Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

Overview
NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
Smed IDSMED30007747
Length (bp)1768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (SMED30007747) t-SNE clustered cells

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (SMED30007747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (SMED30007747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (SMED30007747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30007747h1SMcG0011724 dd_Smed_v4_853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007747h1SMcG0011724 dd_Smed_v4_853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007747h1SMcG0011724 dd_Smed_v4_853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007747h1SMcG0011724 dd_Smed_v4_853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30007747h1SMcG0011724 dd_Smed_v6_853_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Human
Match: RPN1 (ribophorin I [Source:HGNC Symbol;Acc:HGNC:10381])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 274/577 (47.49%), Postives = 404/577 (70.02%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSITVK-------PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKD-FVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            +N+ V RT+D+SSHL K+++ + +             +++ +    E +L+ +G   K  D++++   V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P   +D  L+YG +RD PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I++ +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK LT  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   32 INEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSED-LLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 607          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Human
Match: RPN1 (ribophorin I [Source:HGNC Symbol;Acc:HGNC:10381])

HSP 1 Score: 483.797 bits (1244), Expect = 4.553e-167
Identity = 225/428 (52.57%), Postives = 320/428 (74.77%), Query Frame = 2
Query:  479 NVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            NV SY++   P   +D  L+YG +RD PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I++ +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK LT  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:    9 NVESYTKLGNPTRSED-LLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 435          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Celegans
Match: ribo-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH4])

HSP 1 Score: 355.14 bits (910), Expect = 3.849e-115
Identity = 215/569 (37.79%), Postives = 321/569 (56.41%), Query Frame = 2
Query:    2 MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSIT---VKPDEEDYVVIINSGFEDQ-LSFIGALSKTSDD---------DKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDG--ISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDS-IECADKVKELQNLDSAMKEAIGQSIQLADKIVT 1660
            M++L    +L  V   +      V RTID +S +VK+S+  +   V    +  V+I  S  E   LSFI A    S           +KD  V E +  T   +           G  +T  +    +  L   PS+I+QS+ QF+    + Y  S Y T  Q+T + TT G  +  +  V P  ++  ++ YG Y + PAF  + + VHYENNSPF+  T + R IE+SHWGNIA+EE ++L H GA+L GPFSR DYQ  + G    +++ FTT+L + A+D+YYRDEIGNISTS ++  +DSV+VE+RPRFPLFGGWKT YV+GYN+PS E+LYSK N++A+K +  DH+++D V++    KV+LPE V  +KV TPY V     E+  TYLDTTGR VLVL K N+V +H Q F V Y    + M REPL+    F+ LF ++I+  R DF+I+ D A +++ R   ++  L  + D + + Y+   ++  ++KS+K+     + +K   A   +   T+      L++DS    A+K  EL   D  + +A+   ++  +K  T
Sbjct:    1 MRLLFAIALLGAVFAEDAWKAANVDRTIDATSQIVKVSTLYSFENVGNGPQSKVLIALSKEESATLSFISAGIDGSKGKLKISEKPAEKDLAVYEVDLRTPVAK-----------GAKVTIRINLRITQVLEPLPSKIQQSDSQFVVLHTSAYVPSLYETVTQKTTIRTTQGGKLLSATTVSPSKQETERVIYGPYVNIPAFETKPVKVHYENNSPFVIATIVERFIEVSHWGNIAVEEYIELVHKGAELDGPFSRIDYQMDRRGRRQPALQQFTTVLPAQAKDIYYRDEIGNISTSAVRIRADSVDVEIRPRFPLFGGWKTSYVIGYNLPSEEYLYSKGNQYALKTKLFDHVFNDIVVEKLRTKVLLPEHVKRVKVATPYAVDRRPEELKPTYLDTTGRLVLVLEKENIVPDHSQFFTVTYEFEFVDMLREPLLASAFFFSLFFVIIVYSRFDFTISSDPAKDAEERSQIILGNLAKSVDSKQSAYEDLIEASQQYKSTKNDADLQEAKKTFIAARNQENSTLTDKIATLKTDSGASAAEKASELLKYDKTVFDAVDNYLKAVEKSTT 558          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Fly
Match: CG33303 (gene:FBgn0053303 transcript:FBtr0332197)

HSP 1 Score: 388.652 bits (997), Expect = 8.575e-130
Identity = 196/432 (45.37%), Postives = 289/432 (66.90%), Query Frame = 2
Query:   53 QTVNKKVVRTIDISSHLVKISSSITV-----KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQR-MQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSIT 1330
            + VN  V RT+D++S LVK ++ I+      KP  E YV   +   E  L++I  +   SD    F   +  +    ++ F     +       TF ++T+ S  +   P EI+Q++KQF+K++GNL+ YS Y T  Q+T V  ++ N++S++Q VKP S   NK+  G Y +  AFS+E L +HYEN++PF+TV +L R +EISHWGNIA++E++ + H+GAKLKG FSRYD+Q+  + G++++KS+ T L ++A  VYYRD  GNISTS++  + D +E+ELRPRFPLFGGWKT Y LGYNVPS+E++++  N++ +K+  IDHIYD+  ID AT+K++LPEG  DI++ TPY +     E++ TYLDT GR V+  SK+NLVE+HI DF +HYS +   M +EPL+V    Y++FL  I+ +RLDFSIT
Sbjct:   32 EIVNTNVERTLDLTSQLVKTTTKISAEDSAGKPIVE-YVFFTS---EPSLAYID-VKDASDKSVPF---KRNEPVKGEQSFTFTFPR--AAAKQTFIVETVASKGIRPHPEEIRQNDKQFVKYTGNLHLYSKYRTNSQKTNVKLSSSNILSHTQ-VKPFSVSSNKITLGPYENVEAFSQEPLVIHYENSAPFVTVNTLERTLEISHWGNIAVQESIQMTHTGAKLKGSFSRYDFQKEGRSGLAALKSYKTYLPASASGVYYRDTNGNISTSNMNAVRDFIELELRPRFPLFGGWKTQYTLGYNVPSYEYMFNDGNKYQLKMHLIDHIYDNMAIDEATIKIILPEGSSDIRLSTPYSISRLPNELVHTYLDTIGRPVVSFSKSNLVESHISDFTLHYSFSKTSMLQEPLLVSGFIYIIFLFTIVFLRLDFSIT 452          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Fly
Match: CG33303 (gene:FBgn0053303 transcript:FBtr0080052)

HSP 1 Score: 388.652 bits (997), Expect = 8.575e-130
Identity = 196/432 (45.37%), Postives = 289/432 (66.90%), Query Frame = 2
Query:   53 QTVNKKVVRTIDISSHLVKISSSITV-----KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQR-MQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSIT 1330
            + VN  V RT+D++S LVK ++ I+      KP  E YV   +   E  L++I  +   SD    F   +  +    ++ F     +       TF ++T+ S  +   P EI+Q++KQF+K++GNL+ YS Y T  Q+T V  ++ N++S++Q VKP S   NK+  G Y +  AFS+E L +HYEN++PF+TV +L R +EISHWGNIA++E++ + H+GAKLKG FSRYD+Q+  + G++++KS+ T L ++A  VYYRD  GNISTS++  + D +E+ELRPRFPLFGGWKT Y LGYNVPS+E++++  N++ +K+  IDHIYD+  ID AT+K++LPEG  DI++ TPY +     E++ TYLDT GR V+  SK+NLVE+HI DF +HYS +   M +EPL+V    Y++FL  I+ +RLDFSIT
Sbjct:   32 EIVNTNVERTLDLTSQLVKTTTKISAEDSAGKPIVE-YVFFTS---EPSLAYID-VKDASDKSVPF---KRNEPVKGEQSFTFTFPR--AAAKQTFIVETVASKGIRPHPEEIRQNDKQFVKYTGNLHLYSKYRTNSQKTNVKLSSSNILSHTQ-VKPFSVSSNKITLGPYENVEAFSQEPLVIHYENSAPFVTVNTLERTLEISHWGNIAVQESIQMTHTGAKLKGSFSRYDFQKEGRSGLAALKSYKTYLPASASGVYYRDTNGNISTSNMNAVRDFIELELRPRFPLFGGWKTQYTLGYNVPSYEYMFNDGNKYQLKMHLIDHIYDNMAIDEATIKIILPEGSSDIRLSTPYSISRLPNELVHTYLDTIGRPVVSFSKSNLVESHISDFTLHYSFSKTSMLQEPLLVSGFIYIIFLFTIVFLRLDFSIT 452          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Zebrafish
Match: rpn1 (ribophorin I [Source:ZFIN;Acc:ZDB-GENE-030131-4286])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 274/589 (46.52%), Postives = 400/589 (67.91%), Query Frame = 2
Query:   14 LLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITV----KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETED-STLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            L+ C       ++  VN+ V RT+D+SSHL KI++ I +          +++ +       L+F+GA  K  +++ + +  + +     S + F   L      G  L   ++T++SH L  FP+ I Q+E+Q + F GN Y YSPYPT  Q T+V   +  V SY++   P +K D  + YG ++D P FS++ + +HYENNSPFLT++S+ R IE+SHWGNIA+EET+DL H+GA LKGPFSRYDYQR  D GISSVKSF TIL ++A+DVYYRDEIGNISTSHL+ L DSVEVE+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+R +DH+YDDQVID  TV+++LPEG  +I + TPY +     E+  TYLDT GR VLV +K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E +M+V  + E++ T  +KR  +Y+  D+ +N++K S+DT      RK ++A+H+ LT  +  +Q +L+++  + A+KV E+Q LD  +K+ + +S   A+++V GK++K  Y++ +    AKR EL+ +++ L+ +L
Sbjct:   11 LICCFFCGSVCADGLVNEDVKRTLDLSSHLAKITAEIQLANHGSSRANSFIIGLEEELAPHLAFVGASVKGEEEEDEHLELKEKTVHGQSGKFFEAQLQSSLAPGAKLRVKVETVFSHVLKPFPTHITQAERQLVVFQGNHYLYSPYPTRSQTTRVRLASKTVESYTKLGNP-TKSDETIEYGPFKDIPPFSQDVMKIHYENNSPFLTISSITRTIEVSHWGNIAVEETIDLRHTGAHLKGPFSRYDYQRQSDSGISSVKSFKTILPASAQDVYYRDEIGNISTSHLQVLDDSVEVEIRPRFPLFGGWKTHYIIGYNLPSYEYLYNLGDQYALKMRLVDHVYDDQVIDQLTVRLILPEGARNIHMDTPYPISRSQDELHYTYLDTFGRPVLVATKNNLVEQHIQDVVVHYTFNKILMLQEPLLVVGAFYILFFTVIIYVRLDFSITKDPAAEVRMKVASITEQVLTLVNKRLGLYRHMDEVVNRYKQSRDTGALNSGRKTLEAEHRTLTNDITALQTRLKAEGSDLAEKVGEIQKLDGQLKDLVCRSSLDAERLVAGKVKKDAYIDSDKNLTAKRHELVNRIDSLLDAL 598          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Zebrafish
Match: rpn1 (ribophorin I [Source:ZFIN;Acc:ZDB-GENE-030131-4286])

HSP 1 Score: 72.7886 bits (177), Expect = 6.334e-15
Identity = 35/108 (32.41%), Postives = 70/108 (64.81%), Query Frame = 2
Query: 1427 DDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLV 1750
            D+ +N++K S+DT      RK ++A+H+ LT  +  +Q +L+++  + A+KV E+Q LD  +K+ + +S   A+++V GK++K  Y++ +    AKR EL+ +++ L+
Sbjct:    4 DEVVNRYKQSRDTGALNSGRKTLEAEHRTLTNDITALQTRLKAEGSDLAEKVGEIQKLDGQLKDLVCRSSLDAERLVAGKVKKDAYIDSDKNLTAKRHELVNRIDSLL 111          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Xenopus
Match: rpn1 (ribophorin I [Source:NCBI gene;Acc:395031])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 279/591 (47.21%), Postives = 409/591 (69.20%), Query Frame = 2
Query:   14 LLFCILALVKYSEQT---VNKKVVRTIDISSHLVKISSSITV-KPDE---EDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
               C +A +  S +    VN+ V RT+D+SSHL K+++ +T+  P       +++ +      +L+++G +    ++D    + ET+    S  ++ V  G     G      ++T+++H L  +P++I Q+EKQF+ F GN YF+SPYPT+ Q T+V   + NV +Y++   P   +D  + YG ++D   +S++ L VHYENNSPFLT+TS+ R IE+SHWGNIA+EETVDL H+GA LKGPFSRYDYQR  D GISSVKSF TIL +AA+DVYYRDEIGNISTSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RFIDH++DDQV+D  TVK+VLPEG  ++ V  PY +     E+  TYLDT GRTV+V  K NLVE HIQD  VHYS N +LM +EPL+V+ AFY+LF  VI+ VRLDFSITKD A E++M+   + E++ T  +KR  +Y+ +D+++NK+K S+D       +K ++ +HK LT  + ++Q+KL+++  +  DKV E+Q LDS +KE + +S   A+++V+GKL+K  Y+E E +H ++R EL+ K++ ++  L
Sbjct:    7 FFLCFIAAIAVSSRAQDLVNEDVKRTVDLSSHLAKVTAEVTISNPGPGAVHSFLLALEPELGSRLAYLG-VKGEDEEDGALEIQETKVKGKSGMQYTVRFGSSLAPGAKTKVTVETVFTHVLQPYPTQITQAEKQFVTFEGNHYFFSPYPTKSQTTRVKLASRNVETYTKLGNPTRSED-LIEYGPFKDIAPWSQDLLKVHYENNSPFLTITSMTRLIEVSHWGNIAVEETVDLKHTGAYLKGPFSRYDYQRQPDSGISSVKSFKTILPAAAQDVYYRDEIGNISTSHLLILDDSVEMEIRPRFPLFGGWKTHYIIGYNLPSYEYLYNLGDQYALKMRFIDHVFDDQVVDSLTVKIVLPEGAKNVHVDNPYDINRAPDELHYTYLDTFGRTVIVAHKNNLVEQHIQDIVVHYSFNKILMLQEPLLVVGAFYILFFTVILYVRLDFSITKDPAAEARMKAACITEQILTLVNKRLGLYRHFDEAVNKYKLSRDIATLNSGKKTLETEHKNLTNEIASLQSKLKAEGSDLCDKVAEIQKLDSQVKEIVLKSSSEAERLVSGKLKKETYIENEKQHSSRRQELVNKIDNILVGL 595          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Mouse
Match: Rpn1 (ribophorin I [Source:MGI Symbol;Acc:MGI:98084])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 278/577 (48.18%), Postives = 406/577 (70.36%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSIT-VKPD------EEDYVVIINSGFEDQLSFIGALSKTSDD-DKDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VN+ V RT+D+SSHL K+++ +  V P          +V+ +    E +L+ +G   K  D+ D +  V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P S+ ++ L+YG ++D PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I+V +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK +T  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   33 VNEDVKRTVDLSSHLAKVTAEVVLVHPGGGSTSRASSFVLALEPELESRLAHLGVQIKGEDEEDNNLEVRETKIKGKSGRFFTVKLPVALDPGSKISVVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNP-SRSEDVLDYGPFKDIPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIQVDSPYDISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRLGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKAVTSEIAVLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYLENEKLSSGKRQELVTKIDHILDAL 608          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Match: sp|Q91YQ5|RPN1_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus OX=10090 GN=Rpn1 PE=1 SV=1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 278/577 (48.18%), Postives = 406/577 (70.36%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSIT-VKPD------EEDYVVIINSGFEDQLSFIGALSKTSDD-DKDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VN+ V RT+D+SSHL K+++ +  V P          +V+ +    E +L+ +G   K  D+ D +  V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P S+ ++ L+YG ++D PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I+V +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK +T  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   33 VNEDVKRTVDLSSHLAKVTAEVVLVHPGGGSTSRASSFVLALEPELESRLAHLGVQIKGEDEEDNNLEVRETKIKGKSGRFFTVKLPVALDPGSKISVVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNP-SRSEDVLDYGPFKDIPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIQVDSPYDISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRLGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKAVTSEIAVLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYLENEKLSSGKRQELVTKIDHILDAL 608          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Match: sp|E2RQ08|RPN1_CANLF (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Canis lupus familiaris OX=9615 GN=RPN1 PE=1 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 277/577 (48.01%), Postives = 405/577 (70.19%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSITVK-------PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKD-FVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VN+ V RT+D+SSHL K+++ + +             +++ +    E +L+ +G   K  D++++   V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P   +D  L+YG +RD PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GI+S++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I+V +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D++IN++K S+D       +K ++ +HK LT  + ++Q++L+++  +  DKV E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   32 VNEDVKRTVDLSSHLAKVTAEVVLAHPGGGSTARAASFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKVSVVVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSED-LLDYGPFRDIPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGIASIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIQVDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETINRYKQSRDVSTLNSGKKSLETEHKALTSEIASLQSRLKTEGSDLCDKVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 607          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Match: sp|Q5RFB6|RPN1_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii OX=9601 GN=RPN1 PE=2 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 274/577 (47.49%), Postives = 404/577 (70.02%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSITVK-------PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKD-FVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            +N+ V RT+D+SSHL K+++ + +             +++ +    E +L+ +G   K  D++++   V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P   +D  L+YG +RD PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I++ +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK LT  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   32 INEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVRLPVALDPGAKISVIVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSED-LLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 607          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Match: sp|Q4R4T0|RPN1_MACFA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis OX=9541 GN=RPN1 PE=2 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 275/577 (47.66%), Postives = 403/577 (69.84%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSITVK-------PDEEDYVVIINSGFEDQLSFIGALSKTSDD-DKDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            +N+ V RT+D+SSHL K+++ + +             +++ +    E +L+ +G   K  D+ D +  V ET+    S R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P   +D  L+YG +RD PA+S++   VHYENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+RF+DH++D+QVID  TVK++LPEG  +I++ +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D+++N++K S+D       +K ++ +HK LT  +  +Q++L+++  +  D+V E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   32 INEDVKRTVDLSSHLAKVTAEVVLAHLGGSSTSRATSFLLALEPELEARLAHLGVQVKGEDEEDNNLEVRETKIKGKSGRFFIVKLPVALDPGAKISVIVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSED-LLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 607          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Match: sp|Q9GMB0|RPN1_PIG (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Sus scrofa OX=9823 GN=RPN1 PE=1 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 275/577 (47.66%), Postives = 401/577 (69.50%), Query Frame = 2
Query:   59 VNKKVVRTIDISSHLVKISSSITV-------KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKD-FVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VN+ V RT+D+SSHL K+++ + +        P    +++ +    E +L+ +G   K  D++++   V ET+      R F V L    + G  ++  ++T+Y+H L  +P++I QSEKQF+ F GN YFYSPYPT+ Q  +V   + NV SY++   P   +D  L+YG +RD P +S++   VH ENNSPFLT+TS+ R IE+SHWGNIA+EE VDL H+GA LKGPFSRYDYQR  D GISS++SF TIL +AA+DVYYRDEIGN+STSHL  L DSVE+E+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+R +DH++D+QVID  TVK++LPEG  +I+V +PY +     E+  TYLDT GR V+V  K NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VI+ VRLDFSITKD A E++M+V  + E++ T  +KR  +Y+ +D++IN++K S+D       +K ++ +HK LT  V  +Q++L+++  +  DKV E+Q LD+ +KE + +S   A+++V GKL+K  Y+E E     KR EL+ K++ ++ +L
Sbjct:   33 VNEDVKRTVDLSSHLAKVTAEVVLAHAGSSSSPRAASFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKRGRFFTVTLPVALDPGAKISVTVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKSQSMRVKLASRNVESYTKLGNPTRSED-LLDYGPFRDVPPYSQDTFKVHSENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRLVDHVFDEQVIDSLTVKIILPEGAKNIQVDSPYEISRAPDELHYTYLDTFGRPVIVAHKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIVYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETINRYKQSRDVSTLNSGKKSLELEHKALTSEVALLQSRLKTEGSDLCDKVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL 608          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Match: A0A2T7NTC6 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pomacea canaliculata OX=400727 GN=C0Q70_14885 PE=3 SV=1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 312/563 (55.42%), Postives = 422/563 (74.96%), Query Frame = 2
Query:   77 RTIDISSHLVKISSSITVK----PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKF-NVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGL 1747
            R IDI+SHLVK  +SIT++         ++ +++   + +LSFIGA++K + DD+   V +T  S    +KF  V L    + G+S+T +++ I++H L  +PS+I Q+EKQ + F GNLYFY+PY T  Q+T V+T++  V SY++  KPVS  DN + YG + +R  FS+  L VH ENN+ FLTVT L R +E+SHWGNIA+EE VDL HSGA LKGPFSR+DYQR QDG+SSVKSF TIL ++ARDVYYRDEIGNISTSH++EL DSVE+ELRPRFPLFGGWKTHY +GYNVPS+E+LY+K + +A+K+RF+DH+YDD VID A +KV+LPEG  D+KVRTP+ V     ++  TYLDTTGR V+V+ K NLVE HIQDFE+HY+    ++ +EPL+V+ AFYLLFL VI+ VRLDFSITKDEA ES++RV  LVEE+Q+  D+R A+YQSYDD+IN+FK+SKD+  F+  RKK+DAD+++LT  ++++Q +L++++ E ADKV ELQ LDS  KE I  +I LA+K+V  K+ + QY++ E     KR E+ QKMEG+
Sbjct:    3 RKIDIASHLVKTYTSITIENRGSSTVRSFLYVVDPSLQTKLSFIGAVTKDNKDDR-LKVQQTTVSGHDDKKFWRVTLPSGLDAGRSVTVDVEAIFAHALTPYPSQITQAEKQSVVFDGNLYFYTPYQTVSQKTTVVTSSAVVESYTKT-KPVSISDNVITYGPFENRLPFSEAPLRVHEENNAAFLTVTYLERIVEVSHWGNIAVEEHVDLRHSGATLKGPFSRFDYQRNQDGVSSVKSFKTILPASARDVYYRDEIGNISTSHMRELDDSVELELRPRFPLFGGWKTHYYIGYNVPSYEYLYNKGDHYALKMRFVDHLYDDMVIDEAVIKVILPEGSKDMKVRTPFDVIREEDDVHYTYLDTTGRPVIVMRKFNLVEQHIQDFELHYTFQRFMLLQEPLLVVGAFYLLFLAVIVYVRLDFSITKDEAKESRLRVASLVEEVQSVQDRRSALYQSYDDAINRFKTSKDSGAFLASRKKVDADYRQLTTQIHSLQQQLKTEAPEIADKVAELQRLDSQYKEQIALAISLAEKLVANKISRQQYLDSEGGVATKREEIYQKMEGV 563          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Match: V3Z1F4 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_196756 PE=3 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 314/601 (52.25%), Postives = 428/601 (71.21%), Query Frame = 2
Query:    2 MKVLLLFCILALV----------KYSEQTVNKKVVRTIDISSHLVKISSSITVK----PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDF-----VVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGL 1747
            M      C+LA+V            +   VN KV R IDISSH+VKI++SIT++       + Y+ ++++  +++LSFIGA+SK+ D++K        V   +D +  + + +  LG    GK+ T  ++T+++H L  +P+EI Q+EKQF+ F+GNLYF+SPY T  Q T V TT+ N+ SY++  KPVS  DN + YG +  R  F++ EL VH ENNSPFLTVTS+ R IEISHWGNIA+EE +D+ HSGA LKGPFSR+DYQR  DG+SS+KSF T   +AARDVYYRDEIGN+STS+L+EL DSVE+E+RPRFPLFGGWKT Y +GYN+PS+E+L+++ N + +K+R IDH+YDD V+D  TV+++LPEG  DI V  PY V+ G+ E+  TYLDT GR V+VL K NLVE HIQDF V YS   ML+ +EPL+V+ AFYLLFL+VI+ VRLDFSITKDEA ESK+R+  L+ E+Q   DKR A+YQSYDD+INKFKSSKD   F   RKKI+AD+  LTQ +++IQ +L++++ + A+K+ ELQ LDS  K+ I  +I  A+++++ KL K QY+E ++ +  KR E   KME L
Sbjct:    3 MATHFRLCVLAIVLNVVCSANQDSINNDLVNSKVERKIDISSHIVKITTSITIENKGSSSVKSYLFVLDNSLQNKLSFIGAVSKSRDEEKKLDVKLTSVANQKDKSFYRIELSSPLGS---GKTTTLEVETVFAHVLTPYPAEITQAEKQFVVFNGNLYFFSPYKTTTQSTSVTTTSSNIESYTRT-KPVSVSDNVIKYGPFEAREPFTEAELRVHEENNSPFLTVTSIERIIEISHWGNIAVEEHIDMRHSGATLKGPFSRFDYQRNNDGVSSIKSFRTQFPAAARDVYYRDEIGNVSTSNLRELEDSVEIEIRPRFPLFGGWKTQYYIGYNIPSYEYLFNRGNEYGLKMRLIDHVYDDMVVDEVTVRIILPEGSKDIVVDPPYPVKRGSNELHHTYLDTVGRPVIVLYKTNLVEQHIQDFTVTYSFQKMLLLQEPLLVVGAFYLLFLIVIVYVRLDFSITKDEAKESKLRISSLINEVQDAQDKRSALYQSYDDAINKFKSSKDATTFGSSRKKINADYANLTQQISSIQAQLKAEASDAAEKIAELQKLDSQYKDLINSAITSAERLISNKLNKQQYLEADATNTTKREEAESKMEAL 599          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Match: A0A0L8GGA9 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033913mg PE=3 SV=1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 308/573 (53.75%), Postives = 417/573 (72.77%), Query Frame = 2
Query:   68 KVVRTIDISSHLVKISSSITV----KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKD-----NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            KV R ID+SSHL+KIS+S+T+    K     +V +++   ++  +++GA  K+ DD    +  + + +T+  +K N++   D       GK+    L+ IY+H L ++PS+I QSEKQ++ FS NLY +SPY    Q   V   + N+  Y++  KPVS+ +  +NYG Y ++  F+ EEL VH+ENNSPFLTVT + R IEISHWGNIA+EE   + HSGA LKGPFSRYDYQR QDG+SS+KSF TIL +AARDVYYRDEIGNISTSHLKE+ DSVE+ELRPRFPLFGGWKT Y +GYNVPS+E+LY+K +++ +K+R +DH++DDQ++DH TVK++LPEG  +IK++ P+ V  G R++  TYLDT GR V+VL K+NLVE HIQDFE+ YS    L+ +EPL+V+ AFYLLFL+VII VRLDFSITKDEA ESKMR+  L+EE+Q++HDKR A+YQ+YDD+ NKFKS+K+   F   RKKID+D+K+LTQ ++T+Q  L+ +  E A+KV ELQ LDS  KE I Q+I  A+K++  K+ K  Y+E E     KR E+ Q+ME L +SL
Sbjct:   33 KVERGIDVSSHLIKISTSMTIENTGKTTANHFVYVLDPYLQNHEAYVGATLKSEDDK---LKVKKKQTTIKGQK-NIYYQIDLSSGIEPGKTAVVELEEIYTHALQAYPSQIAQSEKQYVVFSTNLYLFSPYRVISQSAVVTCASSNIEFYTKK-KPVSQAETSINYGPYPNKEPFTAEELKVHFENNSPFLTVTYMERVIEISHWGNIAVEEHFQVAHSGATLKGPFSRYDYQRNQDGVSSIKSFKTILPAAARDVYYRDEIGNISTSHLKEMDDSVELELRPRFPLFGGWKTQYYIGYNVPSYEYLYNKGDKYLLKMRLMDHVFDDQIVDHLTVKIILPEGSKNIKLKAPFEVVHGKRQLHFTYLDTIGRPVIVLHKSNLVEQHIQDFELGYSFQKFLLLQEPLLVVGAFYLLFLVVIIYVRLDFSITKDEAKESKMRIASLIEEVQSSHDKRSALYQTYDDATNKFKSNKEASVFQTSRKKIDSDYKQLTQRIHTLQATLKEEGAEAAEKVAELQKLDSQYKELINQAINYAEKLINNKMNKQAYIESEPAISKKRAEINQRMEVLSSSL 600          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Match: K1QWZ6 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Crassostrea gigas OX=29159 GN=CGI_10023347 PE=3 SV=1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 314/594 (52.86%), Postives = 437/594 (73.57%), Query Frame = 2
Query:   14 LLFCILALVKYSE---QTVNKKVVRTIDISSHLVKISSSITV----KPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRK----FNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            ++FCI   VK        +N KV R ID+S+HLVK+S+SIT+    K   + ++  +    ++ LS I A  K  D D+   V++T   T++ +K    + + L  +   GK++T ++++ Y+H L  +P+EI QS+KQ + ++GN+YF+SPYPT+ Q T V TTN  + SYS++ KPVS+ D  + YG Y  R AF++ EL VHYENNSPFLTVT+L R IE+SHWGNIA+EE + + H+GA LKGPFSRYDYQR QDG+SS+K+F T+L +AARDVYYRDEIGNISTS+LKE+ D VE+ELRPRFPLFGGWKT Y +GYNVPS+++L++K + +A+K+RF+DHI+DD V+D  TVK++LPEG  ++++ TPY V +G  ++  TYLDTTGR V+V+ K+NLVE HIQDF++HY+   +L+ +EPL+V+ AFYLLFL VI+ VRLDFSITKDEA ESKMRV  LVEE+Q+ HD+R A+YQSYDD+INK+KS+KD   F   RKK+DAD+K LTQ ++ +Q KL+++  + A+KV ELQ  D   K+ +  +I LA+K+V+GK+ K QY++ E  +  KR +L  KME L +SL
Sbjct:   13 VIFCIECKVKQDTIDGAILNSKVDRKIDVSTHLVKMSTSITLENTGKSPIKSFLYALEPSLQNYLSIITANVK--DKDEKLGVSQT---TVASKKDLSFWRIELPSNLEPGKTMTVDVESSYAHALTPYPAEITQSQKQQVLYNGNVYFFSPYPTKSQTTTVTTTNTAIESYSKSPKPVSQTDRTITYGPYEQREAFAEAELRVHYENNSPFLTVTNLERIIEVSHWGNIAVEEHISMRHTGALLKGPFSRYDYQRAQDGLSSIKAFKTVLPAAARDVYYRDEIGNISTSNLKEMDDFVELELRPRFPLFGGWKTQYYIGYNVPSYQYLFNKGDNYALKMRFVDHIFDDMVVDQVTVKIILPEGAKNMRLETPYPVTQGENQLHFTYLDTTGRPVIVIHKSNLVEQHIQDFQLHYTFQKLLLLQEPLIVVGAFYLLFLAVIVYVRLDFSITKDEAKESKMRVASLVEEVQSAHDRRSALYQSYDDAINKYKSTKDANTFAATRKKVDADYKSLTQQISDLQTKLKNEGSDLAEKVNELQVSDRQYKDLVALAITLAEKLVSGKINKQQYLDNEKINKTKREDLDSKMEALRSSL 601          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Match: A0A1S3GYD0 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Lingula unguis OX=7574 GN=LOC106150524 PE=3 SV=1)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 303/599 (50.58%), Postives = 431/599 (71.95%), Query Frame = 2
Query:    2 MKVLLLFCILALVKYSEQTVNKKVV-----RTIDISSHLVKISSSITVKPDEEDYV-----VIINSGFEDQLSFIGALSKTSD-DDKDFVVTETEDSTLSQ--RKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            +  LL  C  A    ++ TVN  +V     R IDIS+HL K+++ IT++   +  V      + ++  +D+LSFIGA +K  D +D +  V+ET  +T ++  + + + +     G + T  ++T+++H L  +P++I Q EKQ M++ GNLY+YSPY T+ Q T V  ++  + SY++  KPVS  D  + YG Y  RPAF+K E+ +HYENN+PFLTVT L R IE+SHWGNIA+EET D+YH+GAKLKGPFSRYDYQR QDG SS+KSF T+L + A+D+YYRDEIGNISTS+L+E  + +E+ELRPRFPLFGGWKTHY +GYN+P++++LY+  + +A+K+ F+DH+YDDQVID+ TVK++LPEG  +I+   PY V+  A  +  TYLDT GR V+ L K NLVENHIQDF++ Y+   +L+ +EPL+V++AF+LLF +VII VRLDFSITKDEA ES+MRV GLVEE+Q  HDKR A+YQSYDD+++K+K++KDT  F   RKKIDAD+K LT+    +Q KL+ +  + A+KV ELQ LD+  +E +  +I  A+K++ GK+ K QY+E E+   +K+ +++ KME +VTSL
Sbjct:   11 VSTLLATCCTA----NQDTVNTAIVNSNVERKIDISTHLAKVTNVITLENTGKGAVRSFLFALEDADAKDRLSFIGAQTKVEDGEDSNLPVSETTVTTDAKGAKFWRIDIPALGEGSTTTVTVETVFTHILRPYPAQITQGEKQLMQYHGNLYYYSPYSTKTQTTSVQLSSSTIESYTK-TKPVSVNDKTITYGPYESRPAFTKGEVVIHYENNTPFLTVTHLTRTIEVSHWGNIAVEETFDMYHTGAKLKGPFSRYDYQRHQDGASSIKSFKTVLPANAKDIYYRDEIGNISTSNLREQDEGMELELRPRFPLFGGWKTHYTIGYNIPAYQYLYNSGSNYALKMPFVDHVYDDQVIDYITVKIILPEGSKNIQFNPPYDVKRDADSLHFTYLDTVGRPVVTLHKTNLVENHIQDFQLDYTFGKVLLLQEPLLVVLAFWLLFTVVIIYVRLDFSITKDEASESRMRVAGLVEEVQNVHDKRSALYQSYDDAVDKYKANKDTAAFTAQRKKIDADYKALTEQFKALQAKLKQEGTDVAEKVAELQRLDTQFREQVNIAISYAEKLIAGKIPKAQYLEAETSTKSKKEDILGKMENIVTSL 604          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Cavefish
Match: rpn1 (ribophorin I [Source:NCBI gene;Acc:103038778])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 280/591 (47.38%), Postives = 401/591 (67.85%), Query Frame = 2
Query:    8 VLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDE----EDYVVIINSGFEDQLSFIGALSK-TSDDDKDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VL L   L+    ++  +N++V RT+D+S+HL K+SS I +          + + +       L+FIGA  K   ++D+   + ET     S   F V L      G  L   ++T+ SH L  FP+ I Q+E+Q + F GN Y YSPYPT  Q T+V   + N  SY++   P SK D  + YG ++D   FS++ + +HYENNSPFLT++S+ R IE+SHWGNIA+EET+DL H+GA LKGPFSRYDYQR  D GISSVKSF TIL ++A+DVYYRDEIGNISTSHL+ L DSVEVE+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+R IDH+YDDQ+IDH TVK++LPEG  ++ + TPY +     ++  TYLDT GR VLV +K+NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDFSITKD A E +M+V  + E++ T  +KR  +Y+  D+ +N++K S+DT      RK ++A+H+ LT  +  +Q +L+++  + A+KV E+Q LD  +K+ + QS Q ++++V GK++K  Y+  E     K+ EL+ +++ L+ +L
Sbjct:   15 VLALGWALSGAAAADGLLNEEVKRTVDLSTHLAKVSSEILLANQGSSPVHSFTLALEPELGPHLAFIGASVKGEEEEDEALELKETALQGRSGTFFQVQLPSALAAGGKLRVKVETVLSHVLRPFPTHITQAERQLVVFQGNHYLYSPYPTRSQTTRVRLASKNAESYTKLGNP-SKNDEVIEYGPFKDVAPFSQDTMKIHYENNSPFLTISSITRTIEVSHWGNIAVEETIDLRHTGAYLKGPFSRYDYQRQSDSGISSVKSFKTILPASAQDVYYRDEIGNISTSHLQVLEDSVEVEVRPRFPLFGGWKTHYIIGYNLPSYEYLYTLGDQYALKMRLIDHVYDDQIIDHMTVKLILPEGARNVHLDTPYSIDRSPDQLHYTYLDTFGRPVLVATKSNLVEQHIQDVVVHYTFNKILMLQEPLLVVGAFYILFFTVIIYVRLDFSITKDPAAEVRMKVASITEQVLTLVNKRLGLYRQMDEVVNRYKQSRDTGALNSGRKTLEAEHRNLTNEIAALQARLKTEGSDLAEKVGEIQKLDGQVKDLVCQSCQESERLVAGKVKKETYITSEKTLSGKKQELISRIDSLLDAL 604          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Yeast
Match: OST1 (Alpha subunit of the oligosaccharyltransferase complex of the ER lumen; complex catalyzes asparagine-linked glycosylation of newly synthesized proteins [Source:SGD;Acc:S000003539])

HSP 1 Score: 117.472 bits (293), Expect = 1.390e-28
Identity = 118/477 (24.74%), Postives = 211/477 (44.23%), Query Frame = 2
Query:   11 LLLFCILALVKYSEQTVNKKV--VRTIDISSHLVKISSSITVK-----PDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFV--------VTETEDSTLSQRKFNVHLGKDNVG--KSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSK------QDNKLNYGTYRDRPAFSKEE-LAVHYENNSPFLTVTSLNRHIEISHWGN-IAIEETVDLYHSGAKLKGPFSRYD-YQRMQDGISSVKSFTTIL----HSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLY---SKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLD-TTGRTVLVLSKANLVENHIQDFEV--HYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITK 1333
            L  F + +  +Y      + V   RTID+S+  +  +  IT+K     P  E Y     SG   ++SF  A      ++  F+         T   D   S+ ++ +    + +   + ++  +K+ Y+   + +P  +  SE+Q + +  N    S Y T++    +I ++    S+ +   P  +        N   +G + D P FS  E LA+ Y +N+P   V +L R I +SHW + I  EE  +L +  AKL   FSR +  +++Q        F T+L       A D Y+ D +G +STSH    ++     +RPRFP+FGGW  ++ +G+     +FL+     D +F   +  ++    D V D+  + V LPEG +   + +P      + E  K+Y D   G   L  S  NL+ + + + +V   Y        ++PL +    +   + V +   L+ ++T 
Sbjct:   14 LCFFNVSSAAQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATE-YFTAFESGIFSKVSFFSAYFT---NEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSS----SFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSH----AERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGP-PDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLI-SQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN 476          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Nematostella
Match: EDO44499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVR9])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 269/600 (44.83%), Postives = 392/600 (65.33%), Query Frame = 2
Query:    8 VLLLFCILALVKYSEQTVNKKVV-----RTIDISSHLVKISSSITVKPDEEDYV----VIINSGFEDQLSFIGALSKTSDDD------KDFVVTETEDSTLSQRKFNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            VLL  C +  +   +  +N  +V     R ID+SS LVK+S+SIT+       V      ++    D L+ + A  K  DD+      K+ V+    D  +    F V+L      G S+  +++ +++H +  FP+++ QS+K  + F+GN Y ++ Y ++QQ T +  ++ N+ SY++ +KP S+ DN +  G Y D  AF +  L VH+ENNSPF+ V  + R IE+SHWGNIA+EET  + H GA+LKG FSRYDYQR     +S+KSF TIL +AA DVYYRDEIGNISTSH+    +SVE+ELRPRFPLFGGW+T Y++GYNVPS+E+L+S  N + +K+RF+DHI+DD VID  T+KV+LPEG  DIK++TP+ + EG RE+  TYLDT GR V+V  K N++E HIQDF + Y+ N +++ +EPL+++ AFYLLFLLVII VR+DFSI+KDEA ESKMR  GLVEE+    D+RC +Y  Y D++ K+KSSKD   F   RKK+D D++ +   V  +Q +L  +  +  +K+ ELQ  +   K+ + Q+I +A+K+V G+L K  Y++ E+ +  KR  L  ++E +  +L
Sbjct:    9 VLLTACYIFTLTPVDADINHDLVLSKASRKIDLSSQLVKVSTSITLDNGGNQPVDSFHFAVDPSVADNLALLSASFKDGDDETVHLSVKETVIPSHRDLKI----FLVNLATPLQSGGSVDVSVEEVFAHAMKPFPAKVAQSDKHQVLFTGNHYTFAVYKSKQQSTTITLSSSNIESYTK-LKPSSQSDNTITLGPYSDVDAFKQSTLKVHFENNSPFMAVVDMLRIIEVSHWGNIAVEETYHIKHVGAELKGSFSRYDYQRTP-APTSIKSFKTILPAAAADVYYRDEIGNISTSHMLNQEESVELELRPRFPLFGGWQTRYLIGYNVPSYEYLHSSGNNYVLKMRFVDHIFDDFVIDQMTLKVILPEGSKDIKLKTPFPINEGKRELQFTYLDTVGRPVVVAHKTNVIEQHIQDFALQYTFNKVMLLQEPLLIVGAFYLLFLLVIIYVRMDFSISKDEASESKMRAAGLVEEVLRLLDRRCGLYNVYMDAVGKYKSSKDVAAFTNARKKLDTDYRAIGNQVTQLQKQLAHEQSDAVEKIGELQRKEHERKQLLDQAIVMAEKVVNGRLNKQTYVDNENSNKQKRERLSGEIEAIAATL 602          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Medaka
Match: rpn1 (ribophorin I [Source:NCBI gene;Acc:101169353])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 284/590 (48.14%), Postives = 410/590 (69.49%), Query Frame = 2
Query:   14 LLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVK---PDE-EDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRK--FNVHLGKD-NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQD-GISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            LL   L L  Y++  VN+ V RT+D+ +HL KI++ I +    P   +++++ +      +L++IGA S   D+++D  +   + S   QR   + V L      G  L   ++  +SH L  FPS I Q+E+Q + F GN YFYSPYPT  Q T+V   +  V SY++   P SK D  + YG +RD   FS++ + +HYENN+PFLT+TS+ R IE+SHWGNIA+EET+DL H+GA LKGPFSRYDYQR  D GISSVKSF TIL ++A+DVYYRDEIGNISTSHL+ L DSVEVE+RPRFPLFGGWKTHY++GYN+PS+E+LY+  +++A+K+R +DH+YDDQVIDH TV+++LPEG  +I + TPY +     ++  TYLDT GR VLV +K+NLVE HIQD  VHY+ N +LM +EPL+V+ AFY+LF  VII VRLDF+ITKD A E +M+V  + E++ T  +KR  +Y+  D+ +N++K S+DT      RK ++A+H+ LT  ++T+Q +L+++  + A+KV E+Q LD  +K+ + +S Q A+++V GK++K  Y+E E    +KR EL+ +++ L+ +L
Sbjct:   13 LLLVALGLEVYADGLVNEDVKRTVDLGTHLAKITAEIVLSNQGPSAVQNFILAVEPDLAPRLAYIGA-SVKGDEEEDGTLELQQTSIQGQRGDFYKVQLSSSLAPGAQLKAKVEMAFSHVLKPFPSHITQAERQLVVFQGNHYFYSPYPTRSQTTRVRLASKTVESYTKLGNP-SKTDEVIEYGPFRDVAPFSEDTMKIHYENNTPFLTITSIVRTIEVSHWGNIAVEETIDLRHTGAVLKGPFSRYDYQRQSDSGISSVKSFKTILPASAQDVYYRDEIGNISTSHLQVLDDSVEVEVRPRFPLFGGWKTHYMIGYNLPSYEYLYTLGDQYALKMRLVDHVYDDQVIDHMTVRIILPEGAKNIHIDTPYKIDRMPNQLHYTYLDTFGRPVLVATKSNLVEQHIQDLVVHYNFNKILMLQEPLLVVGAFYILFFTVIIYVRLDFAITKDPAAEVRMKVASITEQVLTLVNKRLGLYRHMDEVVNRYKQSRDTGALNSGRKTLEAEHRTLTNDISTLQARLKAEGSDLAEKVAEVQKLDGQVKDLVFRSCQEAERLVAGKVKKEAYIENEKSLTSKRQELISRIDSLLDTL 600          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Planmine SMEST
Match: SMESG000070862.1 (SMESG000070862.1)

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 586/586 (100.00%), Postives = 586/586 (100.00%), Query Frame = 2
Query:    2 MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL
Sbjct:    1 MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 586          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Planmine SMEST
Match: SMESG000070862.1 (SMESG000070862.1)

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 586/586 (100.00%), Postives = 586/586 (100.00%), Query Frame = 2
Query:    2 MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 1759
            MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL
Sbjct:    9 MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDYVVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKDNVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYENNSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQDGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFPLFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVKVVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHIQDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIESKMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDADHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADKIVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL 594          
The following BLAST results are available for this feature:
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPN10.000e+047.49ribophorin I [Source:HGNC Symbol;Acc:HGNC:10381][more]
RPN14.553e-16752.57ribophorin I [Source:HGNC Symbol;Acc:HGNC:10381][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ribo-13.849e-11537.79Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG333038.575e-13045.37gene:FBgn0053303 transcript:FBtr0332197[more]
CG333038.575e-13045.37gene:FBgn0053303 transcript:FBtr0080052[more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn10.000e+046.52ribophorin I [Source:ZFIN;Acc:ZDB-GENE-030131-4286... [more]
rpn16.334e-1532.41ribophorin I [Source:ZFIN;Acc:ZDB-GENE-030131-4286... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpn10.000e+047.21ribophorin I [Source:NCBI gene;Acc:395031][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpn10.000e+048.18ribophorin I [Source:MGI Symbol;Acc:MGI:98084][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YQ5|RPN1_MOUSE0.000e+048.18Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|E2RQ08|RPN1_CANLF0.000e+048.01Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q5RFB6|RPN1_PONAB0.000e+047.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q4R4T0|RPN1_MACFA0.000e+047.66Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q9GMB0|RPN1_PIG0.000e+047.66Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NTC60.000e+055.42Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
V3Z1F40.000e+052.25Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A0L8GGA90.000e+053.75Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
K1QWZ60.000e+052.86Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A1S3GYD00.000e+050.58Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpn10.000e+047.38ribophorin I [Source:NCBI gene;Acc:103038778][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OST11.390e-2824.74Alpha subunit of the oligosaccharyltransferase com... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO444990.000e+044.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpn10.000e+048.14ribophorin I [Source:NCBI gene;Acc:101169353][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000070862.10.000e+0100.00SMESG000070862.1[more]
SMESG000070862.10.000e+0100.00SMESG000070862.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007747 ID=SMED30007747|Name=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1768bp
AATGAAAGTGTTGCTTTTGTTTTGTATTCTGGCTCTTGTTAAATATAGTG
AACAAACTGTAAATAAAAAAGTAGTTAGGACAATAGATATTTCGTCCCAC
TTGGTTAAAATTAGCTCATCTATTACCGTTAAACCTGACGAGGAAGATTA
TGTCGTAATTATTAATTCTGGCTTTGAAGATCAATTATCATTTATTGGTG
CTTTGAGCAAAACTAGTGATGATGACAAAGATTTTGTCGTTACCGAGACT
GAAGACAGTACGTTAAGTCAACGAAAATTTAATGTTCATTTGGGGAAAGA
TAATGTTGGTAAATCACTAACATTTAATCTTAAGACAATCTACTCCCACA
AATTGGTTTCTTTCCCATCAGAAATTAAACAGTCTGAAAAACAATTTATG
AAATTTTCTGGGAATTTATATTTTTACTCGCCTTACCCTACTGAACAACA
GGAAACTCAAGTTATAACAACTAATGGAAACGTGATATCATATTCTCAAG
CTGTTAAACCAGTATCGAAACAAGATAATAAGTTGAATTACGGTACATAC
CGTGATAGGCCAGCATTTTCTAAAGAAGAATTAGCTGTTCATTATGAAAA
CAATTCTCCTTTCTTGACCGTAACTTCGCTTAATCGGCACATAGAAATTT
CTCATTGGGGTAATATTGCCATAGAAGAAACCGTAGATCTTTATCATAGT
GGAGCAAAATTGAAAGGGCCATTCTCAAGATACGATTATCAAAGAATGCA
AGATGGAATCTCATCTGTAAAGAGTTTTACAACAATTCTTCATTCAGCTG
CCCGTGATGTTTATTATCGTGATGAAATTGGGAATATTAGTACTAGTCAT
TTAAAAGAATTGTCTGATTCGGTTGAAGTAGAATTAAGACCTCGCTTTCC
TCTTTTTGGTGGTTGGAAAACACATTACGTATTAGGTTACAATGTACCTA
GTTTCGAATTTCTTTATTCCAAAGATAACCGTTTTGCAGTTAAATTAAGG
TTTATTGATCATATTTACGATGATCAAGTAATTGATCATGCCACAGTTAA
AGTTGTTCTGCCAGAAGGAGTGGATGATATCAAAGTCAGAACTCCTTATC
TGGTTAGAGAAGGTGCAAGAGAAATTTTGAAAACTTATCTGGATACTACA
GGTCGAACTGTTTTGGTCCTTAGTAAAGCTAATTTAGTTGAGAATCATAT
TCAAGATTTTGAGGTGCATTATTCTCTCAATGTTATGCTTATGGCGAGGG
AGCCGTTAATGGTCATCGTTGCGTTTTATCTTTTGTTTTTATTGGTCATT
ATATGTGTTAGACTTGATTTCTCAATTACAAAGGACGAAGCAATTGAGAG
CAAAATGAGAGTTGATGGATTAGTTGAAGAATTACAAACAACTCACGATA
AAAGATGTGCAGTTTATCAATCATATGATGATTCGATTAACAAATTCAAA
TCTAGCAAGGACACTGAGAAATTTGTTAAGGATCGAAAGAAAATAGATGC
TGATCACAAGAAATTGACACAGACTGTTAACACTATTCAAAACAAATTGA
GATCGGATTCTATTGAATGTGCGGATAAAGTGAAAGAATTGCAAAATTTA
GATAGTGCAATGAAAGAAGCAATTGGTCAAAGCATTCAATTAGCAGATAA
AATTGTAACTGGAAAACTACAAAAACCCCAATACATGGAACTTGAAAGCA
AGCATGTCGCTAAACGAACTGAACTAATGCAAAAGATGGAAGGTCTTGTA
ACTTCCCTTTAGGCCGAG
back to top

protein sequence of SMED30007747-orf-1

>SMED30007747-orf-1 ID=SMED30007747-orf-1|Name=SMED30007747-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=587bp
MKVLLLFCILALVKYSEQTVNKKVVRTIDISSHLVKISSSITVKPDEEDY
VVIINSGFEDQLSFIGALSKTSDDDKDFVVTETEDSTLSQRKFNVHLGKD
NVGKSLTFNLKTIYSHKLVSFPSEIKQSEKQFMKFSGNLYFYSPYPTEQQ
ETQVITTNGNVISYSQAVKPVSKQDNKLNYGTYRDRPAFSKEELAVHYEN
NSPFLTVTSLNRHIEISHWGNIAIEETVDLYHSGAKLKGPFSRYDYQRMQ
DGISSVKSFTTILHSAARDVYYRDEIGNISTSHLKELSDSVEVELRPRFP
LFGGWKTHYVLGYNVPSFEFLYSKDNRFAVKLRFIDHIYDDQVIDHATVK
VVLPEGVDDIKVRTPYLVREGAREILKTYLDTTGRTVLVLSKANLVENHI
QDFEVHYSLNVMLMAREPLMVIVAFYLLFLLVIICVRLDFSITKDEAIES
KMRVDGLVEELQTTHDKRCAVYQSYDDSINKFKSSKDTEKFVKDRKKIDA
DHKKLTQTVNTIQNKLRSDSIECADKVKELQNLDSAMKEAIGQSIQLADK
IVTGKLQKPQYMELESKHVAKRTELMQKMEGLVTSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000484secretory system
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR007676Ribophorin_I
Vocabulary: molecular function
TermDefinition
GO:0004579dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007676Ribophorin IPFAMPF04597Ribophorin_Icoord: 20..434
e-value: 6.8E-129
score: 430.9
IPR007676Ribophorin IPANTHERPTHR21049RIBOPHORIN Icoord: 4..567
NoneNo IPR availablePANTHERPTHR21049:SF0DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 1coord: 4..567
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.72
NoneNo IPR availableTMHMMTMhelixcoord: 419..441