83.9593 bits (206), Expect = 2.805e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 1
Query:  460 RTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            R+S +  Q  L + +S+P  PS           +K +YDY A D DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NY+E I
Sbjct: 5915 RSSSVATQ--LTTASSVPSHPSTT------GKSFKAMYDYRAADDDEVSFKDGDTIVNVQTIDEGWMYGTVQRTGKTGMLPANYLESI 5994          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:Xenbase;Acc:XB-GENE-947075])

HSP 1 Score: 83.9593 bits (206), Expect = 2.910e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 1
Query:  460 RTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            R+S +  Q  L + +S+P  PS           +K +YDY A D DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NY+E I
Sbjct: 2926 RSSSVATQ--LTTASSVPSHPSTT------GKSFKAMYDYRAADDDEVSFKDGDTIVNVQTIDEGWMYGTVQRTGKTGMLPANYLESI 3005          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:Xenbase;Acc:XB-GENE-947075])

HSP 1 Score: 83.9593 bits (206), Expect = 2.967e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 1
Query:  460 RTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            R+S +  Q  L + +S+P  PS           +K +YDY A D DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NY+E I
Sbjct: 6003 RSSSVATQ--LTTASSVPSHPSTT------GKSFKAMYDYRAADDDEVSFKDGDTIVNVQTIDEGWMYGTVQRTGKTGMLPANYLESI 6082          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Match: Lasp1 (LIM and SH3 protein 1 [Source:MGI Symbol;Acc:MGI:109656])

HSP 1 Score: 193.356 bits (490), Expect = 5.040e-60
Identity = 109/263 (41.44%), Postives = 137/263 (52.09%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQ--------------------NSIP-RAP------------------SPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDKYWHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ V P +                    + IP  AP                   P   V+ Q         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGVEPERREAQDSSSYRRPTEQQQPQPHHIPTSAPVYQQPQQQQMTSSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 263          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Match: Nebl (nebulette [Source:MGI Symbol;Acc:MGI:1921353])

HSP 1 Score: 177.178 bits (448), Expect = 1.416e-53
Identity = 99/269 (36.80%), Postives = 137/269 (50.93%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNEN---------------RNRISETGAPPARYDSDYNQNSG------INANQTDQSHRTSRMNG----QKVLPSQNSIPRAP----SPVEVVTQQATK--------------------------YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDKYWHK CF C  C + L M NYKGY K PYC+ HYP Q FTTV DTPEN RL Q ++  S + Y + F E+               R + ++      +Y  D+ +  G      ++   T++  +++++      + V P    + R P    +PV     Q +                           Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTV+RTG  GM+P NY+E +
Sbjct:    1 MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDDPVTERVRKSTQVVSDAAYKGVQPHVVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQPPAHLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFV 269          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Match: Neb (nebulin [Source:MGI Symbol;Acc:MGI:97292])

HSP 1 Score: 86.6557 bits (213), Expect = 1.922e-18
Identity = 38/74 (51.35%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  502 NSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            +SIP  PS    +      ++ +YDY A D+DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct:  701 SSIPSHPSTAGKI------FRAIYDYIAADADEVSFKDGDAIVNAQAIDEGWMYGTVQRTGRTGMLPANYVEAI 768          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Match: Neb (nebulin [Source:MGI Symbol;Acc:MGI:97292])

HSP 1 Score: 85.5001 bits (210), Expect = 6.748e-18
Identity = 38/74 (51.35%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  502 NSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            +SIP  PS    +      ++ +YDY A D+DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct: 6842 SSIPSHPSTAGKI------FRAIYDYIAADADEVSFKDGDAIVNAQAIDEGWMYGTVQRTGRTGMLPANYVEAI 6909          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Match: Neb (nebulin [Source:MGI Symbol;Acc:MGI:97292])

HSP 1 Score: 85.5001 bits (210), Expect = 7.210e-18
Identity = 38/74 (51.35%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  502 NSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            +SIP  PS    +      ++ +YDY A D+DEVSF +GD I+N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct: 7085 SSIPSHPSTAGKI------FRAIYDYIAADADEVSFKDGDAIVNAQAIDEGWMYGTVQRTGRTGMLPANYVEAI 7152          
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Match: sp|Q99MZ8|LASP1_RAT (LIM and SH3 domain protein 1 OS=Rattus norvegicus OX=10116 GN=Lasp1 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.655e-59
Identity = 112/263 (42.59%), Postives = 134/263 (50.95%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQL-----------------------------------TQD-ISNINYHKQFNENRNRIS--ETGAPPARYDSDYNQNSGINANQTDQSHRT-------SRMNGQKVLPSQNSIPRAPSPVEVVTQQ----ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q                                    TQD ISNI YH++F ++R   S  E   P  R   D +        Q  Q H          +   Q+V PS        +PV +          +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGIEPERREAQDSSSYRRPTEQQQPQPHHIPTSAPVYQQPQQQQVTPSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 263          
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Match: sp|Q61792|LASP1_MOUSE (LIM and SH3 domain protein 1 OS=Mus musculus OX=10090 GN=Lasp1 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.525e-59
Identity = 109/263 (41.44%), Postives = 137/263 (52.09%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQ--------------------NSIP-RAP------------------SPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDKYWHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ V P +                    + IP  AP                   P   V+ Q         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGVEPERREAQDSSSYRRPTEQQQPQPHHIPTSAPVYQQPQQQQMTSSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 263          
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Match: sp|Q5R5W0|LASP1_PONAB (LIM and SH3 domain protein 1 OS=Pongo abelii OX=9601 GN=LASP1 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.010e-58
Identity = 106/261 (40.61%), Postives = 136/261 (52.11%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLP----SQNSI--------------------------------------PRAPSPVE--VVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ + P    SQ+S                                       P AP  ++         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDSSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 261          
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Match: sp|O77506|LASP1_RABIT (LIM and SH3 domain protein 1 OS=Oryctolagus cuniculus OX=9986 GN=LASP1 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.143e-58
Identity = 108/263 (41.06%), Postives = 137/263 (52.09%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLP----SQNS-----------------IPRA------------------PSPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ R  S     P   R     +Q S I  ++  +  R     G+   P    SQ+S                 IP +                    P   V+ Q         +Y+ ++DY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGRGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGAEPERRDSQDSSNYRRPPEQQQPPQPHHIPTSTPAYQQPQPQQVAQSYGYKEPAAPVSTQRGAPGGGGKRYRAVFDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 263          
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Match: sp|Q14847|LASP1_HUMAN (LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 2.697e-58
Identity = 106/261 (40.61%), Postives = 135/261 (51.72%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPA--RYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQ-----NSIPRAP--------------------------------SPVEVVTQQ-------ATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VYP EK++CLDK+WHK CF C  C +TL MKNYKGY K PYC+ HYP Q FT V DTPEN RL Q ++  S + Y ++F +N+ +  S     P   R     +Q S I  ++  +  R     G+ + P +      S  R P                                 P   V+ Q         +Y+ +YDY+A D DEVSF +GD I+N + ID GWM GTVERTGD GM+P NYVE I
Sbjct:    1 MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 261          
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Match: T2MDN9 (LIM and SH3 domain protein 1 OS=Hydra vulgaris OX=6087 GN=LASP1 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.266e-66
Identity = 113/222 (50.90%), Postives = 135/222 (60.81%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPP--ARYDSDYNQNSGIN--------ANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C RC KTVYPVEKL+CLDK WHK CF C  C +TL+MK Y+GY K+PYC+THYP+ KFT V DTPEN R+ + T + S I YHK+F + + + +     P   R     NQ S +         A Q D     SR         + S P AP P    +    KY  LYDY A D DEVSF EGDIIINGE+ID GWM+GTV+RTG  GM+P NYVE
Sbjct:    1 MNPKCYRCEKTVYPVEKLNCLDKIWHKGCFNCEVCHMTLSMKTYQGYEKLPYCNTHYPSTKFTAVADTPENLRIKKNTTNQSTIVYHKEFEQEKGKYTAVADDPETTRVKKTQNQASSVKYQQRIEPLAAQVDS--EGSRPPASNTSSRKVSEPAAPPP----SSGGPKYIALYDYTAADDDEVSFQEGDIIINGEIIDDGWMSGTVKRTGQTGMLPSNYVE 216          
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Match: A7RI32 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g178189 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.520e-63
Identity = 100/226 (44.25%), Postives = 136/226 (60.18%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNG----------QKVLPSQNSIPRAPSPVEVVTQQAT----KYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C +C KTVY  EKL+CLDK WHK CF+C  C++ L MKNYKGYNK PYC+ HYPT KFT V DTPEN RL + T + S++ YHK++ + + + +     P    +  N         T ++ R   +            Q+    Q + P  P+P++ V Q ++    +Y  +YDY A D DEVS VEGDII++ E+ID+GWM G V+RTG  GM+P NYV+
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHYPTPKFTAVADTPENLRLKKQTDNQSSLKYHKEYEQEKGKFTVVADDPEVLRARKNSEQASKVAYTQEARRMQGLAATVQEELSKSHQRPCDDQPAAPYQPAPLQQVPQPSSSNSAQYLVMYDYNAADDDEVSMVEGDIIVDAEIIDEGWMVGRVKRTGQSGMLPANYVQ 226          
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Match: I2G9D2 (LIM and SH3 domain protein 3 OS=Nematostella vectensis OX=45351 GN=lasp3 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.678e-62
Identity = 100/216 (46.30%), Postives = 136/216 (62.96%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQAT----KYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C +C KTVY  EKL+CLDK WHK CF+C  C++ L MKNYKGYNK PYC+ HYPT KFT V DTPEN RL + T + S++ YHK++ + + + +     P    +   + S     +  +SH       Q+    Q + P  P+P++ V Q ++    +Y  +YDY A D DEVS VEGDII++ E+ID+GWM G V+RTG  GM+P NYV+
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHYPTPKFTAVADTPENLRLKKQTDNQSSLKYHKEYEQEKGKFTVVADDPEVLRA---RKSTTVQEELSKSH-------QRPCDDQPAAPYQPAPLQQVPQPSSSNSAQYLVMYDYNAADDDEVSMVEGDIIVDAEIIDEGWMVGRVKRTGQSGMLPANYVQ 206          
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Match: I2G9E4 (LIM and SH3 domain protein OS=Clytia hemisphaerica OX=252671 GN=lasp PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.990e-62
Identity = 117/279 (41.94%), Postives = 141/279 (50.54%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNEN--------------RNRISETGAPPARYDSDYNQNSGINANQTD--QSHRTSRMNGQ---------------------------KVLPSQNSIPRAPSPV-----------------------EVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            MNP C RCNKTVYP EKL+CLDK WHK CFKC  C +TL MKNYKGY K+PYCS HYPT KFT V DTPEN RL + T + S   Y K+F +               R R ++  A    Y  D+ +  G   + TD  ++ RT +   Q                           +  P    + +AP+P                                +Y  +YDYAA D DEVSF EGDIIINGE ID GWMTGTVERTG+ GM+P NYVE+
Sbjct:    1 MNPPCARCNKTVYPTEKLNCLDKIWHKGCFKCESCGMTLNMKNYKGYKKLPYCSAHYPTTKFTAVADTPENLRLKKNTTNQSGAVYQKEFIKEKGKFTAVTDDPETMRTRKTQQQASGVVYQKDFIKEKGKVTSVTDDPETMRTKKTQQQASDLSYRGTAPPGSREADGSSSSLEDTRYTPRSEPVHQAPAPTYDPEPEYEPEPEPEPEPEPALPEPAAGGSGGRYVAIYDYAAADEDEVSFQEGDIIINGESIDAGWMTGTVERTGESGMLPSNYVEE 279          
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Match: A0A3Q2E3Y2 (LIM and SH3 protein 1 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.864e-62
Identity = 105/222 (47.30%), Postives = 136/222 (61.26%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR-ISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEV-------VTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNPLCGRCN+ VYP EK++CLDKYWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT V DTPEN RL Q T+  S ++Y + F +N+ +  S     P        Q+   N +   +S++T     Q+   SQN     P+P  V             +Y+ +YDYAA D DEVSF++GD+I++ + ID+GWM G VERTG QGM+P NYVE I
Sbjct:    1 MNPLCGRCNQVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTNFTCVADTPENLRLKQQTKMQSQVHYKEDFEKNKGKGFSVVADTPEMQRIKKTQDQISNVSVYYRSNKTRSY--QQPAASQNYHHYEPTPEPVRPAAAAPPPSSGKRYRAVYDYAAADDDEVSFMDGDVIVDVQQIDEGWMYGRVERTGQQGMLPANYVEAI 220          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000032311.1 (LIM and SH3 domain protein 1 [Source:NCBI gene;Acc:103022903])

HSP 1 Score: 202.601 bits (514), Expect = 3.493e-64
Identity = 111/250 (44.40%), Postives = 138/250 (55.20%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQ-----------------------------------LTQD-ISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RCNK VYP EK++CLDKYWHK CF C  C +TL MKNYKG++K PYCS HYP   FT+V DTPEN RL Q                                    TQD ISNI YH++F+++R       APPA  ++ Y  +S  + N   Q  R++            + P  PS          +YK +YDYAA D DEVSF +GD+I++ + ID+GWM G VERTG QGM+P NYVE I
Sbjct:    1 MNPQCSRCNKVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFDKKPYCSQHYPKTSFTSVADTPENLRLMQQSKVQSQVLYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFDKSR---MAGDAPPAETNAAYQPSSPQSYNYDPQPVRSA------------AAPPPPS-------GGKRYKAIYDYAAADEDEVSFADGDVILDVQQIDEGWMFGRVERTGKQGMLPSNYVEAI 228          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Match: lasp1 (LIM and SH3 domain protein 1-like [Source:NCBI gene;Acc:103035270])

HSP 1 Score: 196.438 bits (498), Expect = 1.472e-61
Identity = 102/242 (42.15%), Postives = 131/242 (54.13%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNG-----------------------QKVLPSQNSIPRAPSPVEVVT-----QQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNPLC RCN+ VYP EK++CLDKYWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT+V DTPEN RL Q ++  S + Y ++F +N+ +     A              I+  +  +    SRM G                       Q    SQN     P PV             +Y+ +YDY A D DEVSF++GD+I++ + ID+GWM G VERTG QGM+P NYVE I
Sbjct:    1 MNPLCSRCNRVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTSFTSVADTPENLRLKQQSKMQSQVLYKEEFEKNKGKGFSVVADTPEMQRIKKTQDQISNIKYHEEFEKSRMGGEAPPQHHPPQQQQQQQHHTPPAYQPPAASQN-YHYEPEPVRQAAAAPPPSSGKRYRAVYDYVAADEDEVSFLDGDVIVDVQPIDEGWMYGRVERTGQQGMLPANYVESI 241          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Match: lasp1 (LIM and SH3 domain protein 1-like [Source:NCBI gene;Acc:103035270])

HSP 1 Score: 174.481 bits (441), Expect = 1.868e-52
Identity = 92/228 (40.35%), Postives = 120/228 (52.63%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNG-----------------------QKVLPSQNSIPRAPSPVEVVT-----QQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERT 681
            MNPLC RCN+ VYP EK++CLDKYWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT+V DTPEN RL Q ++  S + Y ++F +N+ +     A              I+  +  +    SRM G                       Q    SQN     P PV             +Y+ +YDY A D DEVSF++GD+I++ + ID+GWM G VERT
Sbjct:    1 MNPLCSRCNRVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTSFTSVADTPENLRLKQQSKMQSQVLYKEEFEKNKGKGFSVVADTPEMQRIKKTQDQISNIKYHEEFEKSRMGGEAPPQHHPPQQQQQQQHHTPPAYQPPAASQN-YHYEPEPVRQAAAAPPPSSGKRYRAVYDYVAADEDEVSFLDGDVIVDVQPIDEGWMYGRVERT 227          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Match: nebl (nebulette [Source:NCBI gene;Acc:103034731])

HSP 1 Score: 157.147 bits (396), Expect = 8.562e-46
Identity = 104/288 (36.11%), Postives = 128/288 (44.44%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTV------------------------------------TDTPENKRLAQLTQDISNIN------YHKQFNENRNRISETGAPPA------------------------RYDSDYNQNSGINAN--------QTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VY  EK++CLDKYWHK CF C  C +TL M NYKGY K PYC++HYP Q FT V                                     DTPE +RL +    ISN++      YHK +          GA  A                        +Y  D ++  G+            T  S   S M+ Q  + S  S+     P   V      Y+ LYDY A D DEVSF +GDII N + ID+GW+ GTV+RTG  GM+P NYVE I
Sbjct:    1 MNPHCARCGKIVYATEKVNCLDKYWHKGCFHCEVCKMTLNMNNYKGYEKKPYCNSHYPKQTFTIVADTPENLRLRQQSELQSQVKYRKDFEESKGRGLRFLVDTPELQRLKKAQDQISNVSPDQEVKYHKDYEVPGLHGVPQGARGAYLVRAQGRPNHQTMGNSAAQQNVHQYIMDVDRRPGVIVAPVLPGAYYSTGHSQGHSYMH-QASMHSLRSMQLRAHPTLSV------YRALYDYTAQDCDEVSFRDGDIIHNVQPIDEGWLYGTVQRTGRSGMLPANYVEGI 281          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Match: nebl (nebulette [Source:NCBI gene;Acc:103034731])

HSP 1 Score: 157.147 bits (396), Expect = 8.562e-46
Identity = 104/288 (36.11%), Postives = 128/288 (44.44%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTV------------------------------------TDTPENKRLAQLTQDISNIN------YHKQFNENRNRISETGAPPA------------------------RYDSDYNQNSGINAN--------QTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP C RC K VY  EK++CLDKYWHK CF C  C +TL M NYKGY K PYC++HYP Q FT V                                     DTPE +RL +    ISN++      YHK +          GA  A                        +Y  D ++  G+            T  S   S M+ Q  + S  S+     P   V      Y+ LYDY A D DEVSF +GDII N + ID+GW+ GTV+RTG  GM+P NYVE I
Sbjct:    1 MNPHCARCGKIVYATEKVNCLDKYWHKGCFHCEVCKMTLNMNNYKGYEKKPYCNSHYPKQTFTIVADTPENLRLRQQSELQSQVKYRKDFEESKGRGLRFLVDTPELQRLKKAQDQISNVSPDQEVKYHKDYEVPGLHGVPQGARGAYLVRAQGRPNHQTMGNSAAQQNVHQYIMDVDRRPGVIVAPVLPGAYYSTGHSQGHSYMH-QASMHSLRSMQLRAHPTLSV------YRALYDYTAQDCDEVSFRDGDIIHNVQPIDEGWLYGTVQRTGRSGMLPANYVEGI 281          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Match: nebl (nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151])

HSP 1 Score: 149.058 bits (375), Expect = 8.485e-44
Identity = 87/254 (34.25%), Postives = 122/254 (48.03%), Query Frame = 1
Query:  139 CLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRI-SETGAPP--------------ARYDSDYNQNSG-----INANQTDQSHRTSR---------------------------------------MNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            C  + WHK CF C  C + L MKNYKGY+K PYC+ HYP Q FT+V DTPEN RL Q ++  S + Y ++F + + R  S+    P              A+Y  ++ +N G     +  N T +  R S                                         +GQ  + S  S  +   PV    +    Y+ +YDYAA D DEVSF++GD+I N + ID+GWM GTV+RTG  GM+P NY++ +
Sbjct:    1 CRPQTWHKACFHCEVCKMALNMKNYKGYDKRPYCNMHYPKQSFTSVADTPENLRLKQQSELQSQVKYKEEFEKAKGRACSQVSDTPEMMRIRKAQDQISDAKYHEEFEKNKGKGYAPVTDNVTMEQQRRSMHEVGSDAAAAYSRGSTRYSADEGGMYAQQQQQQHGQQNYFHGQGYVSSAASSQQ--RPVSQTPRATRPYRAVYDYAAADDDEVSFLDGDVIENVKQIDEGWMYGTVQRTGQTGMLPANYLQPL 252          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005882.1 (pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1 gene:ENSPMAG00000005319.1 transcript:ENSPMAT00000005882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 9.705e-23
Identity = 41/85 (48.24%), Postives = 53/85 (62.35%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPT-QKFTTVTDTPENKRLAQLTQDISNI 333
            MN  C RC   VYP+EKL CL + WHKMCF C +C+  LT+ N+K + K PYC  H P   KFT+V DTP N  + Q + + S +
Sbjct:    1 MNKPCARCQHPVYPLEKLDCLGQTWHKMCFYCEECETVLTVNNFKSFEKRPYCHAHCPKPNKFTSVLDTPLNLNVKQQSVNASEV 85          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009405.1 (pep scaffold:Pmarinus_7.0:GL476851:143328:224413:-1 gene:ENSPMAG00000008494.1 transcript:ENSPMAT00000009405.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.896e-16
Identity = 34/68 (50.00%), Postives = 49/68 (72.06%), Query Frame = 1
Query:  523 SPVEV-VTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            SPV   ++  +  Y+ +Y+Y A D DEVSF +GD+I+N + ID+GWM GTV+RTG  GM+P NYV+ +
Sbjct: 2877 SPVSSHLSSTSRTYRAVYEYTAADRDEVSFQDGDVIVNTQQIDEGWMYGTVQRTGISGMLPANYVQAL 2944          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 57.3806 bits (137), Expect = 1.004e-9
Identity = 27/54 (50.00%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  562 KCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            + LYDY A D  E+SF  GD+I N E ID GW  G+    G +GM P NYVE +
Sbjct:  303 RALYDYQAADDTEISFDPGDLISNIEQIDDGWWNGSGP-DGSRGMFPANYVELV 355          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Match: cttn (cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3])

HSP 1 Score: 48.9062 bits (115), Expect = 7.594e-7
Identity = 27/72 (37.50%), Postives = 35/72 (48.61%), Query Frame = 1
Query:  502 NSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
             + P +P+    V         +YDY     DE+SF   DII N E +D+GW  G  E  G  G+ P NYVE
Sbjct:  496 ETFPSSPAGATAVA--------IYDYQKAGDDEISFEPDDIITNIECLDEGWWRG--ECNGQVGIFPANYVE 557          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Yeast
Match: ABP1 (Actin-binding protein of the cortical actin cytoskeleton; important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization; inhibits barbed-end actin filament elongation; phosphorylation within its Proline-Rich Regio, mediated by Cdc28p and Pho85p, protects Abp1p from proteolysis mediated by its own PEST sequences; mammalian homolog of HIP-55 (hematopoietic progenitor kinase 1 [HPK1]-interacting protein of 55 kDa) [Source:SGD;Acc:S000000684])

HSP 1 Score: 57.3806 bits (137), Expect = 1.027e-9
Identity = 23/48 (47.92%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  571 YDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYV 714
            YDY A + +E++FVE D IIN E +D  W  G +E+ G +G+ P NYV
Sbjct:  541 YDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Match: LASP3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI32])

HSP 1 Score: 209.92 bits (533), Expect = 2.102e-67
Identity = 100/226 (44.25%), Postives = 136/226 (60.18%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNG----------QKVLPSQNSIPRAPSPVEVVTQQAT----KYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C +C KTVY  EKL+CLDK WHK CF+C  C++ L MKNYKGYNK PYC+ HYPT KFT V DTPEN RL + T + S++ YHK++ + + + +     P    +  N         T ++ R   +            Q+    Q + P  P+P++ V Q ++    +Y  +YDY A D DEVS VEGDII++ E+ID+GWM G V+RTG  GM+P NYV+
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHYPTPKFTAVADTPENLRLKKQTDNQSSLKYHKEYEQEKGKFTVVADDPEVLRARKNSEQASKVAYTQEARRMQGLAATVQEELSKSHQRPCDDQPAAPYQPAPLQQVPQPSSSNSAQYLVMYDYNAADDDEVSMVEGDIIVDAEIIDEGWMVGRVKRTGQSGMLPANYVQ 226          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Match: LASP1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI30])

HSP 1 Score: 189.504 bits (480), Expect = 1.059e-59
Identity = 101/216 (46.76%), Postives = 126/216 (58.33%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDS-DYNQNSGINANQTDQSHRTSRMNGQK--VLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQ 720
            MNP C RC KTVYPVEKLSCLDK WHK CFKC  C +TL MK YKGY K+PYC  HYP  K T V DT EN+R+   TQ  S + Y + F ++R R +     P    + + N+NS   +N   QS    +  G +   +PS    P  P      T++  +Y   Y+Y A+D+DE+   EGDII N   ID+GWM G  +RTG  GM P NYVEQ
Sbjct:    1 MNPPCARCRKTVYPVEKLSCLDKVWHKGCFKCESCGMTLNMKTYKGYQKLPYCDAHYPKTKHTVVADTLENQRIKTNTQIQSQVQYQRDFEQSRGRYTVISDDPETLRAINVNRNS---SNVAYQSGSRDQYTGSRDPRMPSYGDRPPMPR-----TRKEERYVAAYNYTASDTDEIGLQEGDIITNPTRIDEGWMEGRNQRTGKFGMFPANYVEQ 208          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Match: LASP2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI31])

HSP 1 Score: 182.956 bits (463), Expect = 9.229e-57
Identity = 103/237 (43.46%), Postives = 126/237 (53.16%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQN----------------------SGINANQTDQSHRTSRMNGQKVLPSQNSIP---RAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C +C KTVYPVEKL+CLDK WHK CF C  C++TL MK YKGYNK PYC+ HYPT K TTV DTPEN RL   +Q+ SN+ Y K + E++   +     P    +  N N                       G+N +Q     R        V P Q  +    + P         A +Y   YDY A D DEVSFVEGDII +  +ID GW+ G V RTG  GM+P NY+E
Sbjct:    1 MNPQCAKCAKTVYPVEKLNCLDKIWHKKCFTCQICNMTLNMKTYKGYNKYPYCNAHYPTTKPTTVADTPENLRLRIQSQNQSNVTYKKDYEESKGHYTAVTDDPEVIRAKQNMNIVSQVKYTGGTAEMRLGTSDLVEGVNPHQPGYEERVQHQPKHHV-PEQRQMQTHMQPPPAQPPARPAAPRYVAQYDYTAADDDEVSFVEGDIIQDVNIIDDGWVEGRVSRTGQFGMIPANYLE 236          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Match: EDO28129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C3])

HSP 1 Score: 82.0333 bits (201), Expect = 2.343e-20
Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCST 246
            MNP C +C KTVY  EKL+CLDK WHK CF+C  C++ L MKNYKGYNK PYC+ 
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNA 55          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Match: EDO50008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF11])

HSP 1 Score: 59.6918 bits (143), Expect = 1.611e-11
Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = 1
Query:   58 FDFFKRFKMNPL--CGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHY 252
            F    RF   P   C  CNKTVYP+E+L+   K +HK CFKC +C+ TL + NY       YC  H+
Sbjct:    8 FQRLGRFSAPPQEKCEVCNKTVYPMERLAADKKVYHKFCFKCNECNNTLRLGNYAALQGKVYCKPHF 74          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Match: ENSORLT00000014630.2 (LIM and SH3 domain protein 1 [Source:NCBI gene;Acc:101165512])

HSP 1 Score: 193.356 bits (490), Expect = 6.961e-60
Identity = 103/250 (41.20%), Postives = 132/250 (52.80%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQ------------------------------------DISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNP CGRCNK VYP EK++CLDK+WHK CF C  C + L+MKNYKG+ K PYCS HYP   FT VTDTPEN RL Q +Q                                     ISNI YH++F ++++R S+   P  R D +  QN                   + V P+    P A +P         +Y+ LY Y A +SDEVSF EGD+I + E ID+GWM G+ +RTG +GM+P NYV  +
Sbjct:    2 MNPSCGRCNKPVYPTEKINCLDKFWHKCCFSCEVCKMALSMKNYKGFEKRPYCSMHYPKTSFTIVTDTPENLRLKQQSQLNSQALYKEDFEKNKGKGFSVVADTPEMQRLKKTQDQISNIKYHEEFEKSKSR-SDAPPPENRKDLEKQQNP-----------------QRSVQPAAEMQPAAIAP----PSGGKRYQALYSYTAAESDEVSFQEGDLIFDAEPIDEGWMYGSNQRTGQRGMLPLNYVRPL 229          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Match: lasp1 (LIM and SH3 protein 1 [Source:NCBI gene;Acc:101156576])

HSP 1 Score: 191.045 bits (484), Expect = 1.262e-59
Identity = 103/235 (43.83%), Postives = 133/235 (56.60%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVL----PSQNSI-PRA--------PSPVEVVTQQATK--------YKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNPLC RCN  VYP EK++CLDKYWHK CF C  C +TL MKNYKG+ K PYC+ HYP   FT V DTPEN RL Q ++  S + Y + F +N+ +     A              I+  +  +     +M G+  L    PS  +  P A        P+P E V Q A          Y+ +YDY+A D DEVSF++GD+I + + ID+GWM G V+RTG QGM+P NYVE I
Sbjct:    1 MNPLCSRCNLVVYPTEKVNCLDKYWHKGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKTNFTCVADTPENLRLKQQSKMQSQVLYREDFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKRKMGGEAPLTPTTPSAGAFQPPATPQNYHYEPTP-EPVRQAAAAPPPSSGKVYRAVYDYSAADDDEVSFMDGDVIEDVQQIDEGWMYGRVQRTGQQGMLPANYVEAI 234          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Match: ENSORLT00000039921.1 (pep primary_assembly:ASM223467v1:20:3276051:3394630:1 gene:ENSORLG00000022207.1 transcript:ENSORLT00000039921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 2.428e-57
Identity = 112/275 (40.73%), Postives = 140/275 (50.91%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNR----ISET-----------GAPPARYDSDYNQ------NSGINANQTDQSHRTSRMNGQ----KVLPSQ--------NSIPRAP-------------------------SPVEVVT-----QQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVE 717
            MNP C RC K VYP EK+SCLDK WHK CF C  C +TL MKNYKGY+K PYC+ HYP   FT V DTPEN RL Q ++  S + Y K F E++ R    +S+T               A+Y  D+ +        G++    ++  R ++M G+    K L SQ          I  AP                         S V  VT          Y+ LYDY A D DEVSF +GD+IIN + ID+GWM GTV+RTG  GM+P NYVE
Sbjct:    1 MNPQCARCGKIVYPTEKVSCLDKNWHKGCFHCEVCKMTLNMKNYKGYDKKPYCNAHYPKTSFTIVADTPENLRLRQQSELQSQVKYKKDFEESKGRGFSIVSDTPEMQRLRKTQEQISNAKYHEDFERARGRGYTPGLDDPSMERYQRANQMIGEAGYSKGLHSQGMEMDRRPGGIIVAPVLPGAYHHQGAQHQQYHGYMHQTSMSSVRSVTSPPQHSHVRVYRALYDYTAQDHDEVSFRDGDVIINAQPIDEGWMYGTVQRTGKSGMLPANYVE 275          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Match: ENSORLT00000037489.1 (pep primary_assembly:ASM223467v1:21:4274531:4280546:-1 gene:ENSORLG00000029464.1 transcript:ENSORLT00000037489.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.563e-18
Identity = 38/74 (51.35%), Postives = 49/74 (66.22%), Query Frame = 1
Query:  502 NSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            +S+P  PS            + +YDY A DSDEVSF +GD+I+N + ID+GWM GTV+RTG  GM+P NYVE I
Sbjct:  214 SSVPSHPSTT------GKTVRAMYDYTAADSDEVSFKDGDVIVNVQSIDEGWMYGTVQRTGKTGMLPANYVEAI 281          
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Match: ENSORLT00000046467.1 (pep primary_assembly:ASM223467v1:19:5358336:5359736:-1 gene:ENSORLG00000026709.1 transcript:ENSORLT00000046467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.125e-16
Identity = 33/68 (48.53%), Postives = 42/68 (61.76%), Query Frame = 1
Query:   94 CGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYP-TQKFTTVTDTPEN 294
            C RC   VYP EK++C+D+ WHK CF C  C + LT  N+  + K PYCS H P    FT+V +TP N
Sbjct:    4 CARCGFVVYPAEKINCIDQNWHKACFHCDVCKMVLTANNFVSHKKRPYCSVHNPRNNTFTSVYETPIN 71          
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Match: SMESG000002154.1 (SMESG000002154.1)

HSP 1 Score: 452.595 bits (1163), Expect = 5.001e-163
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 723
            MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI
Sbjct:    1 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISETGAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI 214          
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Match: SMESG000044487.1 (SMESG000044487.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.117e-11
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 1
Query:   82 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHY 252
            +N  C  CNK VYP+EKL   DK +HK CF+C++C   L+  NY    + PYC+ HY
Sbjct:  199 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 255          
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Match: SMESG000072162.1 (SMESG000072162.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.953e-11
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 1
Query:   85 NPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTP 288
            N  C RC K+VY  E++      WH++CF+C QCD++L + NY     + YC  H+        T TP
Sbjct:    7 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTP 74          
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.335e-8
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  562 KCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYVEQI*SN 732
            K +++Y   DSDE+ F  G+II + E ID+GW  G   ++G +GM P NYVE I +N
Sbjct:  560 KAVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIG-CNKSGKRGMFPSNYVELIATN 615          

HSP 2 Score: 52.373 bits (124), Expect = 2.690e-7
Identity = 26/63 (41.27%), Postives = 35/63 (55.56%), Query Frame = 1
Query:  526 PVEVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERTGDQGMMPYNYV 714
            P E   +++     +Y Y A   DE+SF EG+ I N   ID+GW  G   + GD+GM P NYV
Sbjct:  634 PDEDNAEKSLTVVAVYSYHALQDDEISFEEGEHIYNVNQIDEGWWQGET-KDGDKGMFPSNYV 695          
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Match: SMESG000001219.1 (SMESG000001219.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.603e-8
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 1
Query:   91 LCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHY 252
            LC  C   +YP+EKL+   + +HK CF+C++C   L++ N+   N   YC  H+
Sbjct:   91 LCLICESKIYPMEKLTVDGRLYHKGCFRCSKCKTVLSVTNFNLSNNSIYCKIHF 144          
The following BLAST results are available for this feature:
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LASP15.616e-5940.61LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
LASP15.616e-5940.61LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEBL5.239e-5237.14nebulette [Source:HGNC Symbol;Acc:HGNC:16932][more]
LASP15.680e-3361.90LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
LASP13.150e-2538.41LIM and SH3 protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F42H10.38.590e-3339.38LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
F42H10.39.639e-3339.38LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
cdap-22.248e-740.30CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573... [more]
sorb-14.470e-737.10SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O6248... [more]
sorb-16.820e-737.10SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O6248... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lasp3.719e-5137.28gene:FBgn0063485 transcript:FBtr0306152[more]
Lasp2.327e-3653.85gene:FBgn0063485 transcript:FBtr0075350[more]
Lasp1.233e-3553.85gene:FBgn0063485 transcript:FBtr0100145[more]
Lasp1.323e-3553.85gene:FBgn0063485 transcript:FBtr0306151[more]
CAP3.660e-946.30gene:FBgn0033504 transcript:FBtr0301965[more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lasp18.126e-6343.59LIM and SH3 protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
nebl1.215e-5339.07nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151][more]
lasp11.675e-4740.28LIM and SH3 protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
CABZ01092072.28.213e-3367.09pep scaffold:GRCz11:KN150170.1:36770:44030:1 gene:... [more]
neb1.617e-1939.31nebulin [Source:ZFIN;Acc:ZDB-GENE-041111-216][more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lasp12.690e-6043.46LIM and SH3 protein 1 [Source:NCBI gene;Acc:493322... [more]
ENSXETT00000052352.16.748e-5235.48nebulette [Source:NCBI gene;Acc:100496676][more]
anks1b2.805e-1746.59ankyrin repeat and sterile alpha motif domain cont... [more]
anks1b2.910e-1746.59ankyrin repeat and sterile alpha motif domain cont... [more]
anks1b2.967e-1746.59ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lasp15.040e-6041.44LIM and SH3 protein 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Nebl1.416e-5336.80nebulette [Source:MGI Symbol;Acc:MGI:1921353][more]
Neb1.922e-1851.35nebulin [Source:MGI Symbol;Acc:MGI:97292][more]
Neb6.748e-1851.35nebulin [Source:MGI Symbol;Acc:MGI:97292][more]
Neb7.210e-1851.35nebulin [Source:MGI Symbol;Acc:MGI:97292][more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99MZ8|LASP1_RAT1.655e-5942.59LIM and SH3 domain protein 1 OS=Rattus norvegicus ... [more]
sp|Q61792|LASP1_MOUSE3.525e-5941.44LIM and SH3 domain protein 1 OS=Mus musculus OX=10... [more]
sp|Q5R5W0|LASP1_PONAB1.010e-5840.61LIM and SH3 domain protein 1 OS=Pongo abelii OX=96... [more]
sp|O77506|LASP1_RABIT1.143e-5841.06LIM and SH3 domain protein 1 OS=Oryctolagus cunicu... [more]
sp|Q14847|LASP1_HUMAN2.697e-5840.61LIM and SH3 domain protein 1 OS=Homo sapiens OX=96... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2MDN91.266e-6650.90LIM and SH3 domain protein 1 OS=Hydra vulgaris OX=... [more]
A7RI321.520e-6344.25Predicted protein OS=Nematostella vectensis OX=453... [more]
I2G9D21.678e-6246.30LIM and SH3 domain protein 3 OS=Nematostella vecte... [more]
I2G9E41.990e-6241.94LIM and SH3 domain protein OS=Clytia hemisphaerica... [more]
A0A3Q2E3Y22.864e-6247.30LIM and SH3 protein 1 OS=Cyprinodon variegatus OX=... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032311.13.493e-6444.40LIM and SH3 domain protein 1 [Source:NCBI gene;Acc... [more]
lasp11.472e-6142.15LIM and SH3 domain protein 1-like [Source:NCBI gen... [more]
lasp11.868e-5240.35LIM and SH3 domain protein 1-like [Source:NCBI gen... [more]
nebl8.562e-4636.11nebulette [Source:NCBI gene;Acc:103034731][more]
nebl8.562e-4636.11nebulette [Source:NCBI gene;Acc:103034731][more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nebl8.485e-4434.25nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151][more]
ENSPMAT00000005882.19.705e-2348.24pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1... [more]
ENSPMAT00000009405.11.896e-1650.00pep scaffold:Pmarinus_7.0:GL476851:143328:224413:-... [more]
DBNL1.004e-950.00drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
cttn7.594e-737.50cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3][more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ABP11.027e-947.92Actin-binding protein of the cortical actin cytosk... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LASP32.102e-6744.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP11.059e-5946.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP29.229e-5743.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281292.343e-2065.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500081.611e-1143.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000014630.26.961e-6041.20LIM and SH3 domain protein 1 [Source:NCBI gene;Acc... [more]
lasp11.262e-5943.83LIM and SH3 protein 1 [Source:NCBI gene;Acc:101156... [more]
ENSORLT00000039921.12.428e-5740.73pep primary_assembly:ASM223467v1:20:3276051:339463... [more]
ENSORLT00000037489.11.563e-1851.35pep primary_assembly:ASM223467v1:21:4274531:428054... [more]
ENSORLT00000046467.11.125e-1648.53pep primary_assembly:ASM223467v1:19:5358336:535973... [more]
back to top
BLAST of LIM and SH3 domain protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002154.15.001e-163100.00SMESG000002154.1[more]
SMESG000044487.11.117e-1147.37SMESG000044487.1[more]
SMESG000072162.12.953e-1136.76SMESG000072162.1[more]
SMESG000073128.11.335e-845.61SMESG000073128.1[more]
SMESG000001219.11.603e-837.04SMESG000001219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007755 ID=SMED30007755|Name=LIM and SH3 domain protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=923bp
CAGATTTGTTTAACCGAATAAATTTTCTTATTCACTAAGGCCGTTTAATA
ATCTTAATTTGATTTTTTCAAAAGATTCAAAATGAATCCATTATGTGGTC
GTTGTAACAAAACTGTCTATCCAGTGGAGAAATTATCATGCCTCGACAAA
TATTGGCATAAAATGTGCTTCAAATGTACTCAATGCGATCTGACATTGAC
TATGAAAAACTATAAGGGCTACAACAAGATGCCATACTGTTCAACTCATT
ACCCCACACAGAAATTTACGACGGTAACTGACACCCCGGAAAATAAACGA
CTTGCTCAATTAACACAGGACATAAGCAATATAAATTATCATAAGCAATT
CAATGAAAACAGAAACAGGATTTCTGAAACTGGAGCTCCCCCAGCAAGGT
ATGACAGTGATTACAATCAAAACTCTGGAATCAACGCAAATCAAACCGAT
CAGTCTCATCGTACTTCAAGAATGAACGGACAAAAAGTCTTGCCATCTCA
AAACTCAATCCCAAGGGCTCCTTCTCCCGTGGAGGTGGTGACACAGCAGG
CGACCAAGTACAAATGTCTGTATGACTATGCGGCAACGGACTCGGATGAG
GTGTCATTTGTGGAGGGGGACATCATTATTAATGGAGAGGTAATTGATCA
AGGCTGGATGACGGGCACCGTCGAAAGAACTGGGGATCAAGGAATGATGC
CTTACAATTACGTTGAGCAAATCTAATCAAATTAAACAAAGAAATATTTA
ATTATAACAATTATCAAGCGTTTAACGCATCAATATTTGCTTTTTCTTGT
TTTTTACATTTTCTCTTTCTAGAGCAATTTATTAATGTGCTGTGTAAATT
ATTAATCACTGGTTTTTTAAAATTAATTTATTATGTCATTATTTCGGTTC
ATTTTCACGTGGTCCTTCACAAT
back to top

protein sequence of SMED30007755-orf-1

>SMED30007755-orf-1 ID=SMED30007755-orf-1|Name=SMED30007755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKM
PYCSTHYPTQKFTTVTDTPENKRLAQLTQDISNINYHKQFNENRNRISET
GAPPARYDSDYNQNSGINANQTDQSHRTSRMNGQKVLPSQNSIPRAPSPV
EVVTQQATKYKCLYDYAATDSDEVSFVEGDIIINGEVIDQGWMTGTVERT
GDQGMMPYNYVEQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005938cell cortex
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR001781Znf_LIM
IPR000900Nebulin_repeat
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 172..187
score: 31.32
coord: 202..214
score: 39.0
coord: 158..168
score: 37.74
IPR001452SH3 domainSMARTSM00326SH3_2coord: 158..214
e-value: 9.0E-11
score: 51.8
IPR001452SH3 domainPFAMPF00018SH3_1coord: 163..207
e-value: 1.2E-11
score: 44.0
IPR001452SH3 domainPROSITEPS50002SH3coord: 155..214
score: 20.972
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 4..56
e-value: 2.3E-12
score: 57.1
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 5..58
e-value: 2.3E-11
score: 43.7
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 5..39
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 3..63
score: 12.92
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 156..214
e-value: 1.9E-21
score: 77.5
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 1..65
e-value: 8.0E-17
score: 62.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 118..148
NoneNo IPR availablePANTHERPTHR46218FAMILY NOT NAMEDcoord: 124..213
coord: 1..134
NoneNo IPR availableCDDcd09447LIM_LASPcoord: 5..57
e-value: 6.30511E-32
score: 108.617
NoneNo IPR availableCDDcd11789SH3_Nebulin_family_Ccoord: 159..213
e-value: 1.00326E-32
score: 110.485
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 2..30
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 31..58
IPR000900Nebulin repeatPROSITEPS51216NEBULINcoord: 61..95
score: 10.114
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 128..213