SMED-SMAD6/7-1

Overview
NameSMED-SMAD6/7-1 (AFK29379.1)
Smed IDSMED30007744
Length (bp)1322
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED-SMAD6/7-1 (SMED30007744) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED-SMAD6/7-1 (SMED30007744) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED-SMAD6/7-1 (SMED30007744) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED-SMAD6/7-1 (SMED30007744) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007744

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior pole progenitor cellSMED30007744SMESG000002697.1 SMED30007744smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30007744SMESG000002697.1 SMED30007744smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007744SMESG000002697.1 JQ278719.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30007744SMESG000002697.1 JQ278719.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007744SMESG000002697.1 JQ278719smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30007744SMESG000002697.1 JQ278719smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30007744SMESG000002697.1 dd_Smed_v4_9186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007744SMESG000002697.1 dd_Smed_v4_9186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007744SMESG000002697.1 dd_Smed_v4_9186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30007744SMESG000002697.1 dd_Smed_v4_9186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007744SMESG000002697.1 dd_Smed_v4_9186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
sigma neoblastSMED30007744SMESG000002697.1 JQ278719.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30007744SMESG000002697.1 JQ278719.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED-SMAD6/7-1 vs. Ensembl Fly
Match: Dad (gene:FBgn0020493 transcript:FBtr0083394)

HSP 1 Score: 54.299 bits (129), Expect = 1.341e-7
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  898 LGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKL-SQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            LG+ +  L N  V +YN     IF+ S        N ++      V K++P + +  F  ++ + + +      P+     F+++ISFGKGWGR Y R   + CPC  E+
Sbjct:  463 LGVTL-SLENGDVWIYNRGNTTIFVDS---PTLSENLDR------VCKVMPGYCLKAFETNRAELLSMRDHGHHPMGPVDYFSIKISFGKGWGRDYKRQDIMGCPCWLEV 562          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Fly
Match: Dad (gene:FBgn0020493 transcript:FBtr0083393)

HSP 1 Score: 54.299 bits (129), Expect = 1.341e-7
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  898 LGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKL-SQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            LG+ +  L N  V +YN     IF+ S        N ++      V K++P + +  F  ++ + + +      P+     F+++ISFGKGWGR Y R   + CPC  E+
Sbjct:  463 LGVTL-SLENGDVWIYNRGNTTIFVDS---PTLSENLDR------VCKVMPGYCLKAFETNRAELLSMRDHGHHPMGPVDYFSIKISFGKGWGRDYKRQDIMGCPCWLEV 562          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Fly
Match: Dad (gene:FBgn0020493 transcript:FBtr0100160)

HSP 1 Score: 54.299 bits (129), Expect = 1.341e-7
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  898 LGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKL-SQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            LG+ +  L N  V +YN     IF+ S        N ++      V K++P + +  F  ++ + + +      P+     F+++ISFGKGWGR Y R   + CPC  E+
Sbjct:  463 LGVTL-SLENGDVWIYNRGNTTIFVDS---PTLSENLDR------VCKVMPGYCLKAFETNRAELLSMRDHGHHPMGPVDYFSIKISFGKGWGRDYKRQDIMGCPCWLEV 562          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Zebrafish
Match: smad6a (SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-011015-1])

HSP 1 Score: 55.4546 bits (132), Expect = 1.143e-8
Identity = 35/102 (34.31%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIP--VYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIF---TVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V  YN +  PIF++S   E        H PY+   V +++P +S+ VF  ++  + ++   S P+   G +   +V+ISF KGWG  YSR     CPC  EI
Sbjct:   80 VWAYNRSQHPIFVNSPTLE--------HHPYLSLTVRRVMPGYSIKVFDYEK--SCQMQPASHPVHPEGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEI 171          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Zebrafish
Match: smad6a (SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-011015-1])

HSP 1 Score: 55.4546 bits (132), Expect = 1.143e-8
Identity = 35/102 (34.31%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIP--VYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIF---TVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V  YN +  PIF++S   E        H PY+   V +++P +S+ VF  ++  + ++   S P+   G +   +V+ISF KGWG  YSR     CPC  EI
Sbjct:   80 VWAYNRSQHPIFVNSPTLE--------HHPYLSLTVRRVMPGYSIKVFDYEK--SCQMQPASHPVHPEGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEI 171          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Zebrafish
Match: smad6a (SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-011015-1])

HSP 1 Score: 55.4546 bits (132), Expect = 6.587e-8
Identity = 35/102 (34.31%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIP--VYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIF---TVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V  YN +  PIF++S   E        H PY+   V +++P +S+ VF  ++  + ++   S P+   G +   +V+ISF KGWG  YSR     CPC  EI
Sbjct:  359 VWAYNRSQHPIFVNSPTLE--------HHPYLSLTVRRVMPGYSIKVFDYEK--SCQMQPASHPVHPEGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEI 450          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Zebrafish
Match: smad7 (SMAD family member 7 [Source:ZFIN;Acc:ZDB-GENE-030128-3])

HSP 1 Score: 48.9062 bits (115), Expect = 2.363e-6
Identity = 31/98 (31.63%), Postives = 47/98 (47.96%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTI-KLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V +YN +  PIFI S   +      N     + V+K+ P  S+  F  ++  ++ + +           FTVQISF KGWG+ Y+R     CPC  E+
Sbjct:   83 VWVYNRSCYPIFIKSATLD------NPDSRTLLVHKVFPGFSIKAFDFEKAGSLQRPNDHEFSQQPRTGFTVQISFVKGWGQCYTRQFISSCPCWLEV 174          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Xenopus
Match: SMAD7 (SMAD family member 7 [Source:NCBI gene;Acc:100486892])

HSP 1 Score: 53.5286 bits (127), Expect = 2.963e-7
Identity = 79/301 (26.25%), Postives = 120/301 (39.87%), Query Frame = 1
Query:  421 ILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRY-FDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQD------CINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAI-SSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNR------------------------FVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGI-FTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            +L KL  +QL+  L+  +     +S   ++P  K  S L +  F +  +   L   FR   L  S+E+K +S C +         C NP H S +  +ES        Y   F       L + ET  P+     A     + V  +Y    PS+  D   D L Q  G C+ QLN+                          V +YN ++ PIFI S   +  D         + V+K+ P  S+  F  ++  +++       +      FTVQISF KGWG+ Y+R     CPC  E+
Sbjct:   66 VLKKLKEKQLEGLLQAVECKGGARSPCLLLPAAKLDSRLGQQPFSLPLL---LCKVFRWPDLRHSSEVKRLSCCDSYGKNNPELVCCNPHHLSRLCELES-PPPPYTRYPMDFLKPTDSQL-LHETGDPSHWCVVAYWEEKTRVGRLYSVQEPSL--DIFYD-LPQGNGFCLGQLNSDNKSQLVQKVRSKIGYGIQLTKEVDGVWVYNRSSYPIFIKSATLDNPDSR------TLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEV 352          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Xenopus
Match: ENSXETT00000014299.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460985.1:12824:13444:1 gene:ENSXETG00000004008.1 transcript:ENSXETT00000014299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 8.439e-7
Identity = 36/105 (34.29%), Postives = 48/105 (45.71%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGI---FTVQISFGKGWGRGYSRSSFLYCPCRCEISIILP 1239
            V +YN +  PIF++S                  VYK+LP +S+ VF         +S +S   L  G     +V+ISF KGWG  YSR     CPC  EI +  P
Sbjct:   99 VWVYNRSDHPIFVNSPTLAPMSGRGQS------VYKVLPGYSIKVFEQG------VSMSSYTYLGDGPCDPHSVRISFAKGWGSSYSRQFITSCPCWLEILLCPP 191          
BLAST of SMED-SMAD6/7-1 vs. TrEMBL
Match: I3RSU1 (SMED-SMAD6/7-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 339/340 (99.71%), Postives = 340/340 (100.00%), Query Frame = 1
Query:  229 MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF 1248
            MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRI+ETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF
Sbjct:    1 MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIKETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF 340          
BLAST of SMED-SMAD6/7-1 vs. TrEMBL
Match: A0A443RNH5 (Mothers against decapentaplegic homolog OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_10849 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.693e-7
Identity = 58/229 (25.33%), Postives = 96/229 (41.92%), Query Frame = 1
Query:  610 SNEIKFMSICSNRQDCINPFHWSLM---KTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDC---------KPDSLWQE------LGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPY-IPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGI--FTVQISFGKGWGRGYSRSSFLYCPCRCEISII 1233
             +E+K +  C  R  CINP+HWS +    ++E +   ++ L+      +       +E +         +  +   FI  +   P     C         K DS+  +      LGI I + +N  V +YN +  P+F++S       H  +      + VYK+LP +S+  F  D+       Q  I         +T++ISF KGWG  YSR     CPC  E+ ++
Sbjct:   89 GDELKCLVWCHARDLCINPYHWSKLCKSDSLECVPTSEDRLWSEPGCWAEMAYWEFKERVG-------RLFPVHDNFINVFADLPRGNGFCLKSMSAVSNKHDSVTTKIKNKIGLGITISREDNS-VWVYNRSNYPVFLNS-------HTLDPPTARKLTVYKLLPGYSIKAFDYDKAAKYSPLQEKIQSEEGPFDPYTIRISFTKGWGPKYSRQCITNCPCWLELILV 302          
BLAST of SMED-SMAD6/7-1 vs. TrEMBL
Match: A0A443SWF2 (Mothers against decapentaplegic homolog OS=Leptotrombidium deliense OX=299467 GN=B4U80_09881 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 8.187e-7
Identity = 76/335 (22.69%), Postives = 133/335 (39.70%), Query Frame = 1
Query:  304 FVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDC---INPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQL---NNRFVSL----YNYTTQPIFISSICKEIQDHNFNKH---------DP----YIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGI--FTVQISFGKGWGRGYSRSSFLYCPCRCEISII 1233
            F  KR  + N ++    ++  R         ++  +   +LA L+  QL+  LE   S    +S     PC+   +N      +   + +    +R   +    ++K +  C  R  C   INP+HWS +   ES+               +  +    +T+   +I    ++         Y+S  +V TD    S     G C+  +   N R  S+    +N     I IS     +  +N +K+         DP     + V+KILP +S+  F  ++++     Q  I         +T++ISF KGWG  YSR S + CPC  E+ ++
Sbjct:    2 FRSKRGSLLNALWQRSRDHSDR----DGDTASLKSVAFAMLAPLSEHQLRTLLEAIDSKGGERS-----PCV-FVNNSIPDAQVAAPQLLACRLWRWPQVLCDEKLKCLLFCRTRDSCTVCINPYHWSRIAKAESIEC-------------VSADKHCPDTVSWCEIAYWELNERIGRLFPVYESSINVFTDLPHGS-----GFCLKNVDVANKRMESVITRTHNKIGFGIMISREGDSVWVYNRSKYPVFLNSHTLDPPTVRRLTVHKILPGYSIQAFDYEKVEKYLPVQEKIRSEEGPFDPYTIRISFAKGWGPKYSRQSIMSCPCWLEVILV 308          
BLAST of SMED-SMAD6/7-1 vs. TrEMBL
Match: A0A0R3W6J8 (MH2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5832 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.283e-6
Identity = 46/134 (34.33%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  838 YYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYT-TQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQT--SIPILNSGIF--TVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            YY S P  ++  K        GI +  L    + L N T   PIF++S C  +Q  N    D   PVY++ P  S+ VF + +I   +L++   S P     +F   + IS GKGWG  Y R+ F +CP R EI
Sbjct:  116 YYPSIPYSSSPTKQRRRLSHEGISLLLLPKGQILLTNKTPATPIFVASPCF-VQQGNLIAGD--WPVYRVAPTCSLVVFDM-RIYEDRLTEVCKSTPWPGKSLFGPVLHISLGKGWGPTYRRTDFTHCPARLEI 245          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Cavefish
Match: smad6b (SMAD family member 6 [Source:NCBI gene;Acc:103029602])

HSP 1 Score: 55.8398 bits (133), Expect = 5.088e-8
Identity = 35/100 (35.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIF---TVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V  YN +  PIF++S   E            + V K++P +S+ VF  ++   + L Q + P L  G +   +V+ISF KGWG  YSR     CPC  EI
Sbjct:  380 VWAYNRSQHPIFVNSPTLEAGPATRG----LLVVRKVMPGYSIKVFDYER-SALLLRQGAEPALPDGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEI 474          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Medaka
Match: smad7 (SMAD family member 7 [Source:NCBI gene;Acc:101165328])

HSP 1 Score: 55.8398 bits (133), Expect = 3.832e-8
Identity = 74/302 (24.50%), Postives = 123/302 (40.73%), Query Frame = 1
Query:  421 ILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQD------CINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQL--NNR----------------------FVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQ----TSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            +L K+  +QL++ L+  +S    +S   ++P         + + +  +   L+  FR   L  S+E+K +S C +         C NP H S +  +ES     +     Y       +L ++++ R    +       + V  +Y    PS+  D   D L Q  G C+ QL  +N+                       V +YN +  PIFI S   +  D         + V+K+ P  S+  F  D+ ++++       T  P      FTVQISF KGWG+ Y+R     CPC  E+
Sbjct:   62 VLKKIKEKQLEVLLQAVESKGGVRSPCLLLPSKVDAKVGQQSYSLPML---LYKVFRWPDLRHSSELKRLSCCESYGKANPELVCCNPHHMSRLCELESPPPPYSRYPMDYLKPPD--SLALQDSERGYWCVVAYWEEKTRVGRLYSVQEPSL--DIFYD-LPQGNGFCLGQLCSDNKSQLVQMVRSKIGYGIQLTREPDGVWVYNRSCYPIFIKSATLDNPDSR------TLLVHKVFPGFSIKAFDYDKANSLQRPNDHEFTQQPRTG---FTVQISFVKGWGQCYTRQFISSCPCWLEV 346          
BLAST of SMED-SMAD6/7-1 vs. Ensembl Medaka
Match: smad7 (SMAD family member 7 [Source:NCBI gene;Acc:101165328])

HSP 1 Score: 50.8322 bits (120), Expect = 1.422e-6
Identity = 34/101 (33.66%), Postives = 49/101 (48.51%), Query Frame = 1
Query:  934 VSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQ----TSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEI 1224
            V +YN +  PIFI S   +      N     + V+K+ P  S+  F  D+ ++++       T  P      FTVQISF KGWG+ Y+R     CPC  E+
Sbjct:  279 VWVYNRSCYPIFIKSATLD------NPDSRTLLVHKVFPGFSIKAFDYDKANSLQRPNDHEFTQQPRTG---FTVQISFVKGWGQCYTRQFISSCPCWLEV 370          
BLAST of SMED-SMAD6/7-1 vs. Planmine SMEST
Match: SMESG000002697.1 (SMESG000002697.1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 340/340 (100.00%), Postives = 340/340 (100.00%), Query Frame = 1
Query:  229 MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF 1248
            MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF
Sbjct:    1 MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLTVQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGCSNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWSLMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSVFIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF 340          
The following BLAST results are available for this feature:
BLAST of SMED-SMAD6/7-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dad1.341e-729.09gene:FBgn0020493 transcript:FBtr0083394[more]
Dad1.341e-729.09gene:FBgn0020493 transcript:FBtr0083393[more]
Dad1.341e-729.09gene:FBgn0020493 transcript:FBtr0100160[more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smad6a1.143e-834.31SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-01... [more]
smad6a1.143e-834.31SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-01... [more]
smad6a6.587e-834.31SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-01... [more]
smad72.363e-631.63SMAD family member 7 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SMAD72.963e-726.25SMAD family member 7 [Source:NCBI gene;Acc:1004868... [more]
ENSXETT00000014299.18.439e-734.29pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
I3RSU10.000e+099.71SMED-SMAD6/7-1 OS=Schmidtea mediterranea OX=79327 ... [more]
A0A443RNH52.693e-725.33Mothers against decapentaplegic homolog OS=Dinothr... [more]
A0A443SWF28.187e-722.69Mothers against decapentaplegic homolog OS=Leptotr... [more]
A0A0R3W6J84.283e-634.33MH2 domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smad6b5.088e-835.00SMAD family member 6 [Source:NCBI gene;Acc:1030296... [more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smad73.832e-824.50SMAD family member 7 [Source:NCBI gene;Acc:1011653... [more]
smad71.422e-633.66SMAD family member 7 [Source:NCBI gene;Acc:1011653... [more]
back to top
BLAST of SMED-SMAD6/7-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002697.10.000e+0100.00SMESG000002697.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007744
GenBankAFK29379.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007744 ID=SMED30007744|Name=SMED-SMAD6/7-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1322bp
AAAAAATGGTTAATTGTGTTAATGAAATTTATTCCATTAGCACAGTATTT
GAAGGAAATCAAAATTCATATTCACATTACACAATAGATTGTTGATAATA
ACATTCATGCACCAATGGAATGGGCTCATTATAAAACAAAATGAAATAAG
TTGCTCTCATTGGTCAATTTGATTTTCTGAAAAATGTGCAGCATAAATAA
TCGAAAACGTCTATGAAACACATGTAACATGAAATCGAATTCCATTTTAA
ACATTTCTCAAGATCAAATCAATCAAGAGACATGTTTAGGATCATGGACA
AATTTCGTCTACAAGAGGAAACTTATCAAAAATATTATTTATCTGATGAA
AACCAATAACAAAAGCCGCTTTCTTACAGTTCAAGATTGTTGTAAAAATA
TTTTAGAAATTCTCTCGAAAATTTTAGCGAAACTTAATATTCAACAGTTA
AAAATCTTTTTGGAAATTGCTCAATCAATTCATCAGTTCCAGTCATTTTC
ACCGATCATTCCTTGTATTAAAGGCTGTAGCAATTTGTTCAGATATTTCG
ACATAGATTATATTAAAAACATTCTTTGGATAACTTTTAGATCTTCTTTA
TTATCAGGATCGAATGAGATCAAATTTATGAGTATTTGCTCAAACCGTCA
GGACTGCATAAATCCATTCCATTGGTCTTTGATGAAAACTGTCGAGTCTA
TGAATGTTGATCAAAATATCCTCTATGACTCGTATTTCTTTAGCAGCATC
CAGTGCAATTTGAGGATAGAAGAAACTATAAGACCGACAAAAATTATCAC
ACCAGCGATTTCCAGTTTGTCGTCAGTCTTTATTATATACTACCAGTCAT
GCCCATCTGTCACGACAGATTGTAAACCTGACTCACTGTGGCAGGAACTT
GGAATATGCATTCATCAGTTAAACAATCGCTTTGTTTCACTTTATAATTA
TACAACTCAGCCAATTTTTATCAGTTCAATCTGTAAAGAGATACAAGACC
ATAACTTCAATAAGCATGACCCTTACATTCCTGTTTATAAAATCCTTCCA
AATCATTCAGTGAATGTTTTCTCTTTGGATCAAATTGACACCATAAAGTT
ATCACAGACATCTATTCCGATTCTCAATTCTGGCATTTTTACAGTACAAA
TAAGTTTCGGCAAAGGCTGGGGCCGAGGGTATTCTCGGTCCAGCTTTCTC
TATTGTCCTTGTCGATGCGAAATTTCAATAATATTGCCTGACAGCTTTTG
AATGTTTCAGAATTGATAAATCATATCAGTGTTTTATTTTTGTTAAGATA
AATAAATTTTTGAAATTGTTTT
back to top

protein sequence of SMED30007744-orf-1

>SMED30007744-orf-1 ID=SMED30007744-orf-1|Name=SMED30007744-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MKSNSILNISQDQINQETCLGSWTNFVYKRKLIKNIIYLMKTNNKSRFLT
VQDCCKNILEILSKILAKLNIQQLKIFLEIAQSIHQFQSFSPIIPCIKGC
SNLFRYFDIDYIKNILWITFRSSLLSGSNEIKFMSICSNRQDCINPFHWS
LMKTVESMNVDQNILYDSYFFSSIQCNLRIEETIRPTKIITPAISSLSSV
FIIYYQSCPSVTTDCKPDSLWQELGICIHQLNNRFVSLYNYTTQPIFISS
ICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTSIPILN
SGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIILPDSF*
back to top
Aliases
The feature 'SMED-SMAD6/7-1' has the following synonyms
Synonym
smad6/7-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000009sigma neoblast
PLANA:0000016pharynx
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR013790Dwarfin
IPR001132SMAD_dom_Dwarfin-type
IPR017855SMAD-like_dom_sf
IPR008984SMAD_FHA_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001132SMAD domain, Dwarfin-typePFAMPF03166MH2coord: 225..334
e-value: 3.2E-14
score: 53.6
IPR001132SMAD domain, Dwarfin-typePROSITEPS51076MH2coord: 149..340
score: 12.374
IPR017855SMAD-like domain superfamilyGENE3DG3DSA:2.60.200.10coord: 222..338
e-value: 1.7E-15
score: 59.0
NoneNo IPR availablePANTHERPTHR13703:SF54MOTHERS AGAINST DECAPENTAPLEGIC HOMOLOGcoord: 234..333
IPR013790DwarfinPANTHERPTHR13703SMADcoord: 234..333
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 205..337