3-oxoacyl-[acyl-carrier-protein] reductase FabG

Overview
Name3-oxoacyl-[acyl-carrier-protein] reductase FabG
Smed IDSMED30007751
Length (bp)953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3-oxoacyl-[acyl-carrier-protein] reductase FabG (SMED30007751) t-SNE clustered cells

Violin plots show distribution of expression levels for 3-oxoacyl-[acyl-carrier-protein] reductase FabG (SMED30007751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3-oxoacyl-[acyl-carrier-protein] reductase FabG (SMED30007751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3-oxoacyl-[acyl-carrier-protein] reductase FabG (SMED30007751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007751SMESG000079251.1 dd_Smed_v4_4614_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007751SMESG000079251.1 dd_Smed_v4_4614_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30007751SMESG000079251.1 dd_Smed_v4_4614_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Match: DCXR (dicarbonyl and L-xylulose reductase [Source:HGNC Symbol;Acc:HGNC:18985])

HSP 1 Score: 123.635 bits (309), Expect = 5.185e-33
Identity = 83/252 (32.94%), Postives = 119/252 (47.22%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHA 854
            +  L+TGA  G+GR T       GA +V   R   +L           V E   +     DL + +      E+ L     +D+L+NNA + L      V+ + FD +  +NLRAVIQ++ ++   LI     G+IVNVSS    ++      YC  K  LD  T+  AL+L    +RVNAVNP V++T + +    D    +  L R      LG+F     V  +I FL S  S  TTG+T PV+GG  A
Sbjct:    8 RRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSL--------VRECPGIEPVCVDLGDWEA----TERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRI----PLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWA 243          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Match: PECR (peroxisomal trans-2-enoyl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:18281])

HSP 1 Score: 115.931 bits (289), Expect = 1.479e-29
Identity = 76/250 (30.40%), Postives = 124/250 (49.60%), Query Frame = 3
Query:  111 ALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQ-KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKG-SIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVIL--TDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGR 848
            A++TG ++G+G+A      +LG+N+VI  R  + LK  A   + +     Q +++    ++ NE+++  L + TL  F +++ L+NN G       E +S   +   +  NL     +   +  S +K  G SIVN+  V     FP  +     +AG+   T+  AL+ A  G+R+N V PGVI   T +       +S ++   Q+        R G P EV+  + FL SPA+SF TG +  VDGGR
Sbjct:   21 AIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNII-VPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAK----RIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGR 265          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Match: HSD17B14 (hydroxysteroid 17-beta dehydrogenase 14 [Source:HGNC Symbol;Acc:HGNC:23238])

HSP 1 Score: 106.301 bits (264), Expect = 2.716e-26
Identity = 73/231 (31.60%), Postives = 109/231 (47.19%), Query Frame = 3
Query:  162 FFQLGANLVITGRNDDNLKDTALLCEKHRVMENQ--KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI-LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            F   GA +VI  +++             R +E +    V  L D+  EDD++ L  +T+  F +LD ++NNAG        E  S   F   + LNL     LT L  P L K++G+++N+SS+ G+      + Y   K  +   T+  ALD +  GVRVN ++PG I T + +         +  ++   L   LGR G P EV  +  FLAS A +F TG    V GG
Sbjct:   29 FVNSGARVVICDKDESG----------GRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEA-NFCTGIELLVTGG 248          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Match: DHRS4 (dehydrogenase/reductase 4 [Source:HGNC Symbol;Acc:HGNC:16985])

HSP 1 Score: 103.99 bits (258), Expect = 2.482e-25
Identity = 73/267 (27.34%), Postives = 129/267 (48.31%), Query Frame = 3
Query:   51 NKAFISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI-LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            N   ++ S    +  + NK AL+T ++ G+G A A    Q GA++V++ R   N+       +     E   +   +  +   +D  +L    +     +DIL++NA +     +I  V+ + +D  +++N++A   +T  + P + K   GS+V VSS+A     PG   Y + K  L   T+  A++LA + +RVN + PG+I T   +   MD+   +   +    T  + R G P + A  ++FL S  +S+ TG T  V GG
Sbjct:   15 NSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQG----EGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKE----TLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG 273          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Match: DHRS4 (dehydrogenase/reductase 4 [Source:HGNC Symbol;Acc:HGNC:16985])

HSP 1 Score: 103.99 bits (258), Expect = 2.482e-25
Identity = 73/267 (27.34%), Postives = 129/267 (48.31%), Query Frame = 3
Query:   51 NKAFISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI-LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            N   ++ S    +  + NK AL+T ++ G+G A A    Q GA++V++ R   N+       +     E   +   +  +   +D  +L    +     +DIL++NA +     +I  V+ + +D  +++N++A   +T  + P + K   GS+V VSS+A     PG   Y + K  L   T+  A++LA + +RVN + PG+I T   +   MD+   +   +    T  + R G P + A  ++FL S  +S+ TG T  V GG
Sbjct:   15 NSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQG----EGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKE----TLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG 273          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Match: Y47G6A.21 (pep chromosome:WBcel235:I:3551949:3559807:-1 gene:WBGene00021646.1 transcript:Y47G6A.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.21)

HSP 1 Score: 228.409 bits (581), Expect = 6.785e-74
Identity = 113/252 (44.84%), Postives = 169/252 (67.06%), Query Frame = 3
Query:  111 ALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            A+ITGASSG+G+ TA LF +    L +TGRN D+LK+ A LC     +    +++   +L++++  + + + T+ +F ++D LIN+AGIL    +    ++ +D  +N+N+R++I+LT    P +I  KG++VNVSS+ G   F G+  YC+ K+ +DQFT+C AL++A  GVRVNAV PGVI+T+IH+ +G DE+ Y  FL++++ THALGR G   EVA +I FL+S  SSFTTG    VDGGR  M PR
Sbjct:    4 AIITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCISEGAISADDILITAVELSSDEAPKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIITTKGTVVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNIHRASGQDEATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTGQLLKVDGGRGIMHPR 255          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Match: Y47G6A.22 (pep chromosome:WBcel235:I:3559923:3562851:-1 gene:WBGene00021647.1 transcript:Y47G6A.22.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.22)

HSP 1 Score: 212.231 bits (539), Expect = 1.162e-67
Identity = 113/252 (44.84%), Postives = 164/252 (65.08%), Query Frame = 3
Query:  111 ALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            A++TGASSG+GRA A L  +    L +TGRN   L + A         +N  LV  + +LA+E+  + + + T+ +F ++D LIN+AGIL    +    ++ +D  +N+N+R++I+LT    P +I  KG++VNVSS+ G   FP +  YC+ K+ +DQFT+C AL++A  GVRVNAV PGV +T++H+ +G DE+ Y  FL+R++ THALGR G+  EVA +I FLAS  SSFTTG    VDGGR  M PR
Sbjct:    4 AIVTGASSGIGRAAALLLARNNYKLSLTGRNVAALNELAGQIVSAGSDKNDVLVTAV-ELASEEAPKTIVDATVQKFGRIDTLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIITTKGTVVNVSSINGPCPFPNVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVTVTNLHRTSGQDETTYSAFLERSKTTHALGRPGDANEVAEAIYFLASEKSSFTTGELLRVDGGRGIMHPR 254          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Match: dhs-14 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9N5G3])

HSP 1 Score: 184.111 bits (466), Expect = 2.500e-56
Identity = 112/264 (42.42%), Postives = 156/264 (59.09%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQ----FDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSV-AGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMD---ESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPA-SSFTTGATFPVDGG 845
            M +FS   K AL+TG+S+G+GRATA L  Q GA + ITGRN D L++T     K  V E+  L +   DLA E    +L   T+ +F +LDIL+NNAG   ND    V +DQ    +D  + +N+R+V+ LT      L+KAKG +VNVSS+ AG ++ P  M Y + KA LDQ+TR AA+DL + GVRVN+V+PG ++T   +  GM       Y  F++  +     G+ G PI++A  IAFLA    SS+  G +   DGG
Sbjct:    1 MTRFS--GKVALVTGSSNGIGRATAVLLAQEGAKVTITGRNADRLEETRQEILKSGVPEDHVLSI-ATDLATEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDRIMQINMRSVVTLTQKAKEHLVKAKGEVVNVSSIGAGPQAQPTFMYYAMSKAALDQYTRSAAIDLIQYGVRVNSVSPGAVVTGFGEAMGMPADMHEKYGHFMESRKECIPCGKMGQPIDIANIIAFLADRKLSSYIIGQSIVADGG 261          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Match: R05D8.9 (pep chromosome:WBcel235:V:2766271:2767503:-1 gene:WBGene00019886.1 transcript:R05D8.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R05D8.9)

HSP 1 Score: 183.341 bits (464), Expect = 4.680e-56
Identity = 111/264 (42.05%), Postives = 160/264 (60.61%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQ----FDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGS-KSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQE---FLQRAQLTHALGRFGNPIEVAYSIAFLASPA-SSFTTGATFPVDGG 845
            +++FS   K AL+TG+S+G+GRA A LF + GA + +TGRN + L++T     K  V E+  L +   DLA E    +L   T+ +F +LDIL+NNAG   ND    V +DQ    +D  + +N+R+V+ LT      L+KAKG IVNVSS+AG+  + PG+M Y + K+ LDQFTRCAA+DL + GVRVN+V+PG + T   +  GM   A++E   F++  +     G    PI++A  IAFLA    SS+  G +   DGG
Sbjct:    2 LSRFS--GKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSV-ATDLAAEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINMRSVVTLTQKAKEHLVKAKGEIVNVSSIAGTAHAQPGVMYYAMSKSALDQFTRCAAIDLIQYGVRVNSVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPIDIANIIAFLADRKLSSYIIGQSIVADGG 262          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Match: R05D8.7 (pep chromosome:WBcel235:V:2761825:2763208:-1 gene:WBGene00019885.1 transcript:R05D8.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R05D8.7)

HSP 1 Score: 178.718 bits (452), Expect = 3.765e-54
Identity = 109/264 (41.29%), Postives = 156/264 (59.09%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQ----FDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSS-VAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQE---FLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTT-GATFPVDGG 845
            M +FS  NK  +ITG+S+G+GR TA LF Q GAN+ ITGR+ + L++T  +  K  V E Q +   +AD+  ED   ++   TL +F ++D+L+NNAG  + D   T   DQ    +   + LNL+AVI++T  + P L+ +KG IVNVSS VAG ++ P  + Y I KA LDQ+TR  A+DLAK G+RVN+V+PG++ T      GM + A Q+   F+   +    +G  G P  +A  I FLA    SF   G +   DGG
Sbjct:    1 MPRFS--NKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQ-VNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGG 261          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Match: CG31548 (gene:FBgn0051548 transcript:FBtr0078736)

HSP 1 Score: 288.115 bits (736), Expect = 3.142e-97
Identity = 139/254 (54.72%), Postives = 184/254 (72.44%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            K  LITGASSG+G ATA  F + GA L + GRN +NLK  A  C K   +   +  + + D+A E D +++  +TL ++ +LD+L+NNAGI+   TIET S++Q+D  +N NLRA+  LT L TP L+K KG+IVNVSSV G +SFPG+++Y I K G+DQFTRC AL+LA KGVRVN VNPGV +T++H R GMD   Y++FL+ ++ THALGR G+  EVA +IAFLAS  +SF+TG + PVDGGRHAMCPR
Sbjct:    6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSK---VSQSQPALVVGDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Match: CG12171 (gene:FBgn0037354 transcript:FBtr0078708)

HSP 1 Score: 277.33 bits (708), Expect = 5.919e-93
Identity = 136/258 (52.71%), Postives = 187/258 (72.48%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            S  +K  ++TGASSG+G  T+ L  +LG  L I GRN D L +TA   E+         +   AD+ +E D++ +   TL++  ++D+L+NNAGIL   +IE  S++QFD  +N N+R++ QLTHL+TP LIK KG+IVNVSSV G +SFPG+++Y + KA +DQFTRC AL+LA KGVRVN+VNPGVI+T++ +R G+D+ AY +FL+ A++THALGR G   EVA +IAFLAS  +SF+TG + PVDGGRHAMCPR
Sbjct:    3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETA---EQIVAAGGAPALQVAADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Match: CG31549 (gene:FBgn0051549 transcript:FBtr0078707)

HSP 1 Score: 275.404 bits (703), Expect = 2.905e-92
Identity = 136/258 (52.71%), Postives = 185/258 (71.71%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            S  +K  ++TGASSG+G + A    +LG  LVI GRN++ LK+TA   +          +   AD+  E +++++   TL++  ++D+L+NNAGIL   +IE  S++QFD  +N N+R++ QLT L TP L+K KG+IVNVSSV G ++FPG+++Y + KA +DQFT C AL+LA KGVRVNAVNPGVI+TDIHKR GMDE  Y +FL+  ++THALGR G+  EVA +IAFLAS  +SFTTG + PVDGGRHAMCPR
Sbjct:    3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETA---DNIVAAGGATPLELQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCPR 257          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Match: CG31549 (gene:FBgn0051549 transcript:FBtr0335215)

HSP 1 Score: 275.404 bits (703), Expect = 2.905e-92
Identity = 136/258 (52.71%), Postives = 185/258 (71.71%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            S  +K  ++TGASSG+G + A    +LG  LVI GRN++ LK+TA   +          +   AD+  E +++++   TL++  ++D+L+NNAGIL   +IE  S++QFD  +N N+R++ QLT L TP L+K KG+IVNVSSV G ++FPG+++Y + KA +DQFT C AL+LA KGVRVNAVNPGVI+TDIHKR GMDE  Y +FL+  ++THALGR G+  EVA +IAFLAS  +SFTTG + PVDGGRHAMCPR
Sbjct:    3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETA---DNIVAAGGATPLELQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCPR 257          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Match: CG3699 (gene:FBgn0040349 transcript:FBtr0070186)

HSP 1 Score: 228.794 bits (582), Expect = 5.416e-74
Identity = 115/259 (44.40%), Postives = 173/259 (66.80%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
             S+ NK  ++TGASSG+G A A +  + GA L + GRN  NL+ T       + ++  +  + +AD+  + D   + ++TL++F ++D+L+NNAGIL    +  + +++FD  +N NLR VI LT  + P L+K KG++VNVSS AG + F G +SY + KA LDQFT+  AL++A +GVRVN+VNPG ++T+IH+  G+ +  Y   LQRA  +H +GR G+  EVA ++AFLAS  +SFTTGA FP+DGG+H + PR
Sbjct:    1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEAT------KKSLKGTQAEIVVADVTKDAD--AIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Match: zgc:101858 (zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13])

HSP 1 Score: 290.041 bits (741), Expect = 1.019e-97
Identity = 137/258 (53.10%), Postives = 188/258 (72.87%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            S+ +K  LITGASSG+G  TA LF +LGA L + GR+ +NL   A  CE        K ++   DL +E+ +R+  E+ ++ F +LD+L+N+AGIL   +IET  M Q+D  +++N+R++  LTHL  P LIK KGSIVNVSSV G +SFPG+++YC+ K+ +DQFTRC AL+LA K VRVN+V PGVI+T++HKRAG+DE  Y +F+++ ++THALGR G   EVA++IAFLAS A++F TG   PVDGGRHAMCPR
Sbjct:   11 SLKDKVTLITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECE---ACGAAKPLLVAGDLTDEETVRRTVEEVIAHFGRLDVLVNSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLTHLCVPHLIKTKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVIITEVHKRAGLDEEQYAQFIEKCKVTHALGRPGEVDEVAHAIAFLASDAATFITGVNLPVDGGRHAMCPR 265          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Match: hsd17b8 (hydroxysteroid (17-beta) dehydrogenase 8 [Source:ZFIN;Acc:ZDB-GENE-010110-1])

HSP 1 Score: 131.724 bits (330), Expect = 4.057e-36
Identity = 86/249 (34.54%), Postives = 131/249 (52.61%), Query Frame = 3
Query:  114 LITGASSGVGRATADLFFQLGANLVITGRNDDNLKDT-ALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQL-DILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKA---KGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            L+TG  SG+GRA    F   GA++V+  RN+++   T  LL  +HR  E+  L +   D++++D + KL       + Q   + +N AGI  ++ I  +  D FD  I +NL+    +T  ++ +L+ A   KGSI+ V S+ G     G ++Y   KAG+   TR AA +L+K G+R N V PG I T       M +   ++ + +      LGR G P EVA + AFLAS  S + TG +  V GG
Sbjct:   13 LVTGGGSGIGRAVCQRFATEGASVVVADRNEESANQTLELLSREHRGQEHMALGV---DVSSKDSVEKLVTSIQRRYFQPPSVCVNAAGITQDEFILKMEEDDFDKVIKVNLKGTFLVTQAVSKALVSAGSVKGSIITVGSIVGKVGNIGQVNYASSKAGVQGLTRTAAKELSKFGIRCNCVLPGFITTP------MTDKVPEKVIDKITSIIPLGRMGEPAEVADACAFLASDDSRYITGVSIEVAGG 252          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Match: dcxr (dicarbonyl/L-xylulose reductase [Source:ZFIN;Acc:ZDB-GENE-030131-7002])

HSP 1 Score: 126.331 bits (316), Expect = 2.928e-34
Identity = 86/256 (33.59%), Postives = 126/256 (49.22%), Query Frame = 3
Query:   87 KFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKG---SIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            + S   K AL+TGA  G+GRATA    + G+ +    R   +L           V E   +     DL++ D  ++     L+    +D+L+NNA          V+ DQFDM+ N+N++A + +  ++   + KA+G   SIVNVSS A   +      YC  KA LD  TR  AL+L    +RVN+VNP V++T++ K    D    +    R      LG+F    +V  SI FL S  S+ T+G   PVDGG
Sbjct:    2 EISFRGKRALVTGAGKGIGRATALALARCGSEVTAVTRTKADLDSL--------VQECPSIKPVCVDLSDWDATKE----ALNNVGPVDLLVNNAACAKLQPFLDVTPDQFDMSFNINVKAALHVAQIVARGM-KARGTGGSIVNVSSQASQCALKDHAVYCATKAALDMLTRVMALELGPHQIRVNSVNPTVVMTEMGKIGWSDPEKARSMTSRIP----LGKFAEVEDVVNSILFLLSDKSAMTSGVMLPVDGG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Match: dhrs4 (dehydrogenase/reductase (SDR family) member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1498])

HSP 1 Score: 124.02 bits (310), Expect = 4.573e-33
Identity = 84/258 (32.56%), Postives = 134/258 (51.94%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNL-KDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI------LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            +  K A++T ++ G+G A A+   Q GA++V++ R   N+ K  +LL  K     N K++    ++   +D  KL   T+ +   +DIL++NA +      +L+ T E      +D  + +N++A   LT ++ P + K   GS+V VSSVAG +  P +  Y + K  L   TR  A +LA+  +RVN V PG+I T        +E   +EFL++  +     R G P E+   IAFL S  +S+ TG T  V GG
Sbjct:   28 LSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVSLLRSK-----NIKVIGTTCNVGKAEDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEV-----WDKILGVNVKASFLLTKMVVPHIEKRGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRFSSALWENEGVLEEFLKQTSIK----RLGQPEEIGGVIAFLCSDEASYITGETITVTGG 271          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Match: dhrs4 (dehydrogenase/reductase (SDR family) member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1498])

HSP 1 Score: 124.02 bits (310), Expect = 4.573e-33
Identity = 84/258 (32.56%), Postives = 134/258 (51.94%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNL-KDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI------LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            +  K A++T ++ G+G A A+   Q GA++V++ R   N+ K  +LL  K     N K++    ++   +D  KL   T+ +   +DIL++NA +      +L+ T E      +D  + +N++A   LT ++ P + K   GS+V VSSVAG +  P +  Y + K  L   TR  A +LA+  +RVN V PG+I T        +E   +EFL++  +     R G P E+   IAFL S  +S+ TG T  V GG
Sbjct:   28 LSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVSLLRSK-----NIKVIGTTCNVGKAEDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEV-----WDKILGVNVKASFLLTKMVVPHIEKRGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRFSSALWENEGVLEEFLKQTSIK----RLGQPEEIGGVIAFLCSDEASYITGETITVTGG 271          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Match: mpp7 (membrane protein, palmitoylated 7 [Source:Xenbase;Acc:XB-GENE-950404])

HSP 1 Score: 298.13 bits (762), Expect = 1.062e-100
Identity = 142/259 (54.83%), Postives = 192/259 (74.13%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
             ++ +K  L+TGASSG+G  TA LF +LGA L + GRN++ L++TA  CE+   M   K ++   DL +E+ +RK+ E+T++ F +LD+L+N+ GIL   T+E  S+  FD  +N+N+R++  LTHL  P LI+ KG+IVNVSSV G +SFPG+++YC+ K+ +DQ TRCAAL+LA K VRVNAV PGVI+TD+H+RAG++E  Y EF+QR Q THALGR G   EVA +IAFLAS A+SF TG T PVDGGRHAMCPR
Sbjct:    9 INLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFSGM---KPLLVPGDLTDEESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHLIQTKGNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRAGLNEEQYSEFIQRTQHTHALGRPGTVDEVAQTIAFLASDAASFITGVTMPVDGGRHAMCPR 264          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Match: dcxr (dicarbonyl/L-xylulose reductase [Source:NCBI gene;Acc:394704])

HSP 1 Score: 130.183 bits (326), Expect = 1.518e-35
Identity = 82/249 (32.93%), Postives = 128/249 (51.41%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            + AL+TGA  G+GR T     + GA +V   R  ++L+  A  C        Q + + LAD +         EK LS    +D+L+NNA + +      V+ + FD +  +N++AV+ ++ ++   +I+    G+IVNVSS A   +      YC  K  LD  T+   L+L  K +RVN+VNP V++T++ +    D    +  L+R      +GRF    +V +SI FL S  SS  TG+  PVDGG
Sbjct:    8 QRALVTGAGKGIGRETVKALRKTGAEVVALSRTFEDLESLAQECPG-----VQTVCVDLADWSA-------TEKALSSIGPVDLLVNNAAVAVLQPFLAVTEEAFDKSFAVNVKAVLHVSQIVVHQMIERGVPGAIVNVSSQASQCALQDHSVYCATKGALDMLTKVMTLELGPKKIRVNSVNPTVVMTEMGRIGWSDPQKSEPMLKRI----PMGRFAEVEDVVHSILFLLSDKSSMITGSCLPVDGG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Match: dhrs4 (dehydrogenase/reductase (SDR family) member 4 [Source:NCBI gene;Acc:548501])

HSP 1 Score: 115.546 bits (288), Expect = 1.231e-29
Identity = 77/255 (30.20%), Postives = 132/255 (51.76%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGI-LLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLI-KAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHA 854
            +  K AL+T ++ G+G A A    Q GA ++++ R   N+ D A+   +   +E +  V     + N++D  +L E  +  F  +DIL++NA +     +I   + + +D  +++N++A   L  L+ P +  +  GSIV VSSVAG   FP +  Y + K  L   T+  A +L+   +RVN + PG+I T        +E+  +  +     T  + R G P + A +++FL SP +S+ TG T  V GG H+
Sbjct:   34 LQGKVALVTASTEGIGLAIARRLGQDGARVLLSSRKQQNV-DRAVQDLRKEGIEVEGTV---CHVGNKEDRERLIETAVQRFGGVDILVSNAAVNPFAGSILESNEEVWDKILDVNVKATFLLVKLVVPKMQERGGGSIVIVSSVAGFTPFPSLGPYSVSKTALLGLTKALAPELSPLNIRVNCLAPGLIRTKFSSALWKNEAVCEHLMS----TLGISRIGQPDDCAGAVSFLCSPDASYITGETIVVSGGSHS 280          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Match: dcxr (dicarbonyl/L-xylulose reductase [Source:NCBI gene;Acc:394704])

HSP 1 Score: 114.39 bits (285), Expect = 1.552e-29
Identity = 80/254 (31.50%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQ-----LTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            + AL+TGA  G+GR T     + GA +V   R  ++L+  A  C        Q + + LAD +         EK LS    +D+L+NNA + +      V+ + FD  I       +         ++   +I+    G+IVNVSS A   +      YC  K  LD  T+   L+L  K +RVN+VNP V++T++ +    D    +  L+R      +GRF    +V +SI FL S  SS  TG+  PVDGG
Sbjct:    8 QRALVTGAGKGIGRETVKALRKTGAEVVALSRTFEDLESLAQECPG-----VQTVCVDLADWSA-------TEKALSSIGPVDLLVNNAAVAVLQPFLAVTEEAFDKKITQGFAVSLADYSYVFHQIVVHQMIERGVPGAIVNVSSQASQCALQDHSVYCATKGALDMLTKVMTLELGPKKIRVNSVNPTVVMTEMGRIGWSDPQKSEPMLKRI----PMGRFAEVEDVVHSILFLLSDKSSMITGSCLPVDGG 245          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Match: hmgb1 (high mobility group box 1 [Source:Xenbase;Acc:XB-GENE-1001206])

HSP 1 Score: 107.071 bits (266), Expect = 1.247e-26
Identity = 79/249 (31.73%), Postives = 126/249 (50.60%), Query Frame = 3
Query:  111 ALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEF-VQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK---GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            AL+TG  SG+GRA        GA++V+    D +  +  L    H  +  Q+   F  D++  + +  L +K    + V   I I++AGI  ++ +  +S + FD  +N+NL+    +T  +  +++ +    GSI+N+ S+ G     G  +Y   KAG++  T+ AA +LAK G+R N V PG I T       M +   Q+ L +      LGR G P ++A   AFLAS  S + TGA+  V GG
Sbjct:   18 ALVTGGGSGIGRAICQRLSVEGASVVVVDL-DISSANATLQTLSHN-LSGQEHAAFATDVSKANHVNSLMQKIQGRYSVPPRIAISSAGITKDEFLLRLSEESFDSVLNVNLKGPFLITQAVARAIVASGEHGGSIINIGSIVGKVGNLGQSNYAASKAGVEGLTKTAAKELAKFGIRCNTVLPGFISTP------MTDKVPQKVLDKFAGMVPLGRLGYPEDIADVCAFLASDDSKYITGASIEVTGG 258          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Match: Dcxr (dicarbonyl L-xylulose reductase [Source:MGI Symbol;Acc:MGI:1915130])

HSP 1 Score: 130.568 bits (327), Expect = 8.376e-36
Identity = 86/254 (33.86%), Postives = 126/254 (49.61%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
              +  + AL+TGA  G+GR+T       GA +V   R  ++L D    C        + + + LAD        +  E+ LS    +D+L+NNA + L      V+ +  D + N+NLRAVIQ++ ++   +I     G+IVNVSS A  ++      YC  K  LD  T+  AL+L    +RVNAVNP V++T + +    D    +  L R      LG+F     V  +I FL S  S  TTG+T PVDGG
Sbjct:    3 LGLAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVRECPGV-----EPVCVDLADW-------EATEQALSNVGPVDLLVNNAAVALLQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGVPGAIVNVSSQASQRALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTPMGRTNWSDPHKAKAMLDRI----PLGKFAEVENVVDTILFLLSNRSGMTTGSTLPVDGG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Match: Cbr2 (carbonyl reductase 2 [Source:MGI Symbol;Acc:MGI:107200])

HSP 1 Score: 124.405 bits (311), Expect = 1.740e-33
Identity = 82/255 (32.16%), Postives = 128/255 (50.20%), Query Frame = 3
Query:   87 KFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            K +     AL+TGA  G+GR T       GA +V   R + +L   A  C          +     DL + D      EK L     +D+L+NNA +++      V+ + FD + ++NLR+V Q++ ++   +I     GSIVNVSS+    +FP +++Y   K  +   T+  A++L    +RVN+VNP V+LTD+ K+     SA  EF ++ +  H L +F    +V  SI FL S  S+ T+G    VD G
Sbjct:    2 KLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPG--------IEPVCVDLGDWD----ATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKV----SADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Match: Hsd17b14 (hydroxysteroid (17-beta) dehydrogenase 14 [Source:MGI Symbol;Acc:MGI:1913315])

HSP 1 Score: 117.472 bits (293), Expect = 1.441e-30
Identity = 80/251 (31.87%), Postives = 119/251 (47.41%), Query Frame = 3
Query:  102 NKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQ--KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTI-ETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
             K  ++TG S G+G A    F   GA +V   +++             R +E +    V    D+  E D++ L  +TLS F  LD ++NNAG      + E  S   F   + +NL     L  L  P L K++G+I+N+SS+ G+      ++Y   K  +   T+  ALD ++ GVRVN ++PG I T + +      S  +  +    L   LGR G P EVA +  FLAS A +F TG    V GG
Sbjct:    9 GKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAG----------GRALEQELSGTVFIPGDVTQERDLQTLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLLGTYTLIKLALPHLRKSRGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISPGNIWTPLWEELAASTSDPRATILEGTLAQPLGRMGQPAEVAAAAVFLASEA-TFCTGLELLVTGG 248          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Match: Dcxr (dicarbonyl L-xylulose reductase [Source:MGI Symbol;Acc:MGI:1915130])

HSP 1 Score: 107.842 bits (268), Expect = 2.221e-27
Identity = 82/254 (32.28%), Postives = 121/254 (47.64%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK--AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
              +  + AL+TGA  G+GR+T       GA +V   R  ++L D    C        + + + LAD        +  E+ LS    +D+L+NNA + L      V+ +  D + N+NLRAVIQ++ ++   +I     G+IVNVSS A  ++      Y         FT  A+L      +RVNAVNP V++T + +    D    +  L R      LG+F     V  +I FL S  S  TTG+T PVDGG
Sbjct:    3 LGLAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVRECPGV-----EPVCVDLADW-------EATEQALSNVGPVDLLVNNAAVALLQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGVPGAIVNVSSQASQRALTNHTVYWCPPM---LFTLLASLQ-----IRVNAVNPTVVMTPMGRTNWSDPHKAKAMLDRI----PLGKFAEVENVVDTILFLLSNRSGMTTGSTLPVDGG 232          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Match: Cbr4 (carbonyl reductase 4 [Source:MGI Symbol;Acc:MGI:2384567])

HSP 1 Score: 106.686 bits (265), Expect = 6.209e-27
Identity = 79/249 (31.73%), Postives = 120/249 (48.19%), Query Frame = 3
Query:  102 NKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTA-LLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            +K   + G S G+GRA A L  Q G  L I  RN +  K TA  L   H        + F  D+A E D++   ++       ++ L+N AGI  +  +     +     ++ NL   +        ++I+  GSIVNV S+ G K   G  +Y   K GL  F+R  A ++A+K +RVN V PG I TD+ +   + E  +++ +        LGRFG  +EVA+++ FL    S + TG    VDGG
Sbjct:    2 DKVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSRNLEVAKVTAGELGGNH--------LAFRCDVAKEQDVQSTFQEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQGGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRH--LKEEHFKKNI-------PLGRFGETLEVAHAVVFLLE--SPYITGHVLIVDGG 231          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Match: sp|Q9X248|FABG_THEMA (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) OX=243274 GN=fabG PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 4.277e-45
Identity = 96/253 (37.94%), Postives = 148/253 (58.50%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
              +  K  LITGA+SG+G+AT  LF Q GA ++    + +NL   +L+ E   +    K+  ++ ++ + D I+++ EK + ++ ++D+L+NNAGI  +  +  +  + +D  IN+NL+ V  +T ++ P +IK + GSIVNVSSV G    PG  +Y   KAG+   T+  A +LA + +RVNAV PG I T + ++  + E A +  L R      LGRFG P EVA  I FLAS  SS+ TG    +DGG
Sbjct:    1 MRLEGKVCLITGAASGIGKATTLLFAQEGATVIAGDISKENLD--SLVKEAEGL--PGKVDPYVLNVTDRDQIKEVVEKVVQKYGRIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIKQRNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEK--LPEKARETALSRI----PLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGG 243          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Match: sp|P51831|FABG_BACSU (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) OX=224308 GN=fabG PE=3 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 1.645e-41
Identity = 88/251 (35.06%), Postives = 146/251 (58.17%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            +++K A++TGAS G+GR+ A    + GAN+V+    ++  K   ++ E   +   +K +   AD++N +D++ + ++TLS F  +DIL+NNAGI  ++ I  +  D++D  IN+NL+ V   T  +T  ++K + G I+NVSS+ G    PG  +Y   KAG+   T+ +A +LA + + VNA+ PG I TD+  +   D     E L++      L RFG P +V+  + FLAS  + + TG T  +DGG
Sbjct:    2 LNDKTAIVTGASRGIGRSIALDLAKSGANVVVNYSGNE-AKANEVVDEIKSM--GRKAIAVKADVSNPEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDMTDKLAKD--VQDEMLKQI----PLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDGG 243          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Match: sp|P50941|FABG_RICPR (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=fabG PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 5.262e-40
Identity = 93/249 (37.35%), Postives = 144/249 (57.83%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQ-FDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            K +LITGASSG+G A A L  +LG+ ++I+G N++ LK      + +  +E       + +LAN+++   L  KT      LDIL+ NAGI  +DT+     DQ FD  I++NL+A   L       +I+ + G I+N+SS+ G    PG  +YC  KAGL   T+  + ++A +G+ VNAV PG I +D+  +  ++E   +  +Q+      LG +G P +VAY++AFLAS  +S+ TG T  V+GG
Sbjct:    7 KTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIE-------VCNLANKEECSNLISKT----SNLDILVCNAGIT-SDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDK--LNEKQREAIVQKI----PLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGG 237          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Match: sp|Q9PKF7|FABG_CHLMU (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=fabG PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 7.318e-39
Identity = 87/250 (34.80%), Postives = 141/250 (56.40%), Query Frame = 3
Query:  102 NKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTAL-LCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            NK A++TG S G+G   A LF + GAN+ I G N++  K  A  L +K       K+   L D++  D +    +K L+E+  +D+++NNAGI  +  +  +S +++   I+ NL ++  +   +   +IKA+ G+IVN+SS+ G +  PG  +Y   KAG+  F++  + ++  K +RVN + PG I TD+ K  G+ ++   E+L+       LGR G P E+A +  FLAS  SS+ TG    VDGG
Sbjct:    7 NKAAIVTGGSRGIGFGIAKLFAEHGANVQIWGINEEAGKSAAQDLSDKT----GSKVSFALVDVSKNDMVSAQVQKFLAEYGTIDVVVNNAGITRDSLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSGAIVNISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTK--GLSDNLKNEWLKGV----PLGRVGTPEEIAMAALFLASNQSSYITGQVLSVDGG 246          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Match: sp|Q68VY7|FABG_RICTY (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=fabG PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.762e-39
Identity = 91/249 (36.55%), Postives = 144/249 (57.83%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQ-FDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            K +LITGAS G+G A A L  +LG+ ++I+G N+  LK      + + ++E       + +LAN+++   L    +S+   LDIL+ NAGI  +DT+     DQ FD  I++NL+A   L       +I+ + G I+N+SS+ G    PG  +YC  KAGL   T+  + ++A +G+ VNAV PG I +D+  +  ++E   +  +Q+      LG +G P +VAY++AFLAS  +S+ TG T  V+GG
Sbjct:    7 KTSLITGASGGIGSAIARLLHKLGSKVIISGSNEKKLKLLGNTLKDNYIIE-------VCNLANKEECNNL----ISKISNLDILVCNAGIT-SDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDK--LNEKQREAIVQKI----PLGTYGIPEDVAYAVAFLASNHASYITGQTLHVNGG 237          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Match: A0A0M3K9K7 (Uncharacterized protein OS=Anisakis simplex OX=6269 GN=ASIM_LOCUS17055 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 2.353e-101
Identity = 152/257 (59.14%), Postives = 195/257 (75.88%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQ---KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            K ALITGA+SG+GRATA LF +LGA++VITGR  D L+  A    K+    +    +   F ADL   +DI+ LAE  + +F +LDIL+NNAGIL N TIE  S+DQFD  +N+NLRAV  LT+LL P LI++KGS+VNVSSV G +SFP +++Y + K+G+DQ TRCAAL+LA KGVRVN VNPGV +T++H+R+GM+E AYQ F++ ++ THALGR G P EVA +IAFLAS A+SF TGA+ PVDGGRHAMCPR
Sbjct:   11 KVALITGATSGIGRATAILFNKLGASIVITGRATDRLEALAEELSKNEGSRDSFKGETYPFTADLTKSEDIKSLAEAAIKKFNKLDILVNNAGILENGTIENTSLDQFDHMMNVNLRAVFYLTNLLCPHLIQSKGSVVNVSSVNGMRSFPNVLAYNVSKSGVDQLTRCAALELASKGVRVNCVNPGVTMTELHRRSGMNEEAYQSFIEHSKSTHALGRAGTPEEVANAIAFLASDAASFITGASLPVDGGRHAMCPR 267          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Match: Q66IW5 (MGC84267 protein OS=Xenopus laevis OX=8355 GN=mgc79752 PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 3.608e-100
Identity = 145/259 (55.98%), Postives = 193/259 (74.52%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
             ++ +K  L+TGASSG+G  TA LF +LGA L + GRN++ L++TAL CE++      K ++   DL +E+ +RK+ E+T++ F QLD+L+N+ GIL   T+E  S+  FD  +N+N+RA+  LTHL  P LIK KG+I+NVSSV G +SFPG+++YC+ K+ +DQ TRCAAL+LA K VRVNAV PGVI+TD+H+RAG++E  Y EFLQR Q THALGR G   EVA +IAFLAS A+SF TG T PVDGGRHAMCPR
Sbjct:   14 INLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETALACEQY---SGVKPLLVPGDLTDEECVRKIIEETVAHFGQLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRAIFYLTHLAVPHLIKTKGNIINVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRAGLNEEQYSEFLQRTQHTHALGRPGTVDEVAQTIAFLASDAASFITGVTLPVDGGRHAMCPR 269          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Match: A0A0L8HGD3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22015006mg PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.431e-100
Identity = 153/262 (58.40%), Postives = 195/262 (74.43%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            M+  ++  K ALI+GASSG+G  TA LF +LGA L ITGR +DNLK TA  CEK+      K +M +ADL+ EDD++ + EKT+S F +L+IL+N AGIL N +IET S+ QFD   N+N+R++ QLT L  P LI  +GSIVNVSSV G +SFPG+++Y + K+ LDQFT   AL+LA K VRVN+VNPGVI+T+IHKR GM E AY +FL++++ THALGR G   EV+ +IAFLAS ASSF TGA  PVDGGRHAMCPR
Sbjct:    1 MDMCNLSGKVALISGASSGIGAGTAVLFSKLGAKLAITGRKEDNLKKTADECEKN----GSKPLMVVADLSKEDDVKTVMEKTISHFGKLNILVNCAGILANGSIETTSLKQFDEVFNINVRSIYQLTMLAVPHLITTQGSIVNVSSVNGIRSFPGVLAYNMSKSALDQFTCTVALELASKKVRVNSVNPGVIVTEIHKRGGMSEEAYAQFLEKSRGTHALGRAGQVDEVSKAIAFLASDASSFITGALLPVDGGRHAMCPR 258          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Match: A0A1L8EZE9 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18045808mg PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 6.157e-100
Identity = 145/259 (55.98%), Postives = 193/259 (74.52%), Query Frame = 3
Query:   90 FSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
             ++ +K  L+TGASSG+G  TA LF +LGA L + GRN++ L++TAL CE++      K ++   DL +E+ +RK+ E+T++ F QLD+L+N+ GIL   T+E  S+  FD  +N+N+RA+  LTHL  P LIK KG+I+NVSSV G +SFPG+++YC+ K+ +DQ TRCAAL+LA K VRVNAV PGVI+TD+H+RAG++E  Y EFLQR Q THALGR G   EVA +IAFLAS A+SF TG T PVDGGRHAMCPR
Sbjct:   14 INLKDKVCLVTGASSGIGGGTALLFARLGARLALNGRNEEKLQETALACEQY---SGVKPLLVPGDLTDEECVRKIIEETVAHFGQLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRAIFYLTHLAVPHLIKTKGNIINVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRAGLNEEQYSEFLQRTQHTHALGRPGTVDEVAQTIAFLASDAASFITGVTLPVDGGRHAMCPR 269          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Match: A0A2D0PRY4 (3-oxoacyl-[acyl-carrier-protein] reductase FabG-like OS=Ictalurus punctatus OX=7998 GN=LOC108255950 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 5.317e-99
Identity = 145/268 (54.10%), Postives = 196/268 (73.13%), Query Frame = 3
Query:   63 ISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            ++ S  +   S+ +K ALITGASSG+G  TA LF +LGA L + GR+ D L   A  CE+      +K ++   DL +ED ++K  E+T++ F +LD+LIN+AGIL   TIET  + Q+D  +N+N+R+V  LTHL  P LI+ KGSIVNVSSV G +SFPG+++YC+ K+ +DQFTRC AL+LA K VRVN+V PGVI+T++HKRAG+DE  Y++FL++ ++THALGR G   EVA +IAFLAS A++F TG T PVDGGRHAMCPR
Sbjct:    1 MATSGAIRVCSLEDKVALITGASSGIGAGTALLFARLGAQLALNGRDMDKLSKLAKECEE---CGGKKPLLVPGDLTDEDTVKKTVEETVAHFGRLDVLINSAGILAMGTIETTDLAQYDKVMNVNVRSVYHLTHLCVPHLIQTKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELAPKQVRVNSVGPGVIITEVHKRAGLDEEQYKQFLEKCKVTHALGRPGEVGEVAQAIAFLASDAATFITGVTLPVDGGRHAMCPR 265          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Match: zgc:101858 (zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13])

HSP 1 Score: 301.597 bits (771), Expect = 2.367e-102
Identity = 149/266 (56.02%), Postives = 193/266 (72.56%), Query Frame = 3
Query:   69 LSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            LS+     S+ +K  LITGASSG+G  TA LF +LGA L + GR+ DNL   A  CE+     + K ++   DL NED +RK  E+T+S F +LD+LIN+AGIL   TIET  + Q+D  +N+N+R+V  LT L  P LIK KGSIVNVSSV G +SFPG++ YC+ K+ +DQFTRC AL+LA K VRVN+V PGVI+T++HKRAG+DE  Y++FL++ ++THALGR G   EVA+SIAFLAS A++F TG   PVDGGRHAMCPR
Sbjct:    1 LSSEEGMNSLKDKVTLITGASSGIGAGTALLFAKLGAQLALNGRDLDNLTKIAKECEE---CGSSKPLLVPGDLTNEDTVRKTVEQTISHFGRLDVLINSAGILAMGTIETADLAQYDKVMNVNVRSVFHLTQLCVPHLIKTKGSIVNVSSVNGQRSFPGVLPYCMSKSAIDQFTRCVALELACKQVRVNSVCPGVIVTEVHKRAGLDEEQYKQFLEKCKVTHALGRPGEVDEVAHSIAFLASDAATFITGVNLPVDGGRHAMCPR 263          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Match: zgc:101858 (zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13])

HSP 1 Score: 301.982 bits (772), Expect = 9.786e-102
Identity = 148/268 (55.22%), Postives = 195/268 (72.76%), Query Frame = 3
Query:   63 ISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            +S +++    S+ +K  LITGASSG+G  TA LF +LGA L + GR+ DNL   A  CE+     + K ++   DL NED +RK  E+T+S F +LD+LIN+AGIL   TIET  + Q+D  +N+N+R+V  LT L  P LIK KGSIVNVSSV G +SFPG++ YC+ K+ +DQFTRC AL+LA K VRVN+V PGVI+T++HKRAG+DE  Y++FL++ ++THALGR G   EVA+SIAFLAS A++F TG   PVDGGRHAMCPR
Sbjct:    1 MSSADSYKVSSLKDKVTLITGASSGIGAGTALLFAKLGAQLALNGRDLDNLTKIAKECEE---CGSSKPLLVPGDLTNEDTVRKTVEQTISHFGRLDVLINSAGILAMGTIETADLAQYDKVMNVNVRSVFHLTQLCVPHLIKTKGSIVNVSSVNGQRSFPGVLPYCMSKSAIDQFTRCVALELACKQVRVNSVCPGVIVTEVHKRAGLDEEQYKQFLEKCKVTHALGRPGEVDEVAHSIAFLASDAATFITGVNLPVDGGRHAMCPR 265          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Match: dcxr (dicarbonyl and L-xylulose reductase [Source:NCBI gene;Acc:103036447])

HSP 1 Score: 124.79 bits (312), Expect = 9.759e-34
Identity = 86/256 (33.59%), Postives = 126/256 (49.22%), Query Frame = 3
Query:   87 KFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKG---SIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            + +   K AL+TGA  G+GRATA    + GA +    R   +L+          V E   +     DLAN        E  L     +D+L+NNAG     +   ++ D+FD++ N+N++A + +  ++   + KA+G   SIVNVSS A   +      YC  K  LD  TR  AL+L    +RVN+VNP V++TD+ K    D    +  + R      LG+F    +V  SI FL S  S+ T G T P+DGG
Sbjct:    2 EITFTGKRALVTGAGKGIGRATALALARGGAEVTAVTRTKADLESL--------VQECPSINPVCVDLANWG----ATETALKNVGPIDLLVNNAGCAKLQSFFEITEDEFDISFNVNVKAALHVAQIVGRGM-KARGRGGSIVNVSSQAAQCAVKDHAVYCATKGALDMLTRVMALELGPHQIRVNSVNPTVVMTDMGKIGWSDPVKAKTMMSRIP----LGKFAEVEDVVNSILFLLSDKSAMTNGVTLPIDGG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Match: pecr (peroxisomal trans-2-enoyl-CoA reductase-like [Source:NCBI gene;Acc:103028150])

HSP 1 Score: 111.309 bits (277), Expect = 4.160e-28
Identity = 76/256 (29.69%), Postives = 130/256 (50.78%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQ---KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKG-SIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQE----FLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGR 848
            K A++TG  SG+G+A +    QLG N+VI  R  + L+  A    K  + E+    ++     ++ +E+++R L   TL    ++D L+NN G   +     +S+  ++  I+ NL         +  S ++  G +IVN+ +    K FPG+      ++ +D  T+  A++ A  GVR+N+V PG I +    +  M+   Y+E      Q+A       R G P E++ ++ FL SPA+SF +GAT  VD G+
Sbjct:   15 KVAIVTGGGSGIGKAISAELLQLGCNVVIASRKLERLEAAATEL-KRNIPESSVPAQVTPIRCNIRDEEEVRNLVASTLKLHGRIDFLVNNGGGQFSSPAAGMSLKGWNAVIDTNLTGTFLCCREVYNSWMRDHGGAIVNIIADMW-KGFPGMAHTGAARSAVDNLTKSLAIEWADSGVRINSVAPGTIFS----KTAMEN--YKEIGPVLFQKAVPCIPAKRLGFPEEISPAVCFLLSPAASFISGATLKVDAGQ 262          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Match: dhrs4 (dehydrogenase/reductase SDR family member 4-like [Source:NCBI gene;Acc:103023174])

HSP 1 Score: 108.227 bits (269), Expect = 3.053e-27
Identity = 82/261 (31.42%), Postives = 131/261 (50.19%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGIL-----LNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            M+  S+  K A++T ++ G+G A A    + GA++V++ R   N+ D A+        EN +++    ++  E D  KL   TL +   +DIL++NA +      + D+ + V    FD+N+    +A   LT  + P + K   GS++ VSSVAG +  P +  Y + K  L   TR  A +LA   +RVN V PG+I T         E    EF++  QL   + R G P ++   +AFL S  +++ TG T  V GG
Sbjct:   20 MSHSSLAGKVAIVTASTDGIGLAAAQALGKRGAHVVVSSRKQANV-DKAV---SQLRSENIQVIGTSCNVGIEQDREKLISLTLEKCGGIDILVSNAAVNPFFGNILDSTDEVWTKIFDVNV----KASFLLTKQVVPHMEKRGGGSVLFVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAHSNIRVNCVAPGIIKTRFSSALWQSEDVTNEFMK--QL--CIKRLGVPEDIGGVVAFLCSDDAAYITGETITVTGG 268          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Match: bdh2 (3-hydroxybutyrate dehydrogenase, type 2 [Source:NCBI gene;Acc:550507])

HSP 1 Score: 103.605 bits (257), Expect = 2.034e-26
Identity = 77/258 (29.84%), Postives = 128/258 (49.61%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCI---GKAGLDQFTRCAALDLAKKGVRVNAVNPGVILT-DIHKRAGMD---ESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            +  K  ++T A  G+GRA A  F + GA ++ T  N + LK+   +           + + + ++ ++D I  LA K      ++D+L N AG + + TI       +D  +NLN++ +  +     P ++  K GSI+N++SVA   S  G+ + C+    KA +   T+  A D   +G+R NAV PG + T  + +R       E A Q+F+ R +     GR   P EVA+   +LAS  S++ TG    +DGG
Sbjct:    4 LDGKVVVLTAAGQGIGRACAIAFAKEGAKVIATDINGEALKELEQI---------PGIEVGVLNVTSKDQIEALAAK----IDKVDVLFNCAGFVHHGTILDCEDKDWDFTMNLNVKGMYYMIRAFLPKMLAQKSGSIINMASVA--SSIKGVANRCVYSTSKAAIIGLTKSVAADFLTEGIRCNAVCPGTVDTPSLQERINAQPDPEKARQDFMARQKS----GRLAKPEEVAHLCVYLASDESAYVTGNEMVIDGG 242          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Match: dhrs4 (dehydrogenase/reductase (SDR family) member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1498])

HSP 1 Score: 100.908 bits (250), Expect = 3.396e-25
Identity = 83/256 (32.42%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNA------GILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLI-KAKGSIVNVSSVAGSKSFPG--IMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            K A++TG++ G+G A A    Q GA++V++ R ++++   A   E H   E   +   +  + + D   KL ++T+S+   LDIL+ NA      G LLN T E      +D  +++NL+A         P +  + +G++V +SSV  +  FP   I  YC+ K  L   T+  +  LA   +RVN V PG+I T        DE   Q F        A+ R G P EVA  ++FL S  + + TG T  VDGG
Sbjct:   33 KIAVVTGSTYGIGLAIARRLAQHGAHVVVSSRTEEHVAHAAE--ELH--AEGLNVTGIVCHVGDADQRTKLIKETVSKLGGLDILVLNAAVNPYVGPLLNATAEV-----WDKVLDVNLKAPFLFVKEAAPHMKERGEGAVVFISSV--TAYFPNEDIGPYCVSKTALLGLTKALSRPLAAMNIRVNNVAPGLIETGFSAGLTKDEKMMQMFRN----VTAIPRAGYPEEVASLVSFLCSRDAGYITGQTMVVDGG 273          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Match: pecr (peroxisomal trans-2-enoyl-CoA reductase [Source:ZFIN;Acc:ZDB-GENE-050417-232])

HSP 1 Score: 88.1965 bits (217), Expect = 1.065e-20
Identity = 64/229 (27.95%), Postives = 102/229 (44.54%), Query Frame = 3
Query:  174 GANLVITGRNDDNLKDTAL-LCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAG-SKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDI--HKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGR 848
            G ++VI  R  + L+  A  LC         ++     ++  E ++R L   TL  + ++D L+NN G       E +S   +   I  NL         +    +K  G ++ V+ +A   + FPG+      +AG+D  T+  A++ A  GVR+NAV PG I +         + +S +     R        R G P EV+  + FL SPA+SF TG T  VD  +
Sbjct:    1 GCSVVIASRKMERLQKAAQELCACIPPSSPARVTAVQCNIRQEQEVRGLMSTTLERYGKIDFLVNNGGGQFPSPAEGISTKGWHAVIETNLTGTFLCCREVYNLWMKDHGGVI-VNIIADMWRGFPGMSHTGAARAGVDNLTKSLAIEWASSGVRINAVAPGTIFSQTASENYKHLSKSPFDMMKPRIPAK----RLGLPEEVSPVVCFLLSPAASFITGETVKVDAAQ 224          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:550454])

HSP 1 Score: 87.4261 bits (215), Expect = 5.847e-20
Identity = 62/202 (30.69%), Postives = 103/202 (50.99%), Query Frame = 3
Query:   99 HNKNALITGASSGVGRATADLFFQLGANLVITGRN---DDNLKDTALLCEKHRVMENQ-------KLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDI 671
            H K  ++TGASSG+G A A  F   GA LV+ GR+    ++L+D   L E+ R++  Q       ++V F  DL +  ++ + AE  ++   ++D+L++ AGI         +MD     + +N    I L   L PS++K  +G IV +SSV G  + P   +Y   K     +      ++A  G++V  V+PG I T++
Sbjct:   54 HGKVVVVTGASSGLGLACARAFHAEGARLVLCGRDLRRLESLRDE--LSERVRILAPQGPEDRTPRVVPF--DLGSPGEVARAAELVVAAHGRVDVLVSGAGISYRGEAALTAMDVHRQLMEVNYFGAIALLTALLPSMLKQGEGHIVAISSVQGRIAIPFRSAYAASKHATQAYFDSLRAEVADSGLKVTVVSPGYIRTNL 251          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Match: bdh1 (3-hydroxybutyrate dehydrogenase, type 1 [Source:ZFIN;Acc:ZDB-GENE-070410-130])

HSP 1 Score: 82.4185 bits (202), Expect = 3.613e-18
Identity = 54/199 (27.14%), Postives = 95/199 (47.74%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLF----FQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEF---------VQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPG 653
            I +K  L+TG  SG G + A       F++ A  ++  +  D  K       +   M++++L +   ++A++D++ K  E   S             L  ++NNAGI     IE   MD +     +NL  +++ T    P + +A+G +VN+SS+ G         YCI K G++ F+ C   ++ + GV+V+ V PG
Sbjct:   23 IRDKAVLVTGCDSGFGLSLAQHLHSKGFKIFAGCLLKDKGGDGAK-------QLEAMKSERLKVVQMNVASDDEVAKAVEFIRSSLPDPEDGERGTGLWGVVNNAGISTFGEIEWTPMDTYKNVAEVNLWGIVRTTKACLPLIRRARGRVVNISSMMGRMGNTARSPYCITKFGIEAFSDCLRYEMMRWGVKVSVVEPG 214          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Match: SPS19 (Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary enzyme of fatty acid beta-oxidation; homodimeric enzyme required for growth and sporulation on petroselineate medium; expression induced during late sporulation and in the presence of oleate [Source:SGD;Acc:S000005146])

HSP 1 Score: 82.4185 bits (202), Expect = 1.345e-18
Identity = 62/247 (25.10%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            K A +TG +  + R   +    LG    I GR+ +  +  A    +    ++  L +   D+ N + +    +KT+ +F ++D +I  A          +S + F   ++++L             L K+KGSI+ VS+       P        KAG+D   +  A++L   G+R N + PG I        G+   A +++ ++A     L R G+  ++A S  ++ SPA+S+ TG    VDGG
Sbjct:   25 KVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAI----DNTEGLKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGG 267          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Match: YMR226C (NADP(+)-dependent serine dehydrogenase and carbonyl reductase; acts on serine, L-allo-threonine, and other 3-hydroxy acids; green fluorescent protein fusion protein localizes to the cytoplasm and nucleus; may interact with ribosomes, based on co-purification experiments [Source:SGD;Acc:S000004839])

HSP 1 Score: 81.2629 bits (199), Expect = 2.247e-18
Identity = 60/207 (28.99%), Postives = 104/207 (50.24%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLG---ANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILL-NDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK--GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIH--KRAGMDESA 701
            K  LITGAS+G+G+ATA  + +       L++  R  + L++     ++     N K+ +   D+   + I+   E    EF  +DIL+NNAG  L +D +  ++ +      + N+ A+I +T  + P + +AK  G IVN+ S+AG  ++P    YC  K  +  FT     +L    +RV  + PG++ T+    +  G +E A
Sbjct:   14 KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQE--FPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLP-IFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEFSLVRYRGNEEQA 217          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Match: YIR035C_mRNA (Putative cytoplasmic short-chain dehydrogenase/reductase [Source:SGD;Acc:S000001474])

HSP 1 Score: 68.1662 bits (165), Expect = 8.000e-14
Identity = 53/194 (27.32%), Postives = 99/194 (51.03%), Query Frame = 3
Query:  114 LITGASSGVGRATADLFFQLGANLVITG--RNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMN-----INLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIH 674
            L+TG S G+G++  D+ F L  + V+ G  R++  LK    L EK+      +    + D+  +  +++L    +    ++D L+ NAG+L  + ++ V  ++ D+N      ++N  +++ L  +  P L K  G++V VSS A +  F    +Y   KA L+ F    A +  ++ V+  AV PG++ TD+ 
Sbjct:    6 LVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKK---LKEKY----GDRFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVL--EPVQNV--NEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDTDMQ 186          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Match: IRC24 (Putative benzil reductase;(GFP)-fusion protein localizes to the cytoplasm and is induced by the DNA-damaging agent MMS; sequence similarity with short-chain dehydrogenase/reductases; null mutant has increased spontaneous Rad52p foci [Source:SGD;Acc:S000001475])

HSP 1 Score: 61.2326 bits (147), Expect = 2.034e-11
Identity = 58/223 (26.01%), Postives = 97/223 (43.50%), Query Frame = 3
Query:  105 KNALITGASSGVGRATADLFFQLGANLVITG--RNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVS-------MDQFDMNINLNLRAVIQLTHLLTPSLIKAK--GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHK-------RAGMDESAYQEFLQ 719
            K  LITGAS G+G        +     ++ G  R +  L+         R     K V  + D+ +   +  L E+   +  +LD ++ NAG+L  + ++++S       + Q++   ++N  +++ L  L  P L  +   G+IV VSS A  K + G  +Y   KA L+ F    A +     VR   + PGV+ T + K         GM   A + F Q
Sbjct:    3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSL------QREYGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGML--EPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQ 217          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Match: FOX2 (3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase; multifunctional enzyme of the peroxisomal fatty acid beta-oxidation pathway; mutation is functionally complemented by human HSD17B4 [Source:SGD;Acc:S000001717])

HSP 1 Score: 62.7734 bits (151), Expect = 2.116e-11
Identity = 53/193 (27.46%), Postives = 94/193 (48.70%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVIT------GRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNP 650
            S  ++  +ITGA  G+G+  A  +   GA +V+       G +  N K   L+ ++  + +   + +   D  NE+   K+ E  + EF ++D+LINNAGIL + +   ++  +F   ++++L    +L+    P +   K G I+N +S AG     G  +Y   K GL       A + AK  + VN++ P
Sbjct:    6 SFKDRVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVDE--IKKAGGIAVANYDSVNENG-EKIIETAIKEFGRVDVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAP 195          

HSP 2 Score: 51.2174 bits (121), Expect = 1.030e-7
Identity = 55/208 (26.44%), Postives = 108/208 (51.92%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEK-HRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK-GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQE 710
            S+ NK  ++TGA  G+G++ A  F + GA +V+     +++KD   + E+ +++      +    D+  E  +  + +  +S+F ++DIL+NNAGIL + +   +  +++   + ++L +   L+  + P   K K G I+N +S +G     G  +Y   KA +  F++  AL+ AK+G+ VN + P       H    M ++ + E
Sbjct:  319 SLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVV-----NDIKDPFSVVEEINKLYGEGTAIPDSHDVVTEAPL--IIQTAISKFQRVDILVNNAGILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAP-------HAETAMTKTIFSE 512          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Match: EDO44080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWS5])

HSP 1 Score: 266.544 bits (680), Expect = 3.345e-89
Identity = 135/252 (53.57%), Postives = 176/252 (69.84%), Query Frame = 3
Query:  114 LITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASS-FTTGATFPVDGGRHAMCPR 866
            LITG SSG+G ATA L  +LG ++   GR+ + L      C++    +  +++    DL++E D++ L EKTL +F +LDIL+N AGIL   TIE  S+  FD  +N+N+RAV  LT L  P LIK +G IVNVSSV G +SFPG++ Y + KA LDQFTRC AL+LA K VR N+VNPGVI+T + +R G+DE AYQ+FL+ ++ THALGR G   EVA +IAFLAS  ++ F TGAT PVDGGRHAMCPR
Sbjct:    3 LITGGSSGIGAATALLLSKLGCSVACGGRSGEKLAKVTQECQQQG--KGSEVLAVEGDLSHEKDVKDLLEKTLEKFGKLDILVNCAGILPTGTIENTSLQTFDEVMNVNVRAVFYLTSLAVPHLIKTEGCIVNVSSVNGLRSFPGVLGYNMSKAALDQFTRCVALELAPKKVRCNSVNPGVIVTGLQRRGGLDEEAYQKFLEHSKTTHALGRPGEAEEVARAIAFLASAETAGFITGATLPVDGGRHAMCPR 252          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Match: EDO38087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX1])

HSP 1 Score: 119.398 bits (298), Expect = 4.382e-32
Identity = 84/260 (32.31%), Postives = 126/260 (48.46%), Query Frame = 3
Query:   87 KFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRND---DNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGS---IVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGR 848
            + S   K AL+TGA  G+GR TA    + GA++V   R     D+LK  +   + H +           D+ N  D+R L    +     + +L+NNAG+      E +  + +D+   +N++A + +   +   + KA+GS   IVNVSS A          YC  KA LD  T+  AL+L K  +RVN+VNP V+LTD+ K A  D       L     +  LGRF    +V  +I +L S  ++   G   PVDGG+
Sbjct:    2 EISFSGKRALVTGAGKGIGRCTAKALVKCGADVVALSRTQSDLDSLKAESPSIQTHHI-----------DVQNTSDVRDL----IKGLGDIHLLVNNAGVGRLHLFEDIEPEDYDIVFGVNVKAALFVAQAVARKM-KAQGSGGAIVNVSSQASQAPLMEHTLYCASKAALDMITKVMALELGKHKIRVNSVNPTVVLTDMGKMAWADPVKAGPMLA----SIPLGRFAEEQDVVDAILYLLSDKAAMIHGTCLPVDGGK 241          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Match: EDO43266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYX9])

HSP 1 Score: 112.079 bits (279), Expect = 1.739e-29
Identity = 85/243 (34.98%), Postives = 130/243 (53.50%), Query Frame = 3
Query:   96 IHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-----AKGSIVNVSSVAGS-KSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTD-IHKRAGM---DESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLA 794
            + NK  +++ A+ G+G+ATA    + GA ++ T  N + LK      E H V   +  V+   D+ + + I+K A    SE  ++D+L N AG++L   IE  S  Q+D+ ++LN+++++   HL +  L+K       GSI+N++SVA S K  P   +Y   KA +  FT+  A D   KG+RVNAV PG I T+ +  R       + A  +FL R       GRFG P EVA  + FLA
Sbjct:   14 LKNKVVVLSAAAQGIGKATALACAREGAKVIATDINAEKLK------ELHSVPGIETRVV---DVTDYEAIKKFA----SEVDRVDVLFNCAGLVLGGNIEECSEKQWDLTMDLNVKSMVN--HLCSLILLKFPHKLWSGSIINMASVASSIKGAPNRFAYGTSKAAVIGFTKAIAADYITKGIRVNAVCPGTIYTESLQYRIDSTPDPQKALADFLAR----QPTGRFGKPEEVANVVVFLA 237          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Match: EDO43775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH2])

HSP 1 Score: 108.227 bits (269), Expect = 8.312e-28
Identity = 75/253 (29.64%), Postives = 130/253 (51.38%), Query Frame = 3
Query:  111 ALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLD-ILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAK---GSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKR--AGMDESAYQEFLQRAQLTH--ALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            AL+TG  SG+GRA  +     GA++ +   +    K+T+     H   +  +   F  ++A+  +++ L +    E+ +   IL+N+AGI  +  +  +    FD  I++NL+    +      ++++ K   GSI+N+SS+       G  +Y   KAG++  T+  A++LA+ G+R NA+ PG I T + ++  A + E          Q+ H   LGRFG P  +A  ++FLA   SS+ TGA+  V GG
Sbjct:   13 ALVTGGGSGIGRAVCEALANRGASVSVIDLHGVGAKETSENLATHN--DTTRHTHFAVNVASSSEVKDLLQAIHKEYQRAPCILVNSAGIAKDALLLKMKEQDFDDVIDVNLKGTFLMCQTTAKAMVENKINNGSIINISSIVAKSGNMGQANYAASKAGVEGLTKVCAIELARFGIRCNAILPGFIDTPMTRKVPAHITE----------QIKHFIPLGRFGQPSNIADVVSFLACDESSYITGASIDVTGG 253          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Match: EDO25912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVB2])

HSP 1 Score: 99.3673 bits (246), Expect = 1.316e-24
Identity = 85/255 (33.33%), Postives = 126/255 (49.41%), Query Frame = 3
Query:  102 NKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDT-IETVSMDQ----FDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPG-IMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGR 848
             K  LITGAS G+G ATA L    G  L +  +      + AL+ E  +     + +   AD+A+E  + +L  +    F +LD+L+NNAGIL     +E + + +    F  N+  +     +    ++       G+IVN+SS A     PG  + Y   K  +D  T   A ++A  G+RVNAV PGVI T+IH   G  E      + R   +  +GR G   EVA +I +LAS  +S+T+GA   V GGR
Sbjct:    2 EKVMLITGASRGIGAATARLAAAQGYALCLNYQRQQAAAE-ALVSEITQA--GGRAIAVQADVADERQVMQLFARLDQHFGRLDVLVNNAGILETQMRLEQMELARWQRVFATNVFGSFLCCREAIKRMSTRQGGNGGAIVNLSSAAARLGAPGEYIDYAAVKGAIDSMTLGLAKEVAADGIRVNAVRPGVIETEIHASGGEPER-----VARVSQSVPMGRGGLAREVAEAILWLASEQASYTSGALLDVSGGR 248          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Match: zgc:101858 (3-oxoacyl-[acyl-carrier-protein] reductase FabG [Source:NCBI gene;Acc:101161976])

HSP 1 Score: 282.337 bits (721), Expect = 8.896e-95
Identity = 139/268 (51.87%), Postives = 188/268 (70.15%), Query Frame = 3
Query:   63 ISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            ++ S+     S+  K ALITGASSG+G  T+ LF QLGA L + GR+ +NL   A  C         + ++   DL +E+ +RK  E+TL+ F +LD+L+N+AGIL   +IET  + Q+D  +++N+R+V  LT L  P L++ KGSIVNVSSV G +SFPG+++YC+ K+ +DQFTRC AL+LA K VRVN+V PGVI+T++HKRAG+D+  Y +FL R + THALGR G   EVA SIAFLAS A+SF TG   P+DGGRHAMCPR
Sbjct:    1 MATSDAFQVSSLKGKVALITGASSGIGAGTSVLFAQLGALLALNGRDVENLTKVAQKCTLQ--CGGAEPLLVPGDLTDEETVRKTVEQTLAHFGRLDVLVNSAGILAMGSIETSDLAQYDKVMDVNVRSVYHLTQLCVPHLVQTKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCIALELAPKQVRVNSVCPGVIVTEVHKRAGLDDEQYAKFLARCKETHALGRPGEVEEVAQSIAFLASDAASFITGVNLPIDGGRHAMCPR 266          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Match: dcxr (dicarbonyl and L-xylulose reductase [Source:NCBI gene;Acc:110015458])

HSP 1 Score: 120.939 bits (302), Expect = 2.986e-32
Identity = 86/254 (33.86%), Postives = 123/254 (48.43%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGS---IVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            S   K AL+TGA  G+GRATA    + GA +V   R   +L           V E   +     DLA+        E  L     +D+L+NNA          V+ +QF+ + ++N++AV+ ++ ++   + KA+GS   IVN+SS A   +      YC  K  LD  T+  AL+L    +RVN+VNP V++TD+ +    D       L R      LGRF    +V  SI FL S +S  T G T PVDGG
Sbjct:    4 SFAGKRALVTGAGKGIGRATALALARHGAKVVAVTRTQADLDSL--------VQECASITPVCVDLADW----PATEAALQGVGPIDLLVNNAACATLQPFLEVTAEQFERSFDVNVKAVLHVSQIVARGM-KARGSGGSIVNLSSQASQCALRDHAVYCATKGALDMLTKVMALELGPHQIRVNSVNPTVVMTDMGRLGWSDPQKAATMLCRIP----LGRFAEVDDVVDSILFLLSDSSRMTNGVTLPVDGG 240          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Match: dhrs4 (dehydrogenase/reductase SDR family member 4-like [Source:NCBI gene;Acc:101171443])

HSP 1 Score: 118.242 bits (295), Expect = 5.882e-31
Identity = 84/270 (31.11%), Postives = 137/270 (50.74%), Query Frame = 3
Query:   63 ISLSNTMNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGIL-----LNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK-AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHA 854
            +S    M++  +  K A++T ++ G+G A A+   + GA++V++ R   N+     L +   +    ++     ++ N +D  KL + TL +   +DIL++NA +      + D+ E V    +D  + +N++A   LT L+ P + K   G+IV VSSVAG +    +  Y + K  L   TR  A +LA   +RVN V PG+I T        +E   +EF  + QL+  + R G P E+   IAFL S  +S+ TG T  V GG  A
Sbjct:   14 LSGQQRMSQSCLAGKVAIVTASTDGIGLAAAEALGKRGAHVVVSSRRQANVDKAVALLQSQSI----QVTGTTCNVGNGEDREKLIQMTLDQCGGIDILVSNAAVNPFFGNIMDSTEEV----WDKILAVNVKASFLLTKLVVPHMEKRGGGNIVFVSSVAGYQPMQALGPYSVSKTALLGLTRALAPELAHSNIRVNCVAPGIIKTRFSSALWQNEGVLEEF--KKQLS--IKRLGEPEEIGGVIAFLCSQDASYITGETITVTGGMEA 271          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Match: hsd17b8 (hydroxysteroid 17-beta dehydrogenase 8 [Source:NCBI gene;Acc:101165741])

HSP 1 Score: 114.005 bits (284), Expect = 1.517e-29
Identity = 78/249 (31.33%), Postives = 128/249 (51.41%), Query Frame = 3
Query:  114 LITGASSGVGRATADLFFQLGANLVITGRNDDNLKDT-ALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQL-DILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIK---AKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            L+TG  SG+GRA        GA++V+   N ++  +T + L +  R    Q  +  + D++ +D ++KL     + + Q   + +N AGI  ++ +  +  +QFD  I +NL+    +T  +  +L+    +KGSI+ V S+ G     G  +Y   KAG++  TR AA +L++ G+R N V PG I T       M +   ++ + +      LGR G P EVA + AFLAS  S + TG +  V GG
Sbjct:   13 LVTGGGSGIGRAVCQRLASEGASVVVADINQESADETFSSLPDNLR---GQVHMATVVDVSLKDSVKKLVTNIQTRYFQPPSVCVNTAGITQDEFLLNMEEEQFDRVIQVNLKGSFLVTQAVAQALVACGASKGSIITVGSIVGKVGNLGQANYAASKAGVEGLTRTAAKELSRFGIRCNCVLPGFITTP------MTDKVPEKVISKITTLVPLGRMGEPAEVADACAFLASDDSRYITGTSIEVTGG 252          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Match: dcxr (dicarbonyl and L-xylulose reductase [Source:NCBI gene;Acc:110015458])

HSP 1 Score: 108.997 bits (271), Expect = 7.098e-28
Identity = 79/240 (32.92%), Postives = 115/240 (47.92%), Query Frame = 3
Query:  135 GVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGS---IVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            G+GRATA    + GA +V   R   +L           V E   +     DLA+        E  L     +D+L+NNA          V+ +QF+ + ++N++AV+ ++ ++   + KA+GS   IVN+SS A   +      YC  K  LD  T+  AL+L    +RVN+VNP V++TD+ +    D       L R      LGRF    +V  SI FL S +S  T G T PVDGG
Sbjct:    6 GIGRATALALARHGAKVVAVTRTQADLDSL--------VQECASITPVCVDLADW----PATEAALQGVGPIDLLVNNAACATLQPFLEVTAEQFERSFDVNVKAVLHVSQIVARGM-KARGSGGSIVNLSSQASQCALRDHAVYCATKGALDMLTKVMALELGPHQIRVNSVNPTVVMTDMGRLGWSDPQKAATMLCRI----PLGRFAEVDDVVDSILFLLSDSSRMTNGVTLPVDGG 228          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Match: SMESG000079251.1 (SMESG000079251.1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 262/262 (100.00%), Postives = 262/262 (100.00%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR
Sbjct:    1 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 262          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Match: SMESG000079254.1 (SMESG000079254.1)

HSP 1 Score: 387.882 bits (995), Expect = 1.471e-136
Identity = 182/262 (69.47%), Postives = 225/262 (85.88%), Query Frame = 3
Query:   81 MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGGRHAMCPR 866
            ++KFS++ KNALITGASSG+G++TA+LFF+LGAN++ITGRN +NL DT  LCE  +V ENQ++V F ADL NE+D++KLAEKTL EF +LDILINNAG++ NDTIE V M+ FD  +N+NLR+VIQLT+LL+PSLI  KGSIVNVSSVAG+++FP +MSYCI KA L+QFT+C ALDLA KGVRVNAV+PGV +T++HKRAGM ESAYQ FL++++ THALGR G   E+AYSIAFLAS A+SFTTGA FPVDGGRH MCPR
Sbjct:    2 IHKFSLNFKNALITGASSGIGKSTAELFFKLGANILITGRNLENLNDTIKLCELSKVNENQRIVAFTADLTNEEDVKKLAEKTLLEFPKLDILINNAGVISNDTIENVEMENFDSVMNMNLRSVIQLTNLLSPSLIDRKGSIVNVSSVAGTRAFPNVMSYCISKAALEQFTKCTALDLASKGVRVNAVSPGVTVTNLHKRAGMSESAYQAFLEKSKTTHALGRAGESEEIAYSIAFLASDAASFTTGAIFPVDGGRHLMCPR 263          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Match: SMESG000016829.1 (SMESG000016829.1)

HSP 1 Score: 108.997 bits (271), Expect = 8.936e-28
Identity = 80/262 (30.53%), Postives = 126/262 (48.09%), Query Frame = 3
Query:   99 HNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRV---MENQKLVMFLADLANEDDIRKLAE---KTLSEFVQLDILINNAGILLND-TIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMD------ESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
             NK  LI G SSG+G A    F      ++    + +N          H++   +E + +     D+  E++I+ + E   KT  E  +LD +INN G    D  I+  S    D   N+N+++    +    P L K+ G I+N+SS  GS      ++Y I K  ++  T+  ALD A+ GVRVN+V+PG+I T +  +  +D       + Y+  + + +    LG  G P +VA    FLAS  + + TGA  PV GG
Sbjct:    4 ENKVILIVGGSSGIGAACVRHFSAAKGTVIFCSNDQEN---------GHKLVQELEGRNVTFLFCDVIIEENIKSVIEFINKTHGE--KLDCIINNVGTHPEDRKIDDFSTSDLDFIFNVNVKSHFLFSKYSMPLLRKSSGCIINMSSQVGSIGQRNAVTYAITKGAVNAMTKSLALDEAENGVRVNSVSPGIIYTPLLVQNTIDNVRIKGNTFYENEIDKMKTLIPLGALGYPEDVARVCLFLASDMAKYITGADIPVSGG 254          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Match: SMESG000033535.1 (SMESG000033535.1)

HSP 1 Score: 84.3445 bits (207), Expect = 8.045e-19
Identity = 74/251 (29.48%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  102 NKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLN-DTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAGSKSFPGIMSYCIGKAGLDQFTRCAALDLAKKG--VRVNAVNPGVILTDIHKRAGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATFPVDGG 845
            NK A++TG++ G+G + A+ F + G+ +VI  R   N+ + A+   K     N  L   +  +   +  +KL  +T+  F ++DIL++NA   ++   I   S D +D   + NL++   L    +P       SI+  SS++G   FP +  Y I K  L    +  + +LA     +RVN + PG+I T   +    +E  ++EF  +  L     RFG   + A  +AFLAS  +++ TG T  V GG
Sbjct:    7 NKVAIVTGSTDGIGYSIAEKFLKEGSKVVICSRKSKNV-NYAIEKLKQSYNPNN-LRGIVCHVGEIEARKKLISETVESFGRIDILVSNAATNVHFGPILECSEDAWDKIFHTNLKSAFFLIKEASPHFNNNA-SIIINSSISGFNPFPMLGIYSITKTALIGMVKVLSQELANDPLRIRVNGIAPGIIKTKFSRALYENEDIHEEFKNQLHLK----RFGTGEDCAGLVAFLASDEAAYITGETVVVAGG 250          
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Match: SMESG000018757.1 (SMESG000018757.1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.156e-18
Identity = 66/211 (31.28%), Postives = 106/211 (50.24%), Query Frame = 3
Query:   93 SIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTALLCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGILLNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPS-LIKAKGSIVNVSSVAGSKSFPGIMSYCIGK---AGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKRAGMDESAYQEF 713
            S+ NK  LITGA SG+G A A  F +L + LV+   ++  LK T+  CEKH+   +  + +F  D+ N  ++ KL+EK  ++   +DIL+NNAG++   ++  +  D      N+N+ + I +     P  L++  G IV+++S+AG      +  YC  K    GL +        L K G+ +  V P  I T      GM E    +F
Sbjct:   38 SVENKIILITGAGSGLGAALAISFAKLKSKLVLLDISEVGLKRTSNECEKHQ--SHTSIFIFQIDITNRMEVFKLSEKIKNDIGIVDILVNNAGVVSGKSLLELDEDMVHKTFNVNVISHIWIIQAFLPDMLLRNSGQIVSLASLAGLFGVNKLSDYCASKFAAVGLQESLLNELRMLKKNGIHLLTVCPFYIDT------GMFEGVKSDF 240          
The following BLAST results are available for this feature:
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCXR5.185e-3332.94dicarbonyl and L-xylulose reductase [Source:HGNC S... [more]
PECR1.479e-2930.40peroxisomal trans-2-enoyl-CoA reductase [Source:HG... [more]
HSD17B142.716e-2631.60hydroxysteroid 17-beta dehydrogenase 14 [Source:HG... [more]
DHRS42.482e-2527.34dehydrogenase/reductase 4 [Source:HGNC Symbol;Acc:... [more]
DHRS42.482e-2527.34dehydrogenase/reductase 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y47G6A.216.785e-7444.84pep chromosome:WBcel235:I:3551949:3559807:-1 gene:... [more]
Y47G6A.221.162e-6744.84pep chromosome:WBcel235:I:3559923:3562851:-1 gene:... [more]
dhs-142.500e-5642.42DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
R05D8.94.680e-5642.05pep chromosome:WBcel235:V:2766271:2767503:-1 gene:... [more]
R05D8.73.765e-5441.29pep chromosome:WBcel235:V:2761825:2763208:-1 gene:... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG315483.142e-9754.72gene:FBgn0051548 transcript:FBtr0078736[more]
CG121715.919e-9352.71gene:FBgn0037354 transcript:FBtr0078708[more]
CG315492.905e-9252.71gene:FBgn0051549 transcript:FBtr0078707[more]
CG315492.905e-9252.71gene:FBgn0051549 transcript:FBtr0335215[more]
CG36995.416e-7444.40gene:FBgn0040349 transcript:FBtr0070186[more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1018581.019e-9753.10zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13][more]
hsd17b84.057e-3634.54hydroxysteroid (17-beta) dehydrogenase 8 [Source:Z... [more]
dcxr2.928e-3433.59dicarbonyl/L-xylulose reductase [Source:ZFIN;Acc:Z... [more]
dhrs44.573e-3332.56dehydrogenase/reductase (SDR family) member 4 [Sou... [more]
dhrs44.573e-3332.56dehydrogenase/reductase (SDR family) member 4 [Sou... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp71.062e-10054.83membrane protein, palmitoylated 7 [Source:Xenbase;... [more]
dcxr1.518e-3532.93dicarbonyl/L-xylulose reductase [Source:NCBI gene;... [more]
dhrs41.231e-2930.20dehydrogenase/reductase (SDR family) member 4 [Sou... [more]
dcxr1.552e-2931.50dicarbonyl/L-xylulose reductase [Source:NCBI gene;... [more]
hmgb11.247e-2631.73high mobility group box 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcxr8.376e-3633.86dicarbonyl L-xylulose reductase [Source:MGI Symbol... [more]
Cbr21.740e-3332.16carbonyl reductase 2 [Source:MGI Symbol;Acc:MGI:10... [more]
Hsd17b141.441e-3031.87hydroxysteroid (17-beta) dehydrogenase 14 [Source:... [more]
Dcxr2.221e-2732.28dicarbonyl L-xylulose reductase [Source:MGI Symbol... [more]
Cbr46.209e-2731.73carbonyl reductase 4 [Source:MGI Symbol;Acc:MGI:23... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9X248|FABG_THEMA4.277e-4537.943-oxoacyl-[acyl-carrier-protein] reductase FabG OS... [more]
sp|P51831|FABG_BACSU1.645e-4135.063-oxoacyl-[acyl-carrier-protein] reductase FabG OS... [more]
sp|P50941|FABG_RICPR5.262e-4037.353-oxoacyl-[acyl-carrier-protein] reductase FabG OS... [more]
sp|Q9PKF7|FABG_CHLMU7.318e-3934.803-oxoacyl-[acyl-carrier-protein] reductase FabG OS... [more]
sp|Q68VY7|FABG_RICTY7.762e-3936.553-oxoacyl-[acyl-carrier-protein] reductase FabG OS... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M3K9K72.353e-10159.14Uncharacterized protein OS=Anisakis simplex OX=626... [more]
Q66IW53.608e-10055.98MGC84267 protein OS=Xenopus laevis OX=8355 GN=mgc7... [more]
A0A0L8HGD34.431e-10058.40Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1L8EZE96.157e-10055.98Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A2D0PRY45.317e-9954.103-oxoacyl-[acyl-carrier-protein] reductase FabG-li... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1018582.367e-10256.02zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13][more]
zgc:1018589.786e-10255.22zgc:101858 [Source:ZFIN;Acc:ZDB-GENE-040927-13][more]
dcxr9.759e-3433.59dicarbonyl and L-xylulose reductase [Source:NCBI g... [more]
pecr4.160e-2829.69peroxisomal trans-2-enoyl-CoA reductase-like [Sour... [more]
dhrs43.053e-2731.42dehydrogenase/reductase SDR family member 4-like [... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bdh22.034e-2629.843-hydroxybutyrate dehydrogenase, type 2 [Source:NC... [more]
dhrs43.396e-2532.42dehydrogenase/reductase (SDR family) member 4 [Sou... [more]
pecr1.065e-2027.95peroxisomal trans-2-enoyl-CoA reductase [Source:ZF... [more]
dhrs7b5.847e-2030.69dehydrogenase/reductase (SDR family) member 7B [So... [more]
bdh13.613e-1827.143-hydroxybutyrate dehydrogenase, type 1 [Source:ZF... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPS191.345e-1825.10Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary e... [more]
YMR226C2.247e-1828.99NADP(+)-dependent serine dehydrogenase and carbony... [more]
YIR035C_mRNA8.000e-1427.32Putative cytoplasmic short-chain dehydrogenase/red... [more]
IRC242.034e-1126.01Putative benzil reductase;(GFP)-fusion protein loc... [more]
FOX22.116e-1127.463-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydr... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440803.345e-8953.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380874.382e-3232.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432661.739e-2934.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437758.312e-2829.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259121.316e-2433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1018588.896e-9551.873-oxoacyl-[acyl-carrier-protein] reductase FabG [S... [more]
dcxr2.986e-3233.86dicarbonyl and L-xylulose reductase [Source:NCBI g... [more]
dhrs45.882e-3131.11dehydrogenase/reductase SDR family member 4-like [... [more]
hsd17b81.517e-2931.33hydroxysteroid 17-beta dehydrogenase 8 [Source:NCB... [more]
dcxr7.098e-2832.92dicarbonyl and L-xylulose reductase [Source:NCBI g... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] reductase FabG vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079251.10.000e+0100.00SMESG000079251.1[more]
SMESG000079254.11.471e-13669.47SMESG000079254.1[more]
SMESG000016829.18.936e-2830.53SMESG000016829.1[more]
SMESG000033535.18.045e-1929.48SMESG000033535.1[more]
SMESG000018757.14.156e-1831.28SMESG000018757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007751 ID=SMED30007751|Name=3-oxoacyl-[acyl-carrier-protein] reductase FabG|organism=Schmidtea mediterranea sexual|type=transcript|length=953bp
CTAATTCACAAAATATAGCATTTTAAATTAATCTGAGTTTCTAAAATCAC
AATAAAGCTTTTATCAGCCTGAGTAATACTATGAATAAATTTTCTATTCA
TAATAAAAACGCCTTAATTACAGGTGCAAGTTCTGGAGTTGGCCGGGCCA
CAGCCGATTTATTTTTTCAATTGGGAGCAAATTTGGTAATCACAGGAAGA
AATGATGACAATCTTAAAGATACGGCGTTATTGTGTGAGAAACACAGGGT
GATGGAAAATCAAAAATTAGTAATGTTTTTAGCTGACCTCGCAAATGAAG
ATGACATACGGAAATTAGCTGAAAAAACTTTATCCGAATTTGTTCAATTA
GATATATTAATTAATAATGCTGGAATCTTGCTGAATGACACTATTGAAAC
TGTTTCCATGGATCAGTTTGATATGAATATAAATTTAAATTTAAGAGCAG
TGATTCAACTAACTCATTTACTGACTCCGTCATTGATAAAGGCTAAAGGA
TCTATTGTTAATGTTTCTAGTGTTGCTGGATCAAAATCTTTTCCTGGAAT
AATGTCATATTGCATTGGAAAGGCCGGACTAGATCAATTCACAAGATGTG
CTGCTCTTGATTTGGCTAAGAAAGGTGTTAGAGTCAATGCAGTAAATCCA
GGAGTGATCTTAACCGATATTCATAAAAGAGCTGGAATGGATGAATCAGC
ATATCAAGAGTTTCTTCAAAGAGCTCAATTGACTCATGCTCTTGGTCGTT
TTGGCAATCCTATTGAAGTTGCATATAGTATTGCATTTTTAGCATCTCCA
GCCTCGTCATTCACTACAGGAGCTACATTTCCTGTTGATGGGGGACGACA
TGCTATGTGTCCCAGATAATATATATCTGGGTCCGACGTTACCAATTGAT
ATACTAAGTTTATTCGATATTTTTTTCATTTTAGTAAAATAAACATTTAT
TTT
back to top

protein sequence of SMED30007751-orf-1

>SMED30007751-orf-1 ID=SMED30007751-orf-1|Name=SMED30007751-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=263bp
MNKFSIHNKNALITGASSGVGRATADLFFQLGANLVITGRNDDNLKDTAL
LCEKHRVMENQKLVMFLADLANEDDIRKLAEKTLSEFVQLDILINNAGIL
LNDTIETVSMDQFDMNINLNLRAVIQLTHLLTPSLIKAKGSIVNVSSVAG
SKSFPGIMSYCIGKAGLDQFTRCAALDLAKKGVRVNAVNPGVILTDIHKR
AGMDESAYQEFLQRAQLTHALGRFGNPIEVAYSIAFLASPASSFTTGATF
PVDGGRHAMCPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
IPR020904Sc_DH/Rdtase_CS
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 88..99
score: 55.08
coord: 134..150
score: 39.47
coord: 181..198
score: 45.06
coord: 160..179
score: 34.67
coord: 220..240
score: 39.42
coord: 10..27
score: 47.12
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 140..148
score: 59.31
coord: 88..99
score: 55.61
coord: 160..179
score: 34.76
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 1..260
e-value: 2.7E-78
score: 264.8
NoneNo IPR availablePFAMPF13561adh_short_C2coord: 15..257
e-value: 1.7E-58
score: 198.0
NoneNo IPR availablePANTHERPTHR43975FAMILY NOT NAMEDcoord: 6..262
IPR020904Short-chain dehydrogenase/reductase, conserved sitePROSITEPS00061ADH_SHORTcoord: 147..175
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 8..259