Protein transport protein Sec61 subunit alpha

Overview
NameProtein transport protein Sec61 subunit alpha
Smed IDSMED30007742
Length (bp)1668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein transport protein Sec61 subunit alpha (SMED30007742) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit alpha (SMED30007742) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein transport protein Sec61 subunit alpha (SMED30007742) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit alpha (SMED30007742) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007742

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007742SMESG000003007.1 dd_Smed_v4_282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007742SMESG000003007.1 Contig39851uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007742SMESG000003007.1 Contig39851newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30007742SMESG000003007.1 dd_Smed_v6_282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007742SMESG000003007.1 dd_Smed_v6_282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30007742SMESG000003007.1 dd_Smed_v6_282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30007742SMESG000003007.1 dd_Smed_v6_282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Match: SEC61A2 (SEC61 translocon alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:17702])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 408/477 (85.53%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Match: SEC61A1 (SEC61 translocon alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:18276])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 401/477 (84.07%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQ+++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRG EFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GNL+++LLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Match: SEC61A1 (SEC61 translocon alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:18276])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 400/474 (84.39%), Postives = 444/474 (93.67%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQ+++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRG EFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GNL+++LLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:   10 KFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 482          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Match: SEC61A2 (SEC61 translocon alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:17702])

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 387/477 (81.13%), Postives = 423/477 (88.68%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKI                      PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKI----------------------PLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 454          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Match: SEC61A2 (SEC61 translocon alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:17702])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 352/415 (84.82%), Postives = 388/415 (93.49%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNR 1308
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNR
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNR 415          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Match: sec-61 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3MU88])

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 407/475 (85.68%), Postives = 441/475 (92.84%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+ VKPFC  +PE+SKPERKIQFREK+LWTAITLF+FLVCCQ+PLFGIMS++SADPFYW+RVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVITVGQA++YVMSG+YG P E+GAG+CLLIV QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP T+NTGRGTEFEGA+I+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT LVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF GN  INLLGTWSD   G RS P GG+CYY+SPP+SL  +F DP+H  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV ADF+GAIGSGTGILLAVTIIYQYFEIFVKEQ EMGG +S + F
Sbjct:    1 MGIKFLEFVKPFCGFVPEVSKPERKIQFREKMLWTAITLFVFLVCCQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLATRSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSD-NTGYRSYPTGGLCYYLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIFVKEQQEMGG-VSAMFF 473          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Match: sec-61 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3MU88])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 383/444 (86.26%), Postives = 414/444 (93.24%), Query Frame = 1
Query:  163 VLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            +LWTAITLF+FLVCCQ+PLFGIMS++SADPFYW+RVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVITVGQA++YVMSG+YG P E+GAG+CLLIV QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP T+NTGRGTEFEGA+I+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT LVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF GN  INLLGTWSD   G RS P GG+CYY+SPP+SL  +F DP+H  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV ADF+GAIGSGTGILLAVTIIYQYFEIFVKEQ EMGG +S + F
Sbjct:    1 MLWTAITLFVFLVCCQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLATRSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSD-NTGYRSYPTGGLCYYLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIFVKEQQEMGG-VSAMFF 442          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Match: sec-61 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3MU88])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 383/444 (86.26%), Postives = 414/444 (93.24%), Query Frame = 1
Query:  163 VLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            +LWTAITLF+FLVCCQ+PLFGIMS++SADPFYW+RVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVITVGQA++YVMSG+YG P E+GAG+CLLIV QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP T+NTGRGTEFEGA+I+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT LVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF GN  INLLGTWSD   G RS P GG+CYY+SPP+SL  +F DP+H  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV ADF+GAIGSGTGILLAVTIIYQYFEIFVKEQ EMGG +S + F
Sbjct:    1 MLWTAITLFVFLVCCQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLATRSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSD-NTGYRSYPTGGLCYYLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIFVKEQQEMGG-VSAMFF 442          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Match: sec-61 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3MU88])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 383/444 (86.26%), Postives = 414/444 (93.24%), Query Frame = 1
Query:  163 VLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            +LWTAITLF+FLVCCQ+PLFGIMS++SADPFYW+RVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVITVGQA++YVMSG+YG P E+GAG+CLLIV QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP T+NTGRGTEFEGA+I+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT LVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF GN  INLLGTWSD   G RS P GG+CYY+SPP+SL  +F DP+H  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV ADF+GAIGSGTGILLAVTIIYQYFEIFVKEQ EMGG +S + F
Sbjct:    1 MLWTAITLFVFLVCCQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLATRSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSD-NTGYRSYPTGGLCYYLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIFVKEQQEMGG-VSAMFF 442          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Match: sec-61 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3MU88])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 383/444 (86.26%), Postives = 414/444 (93.24%), Query Frame = 1
Query:  163 VLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            +LWTAITLF+FLVCCQ+PLFGIMS++SADPFYW+RVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVITVGQA++YVMSG+YG P E+GAG+CLLIV QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP T+NTGRGTEFEGA+I+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT LVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF GN  INLLGTWSD   G RS P GG+CYY+SPP+SL  +F DP+H  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV ADF+GAIGSGTGILLAVTIIYQYFEIFVKEQ EMGG +S + F
Sbjct:    1 MLWTAITLFVFLVCCQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLATRSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSD-NTGYRSYPTGGLCYYLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIFVKEQQEMGG-VSAMFF 442          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Fly
Match: Sec61alpha (gene:FBgn0086357 transcript:FBtr0345753)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 411/477 (86.16%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSD--GEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI+KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYW+RVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVIT+GQA++YVM+GMYG P E+GAGVCLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+ TGRGTEFEGA+I+LFHLMATR DKVRALREAFYR NLPNLMNLLATVLVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF+GN  INLLG W+D  G   +RS PIGG+CYY+SPP+S+  +  DP+H  +YI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQ MVMRGHRE SMIHELNRYIPTAAAFGGLCIGALSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EMGG M TLLF
Sbjct:    1 MGIKFLEVIKPFCSILPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWIRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITIGQAIVYVMTGMYGDPSEIGAGVCLLIIIQLFAAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVTTGRGTEFEGAVIALFHLMATRNDKVRALREAFYRQNLPNLMNLLATVLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFQGNFFINLLGVWADVGGGGPARSYPIGGLCYYLSPPESVGHILTDPIHALLYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQHMVMRGHRENSMIHELNRYIPTAAAFGGLCIGALSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEMGG-MGTLLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Fly
Match: Sec61alpha (gene:FBgn0086357 transcript:FBtr0079266)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 411/477 (86.16%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSD--GEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI+KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYW+RVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGMVIT+GQA++YVM+GMYG P E+GAGVCLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+ TGRGTEFEGA+I+LFHLMATR DKVRALREAFYR NLPNLMNLLATVLVFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQML+ KF+GN  INLLG W+D  G   +RS PIGG+CYY+SPP+S+  +  DP+H  +YI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQ MVMRGHRE SMIHELNRYIPTAAAFGGLCIGALSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EMGG M TLLF
Sbjct:    1 MGIKFLEVIKPFCSILPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWIRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMVITIGQAIVYVMTGMYGDPSEIGAGVCLLIIIQLFAAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVTTGRGTEFEGAVIALFHLMATRNDKVRALREAFYRQNLPNLMNLLATVLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFQGNFFINLLGVWADVGGGGPARSYPIGGLCYYLSPPESVGHILTDPIHALLYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQHMVMRGHRENSMIHELNRYIPTAAAFGGLCIGALSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEMGG-MGTLLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Zebrafish
Match: sec61a1 (SEC61 translocon alpha 1 subunit [Source:NCBI gene;Acc:192298])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/477 (84.91%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Zebrafish
Match: sec61a1l (SEC61 translocon alpha 1 subunit, like [Source:NCBI gene;Acc:266796])

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 399/477 (83.65%), Postives = 443/477 (92.87%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC VLPEI KPER+IQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVI+ASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD   G  +R+ P+GG+CYY+SPP+S   +  DP+H  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GS+  LLF
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERRIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSTGGPARAYPVGGLCYYLSPPESFGTVLEDPIHAIIYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSVGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Xenopus
Match: sec61a1 (Sec61 translocon alpha 1 subunit [Source:NCBI gene;Acc:448033])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 405/477 (84.91%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GNL++NLLGTWSD   G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVNLLGTWSDATTGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Xenopus
Match: sec61a1 (Sec61 translocon alpha 1 subunit [Source:NCBI gene;Acc:448033])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 394/477 (82.60%), Postives = 436/477 (91.40%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQ  +        RYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GNL++NLLGTWSD   G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQVLK-----DRTRYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVNLLGTWSDATTGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 471          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Xenopus
Match: sec61a1 (Sec61 translocon alpha 1 subunit [Source:NCBI gene;Acc:448033])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 391/483 (80.95%), Postives = 431/483 (89.23%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFR------VDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQ  +      VDLPIKS             LFYTSNIPIILQSALVSNLYVISQMLS +F GNL++NLLGTWSD   G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQVLKDRSRGIVDLPIKS-------------LFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVNLLGTWSDATTGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 469          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Xenopus
Match: sec61a1 (Sec61 translocon alpha 1 subunit [Source:NCBI gene;Acc:448033])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 332/475 (69.89%), Postives = 375/475 (78.95%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREA                                                  FY  N+P ++   L++ ++V +          ++I      + G A  R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREA--------------------------------------------------FYRQNLPNLMN--LIATIFVFA----------VVIYFQDATTGGPA--RAYPVGGLCYYLSPPESFGSVLDDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 410          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Match: Sec61a2 (Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931071])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 408/477 (85.53%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Match: Sec61a1 (Sec61 alpha 1 subunit (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1858417])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 401/477 (84.07%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC +LPEI KPERKIQF+EKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQ+++YVM+GMYG P E+GAG+CLLI  QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRG EFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GNL+++LLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Match: Sec61a2 (Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931071])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 335/475 (70.53%), Postives = 375/475 (78.95%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREA                                                  FY  N+P ++   L++ ++V +          ++I        G A  RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREA--------------------------------------------------FYRQNLPNLMN--LIATVFVFA----------VVIYFQDVSGGGPA--RSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 410          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Match: Sec61a2 (Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931071])

HSP 1 Score: 286.574 bits (732), Expect = 2.089e-94
Identity = 137/163 (84.05%), Postives = 151/163 (92.64%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVL 558
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ Q    GLL L
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQ----GLLTL 159          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Match: Sec61a2 (Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931071])

HSP 1 Score: 160.229 bits (404), Expect = 1.170e-46
Identity = 84/115 (73.04%), Postives = 93/115 (80.87%), Query Frame = 1
Query: 1150 IYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            +Y+   + S  F     +++ G  A  VAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    9 LYVISQMLSVRFSGNFLVNLLGQWA--VAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 120          

HSP 2 Score: 53.9138 bits (128), Expect = 1.976e-8
Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 1
Query:  949 QSALVSNLYVISQMLSNKFRGNLIINLLGTWS 1044
            QSALVSNLYVISQMLS +F GN ++NLLG W+
Sbjct:    2 QSALVSNLYVISQMLSVRFSGNFLVNLLGQWA 33          
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Match: sp|Q9JLR1|S61A2_MOUSE (Protein transport protein Sec61 subunit alpha isoform 2 OS=Mus musculus OX=10090 GN=Sec61a2 PE=2 SV=3)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 408/477 (85.53%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Match: sp|Q9H9S3|S61A2_HUMAN (Protein transport protein Sec61 subunit alpha isoform 2 OS=Homo sapiens OX=9606 GN=SEC61A2 PE=2 SV=3)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 408/477 (85.53%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Match: sp|Q2KHX4|S61A2_BOVIN (Protein transport protein Sec61 subunit alpha isoform 2 OS=Bos taurus OX=9913 GN=SEC61A2 PE=2 SV=3)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 408/477 (85.53%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGA+I+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLG W+D   G  +RS P+GG+CYY+SPP+S+ A+F DPVH  +YI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ E+GG M  L F
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGG-MGALFF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Match: sp|Q8AY32|SC61A_GADOC (Protein transport protein Sec61 subunit alpha OS=Gadus ogac OX=8052 GN=sec61a PE=2 SV=3)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 406/477 (85.12%), Postives = 444/477 (93.08%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CL+I+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD   G  +R+ P+GG+CYY SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EM GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLVIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSTGGPARAYPVGGLCYYFSPPESFGSVLDDPVHASIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEM-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Match: sp|Q90ZM2|S61A1_DANRE (Protein transport protein Sec61 subunit alpha-like 1 OS=Danio rerio OX=7955 GN=sec61al1 PE=2 SV=3)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/477 (84.91%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Match: A0A267FEJ4 (Plug_translocon domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026617g1 PE=3 SV=1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 411/477 (86.16%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+ VKPFC VLPEI+KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYW+RVI+ASNRG+LMELGI+PIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQ+++YVM+GMYG   ELGAG+ LLI+FQLTFAGL+VLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSP TINTGRGTEFEGAII+LFHL+ATR DK+RALREAFYR NLPNLMNL +TVLVFA+VIYFQGFRVDLPIKS+RYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKF GN IINLLG W++ E G  +RS P GG+CYYMSPP+SL  +  DP+H  +YI FMLGSCAFFSKTWIDVSGSSAKDVAKQLK+QQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E  GSMS+LLF
Sbjct:    1 MGIKFLEFVKPFCAVLPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWLRVIMASNRGTLMELGITPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITLGQSIVYVMTGMYGDVSELGAGIALLIIFQLTFAGLIVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATINTGRGTEFEGAIIALFHLLATRQDKIRALREAFYRQNLPNLMNLGSTVLVFAVVIYFQGFRVDLPIKSSRYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFAGNFIINLLGVWANSEDGGPARSYPTGGLCYYMSPPESLGHVLIDPIHAVLYITFMLGSCAFFSKTWIDVSGSSAKDVAKQLKDQQMVMRGHREHSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSE-AGSMSSLLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Match: A0A267E607 (Plug_translocon domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026617g2 PE=3 SV=1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 411/477 (86.16%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+ VKPFC VLPEI+KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYW+RVI+ASNRG+LMELGI+PIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQ+++YVM+GMYG   ELGAG+ LLI+FQLTFAGL+VLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSP TINTGRGTEFEGAII+LFHL+ATR DK+RALREAFYR NLPNLMNL +TVLVFA+VIYFQGFRVDLPIKS+RYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKF GN IINLLG W++ E G  +RS P GG+CYYMSPP+SL  +  DP+H  +YI FMLGSCAFFSKTWIDVSGSSAKDVAKQLK+QQMVMRGHRE SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E  GSMS+LLF
Sbjct:    1 MGIKFLEFVKPFCAVLPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWLRVIMASNRGTLMELGITPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITLGQSIVYVMTGMYGDVSELGAGIALLIIFQLTFAGLIVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATINTGRGTEFEGAIIALFHLLATRQDKIRALREAFYRQNLPNLMNLGSTVLVFAVVIYFQGFRVDLPIKSSRYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFAGNFIINLLGVWANSEDGGPARSYPTGGLCYYMSPPESLGHVLVDPIHAVLYITFMLGSCAFFSKTWIDVSGSSAKDVAKQLKDQQMVMRGHREHSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSE-AGSMSSLLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Match: A0A3B5KAN2 (Plug_translocon domain-containing protein OS=Takifugu rubripes OX=31033 GN=sec61a1 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 404/477 (84.70%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AG++VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATR+DKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQ ++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH FIYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGMIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRSDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQQNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAFIYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Match: A0A4Z2BAS4 (Plug_translocon domain-containing protein OS=Takifugu bimaculatus OX=433685 GN=fugu_005203 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 404/477 (84.70%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AG++VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATR+DKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQ ++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH FIYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGMIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRSDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQQNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAFIYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Match: A0A4V6AN81 (Protein transport protein OS=Collichthys lucidus OX=240159 GN=D9C73_004886 PE=3 SV=1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 403/474 (85.02%), Postives = 443/474 (93.46%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AG++VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD   G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:   13 KFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGMIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSTGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAIIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 485          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Match: sec61a1 (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:103023094])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/477 (84.91%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Match: sec61a1l (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:103036990])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 402/477 (84.28%), Postives = 445/477 (93.29%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            M  KFL+++KPFC VLPEI KPER+IQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDK+RALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERRIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKIRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Match: sec61a1 (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:103023094])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 350/419 (83.53%), Postives = 389/419 (92.84%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPT 1320
            M  KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNR + +
Sbjct:    1 MAIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRSVSS 419          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Match: sec61a1 (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:103023094])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 326/387 (84.24%), Postives = 362/387 (93.54%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDV 1233
            KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDKVRALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDV
Sbjct:    3 KFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDV 389          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Match: sec61a1l (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:103036990])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 319/457 (69.80%), Postives = 360/457 (78.77%), Query Frame = 1
Query:  124 ISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            I KPER+IQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDK+RALREA                                                  FY  N+P ++   L++ ++V +          ++I    T S G A  R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHR+ SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 IQKPERRIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKIRALREA--------------------------------------------------FYRQNLPNLMN--LIATVFVFA----------VVIYFQDTSSGGPA--RAYPVGGLCYYLSPPESFGSVLDDPVHAVIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 392          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001374.1 (pep scaffold:Pmarinus_7.0:GL479278:2263:18934:-1 gene:ENSPMAG00000001227.1 transcript:ENSPMAT00000001374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 404/474 (85.23%), Postives = 441/474 (93.04%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSD--GEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            KFL+++KPFC VLPE+ KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGA I+LFHL+ATR DKVRALREAFYR NLPNL NL+ATV VFAIVIYFQGFRVDLPIKSARYRGQ S+YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTW+D  G   +RS P+GG+CYY+SPP+SL ++  DPVH  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHRE+SM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EM GSM  + F
Sbjct:    1 KFLEVIKPFCAVLPEVQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGEPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAFIALFHLLATRQDKVRALREAFYRQNLPNLHNLIATVFVFAIVIYFQGFRVDLPIKSARYRGQQSTYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGTWADVGGGGPARSYPVGGLCYYLSPPESLGSVLDDPVHTVIYIIFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREQSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEM-GSMGAMFF 473          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Yeast
Match: SEC61 (Conserved ER protein translocation channel; essential subunit of Sec61 complex (Sec61p, Sbh1p, and Sss1p); forms channel for SRP-dependent protein import; with Sec63 complex allows SRP-independent protein import into ER; involved in posttranslational soluble protein import into the ER, ERAD of soluble substrates, and misfolded soluble protein export from the ER [Source:SGD;Acc:S000004370])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 257/462 (55.63%), Postives = 346/462 (74.89%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEV-GDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTW--SDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKE 1455
            + LDL KPF   LPE+  PERK+ + +K++WT ++L IFL+  Q+PL+GI+SSE++DP YW+R +LASNRG+L+ELG+SPI+TS +I Q L G +++++  ++ +DR LF  AQK+  +++ +GQA++ VM+G YG P +LG  +CLL++FQL FA L+V++LDELL KGYGLGSGISLF ATNI E I W+AF+PTT+N+GRG EFEGA+I+ FHL+A R DK RAL EAFYRTNLPN+  +L TV +F  V+Y QGFR +LPI+S + RGQ   YPIKLFYTSN PI+LQSAL SN+++ISQ+L  K+  N +I L+G W    G  G + + + G+ YY+ P  SL+    DP+   +YI F+LGSCA FSKTWI++SG+S +D+AKQ K+Q MV+ G RE S+  EL + IPTAAAFGG  IGALSV +D LG +GSG  IL+A T IY Y+E   KE
Sbjct:    5 RVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLLIFLILGQIPLYGIVSSETSDPLYWLRAMLASNRGTLLELGVSPIITSSMIFQFLQGTQLLQIRPESKQDRELFQIAQKVCAIILILGQALVVVMTGNYGAPSDLGLPICLLLIFQLMFASLIVMLLDELLSKGYGLGSGISLFTATNIAEQIFWRAFAPTTVNSGRGKEFEGAVIAFFHLLAVRKDKKRALVEAFYRTNLPNMFQVLMTVAIFLFVLYLQGFRYELPIRSTKVRGQIGIYPIKLFYTSNTPIMLQSALTSNIFLISQILFQKYPTNPLIRLIGVWGIRPGTQGPQ-MALSGLAYYIQPLMSLSEALLDPIKTIVYITFVLGSCAVFSKTWIEISGTSPRDIAKQFKDQGMVINGKRETSIYRELKKIIPTAAAFGGATIGALSVGSDLLGTLGSGASILMATTTIYGYYEAAAKE 465          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Yeast
Match: SSH1 (Subunit of the Ssh1 translocon complex; Sec61p homolog involved in co-translational pathway of protein translocation; not essential [Source:SGD;Acc:S000000487])

HSP 1 Score: 233.417 bits (594), Expect = 1.024e-70
Identity = 148/479 (30.90%), Postives = 249/479 (51.98%), Query Frame = 1
Query:   73 GFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESA---DPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVG-DTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRG--TEFEGAIISLFH-LMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVIS----QMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGS 1476
            GF+ +D+VKP   +LPE+  P  K+ F +K+++T     I+L   Q PL G+  + +    DP Y++R +      +L+E G+ P ++SGLI+QLLAG+K+I+V      DR LF    K+F +V  V    +++ +G +G   +L      LI FQL  AG+   +L E++ KG+G  SG  +     I   +V   F  + I  G    TE +GA+I+L   L +     +  +  AF R  LPNL   +  + +  IV Y Q  RV+LPI+S R RG  + YPIKL YT  + ++    ++  +++ +    Q+++     ++I  ++G + +      +VP   +     P      +   P+    Y AF+L +  +F+  W  +SGSSA+DVA + K+Q + + G RE+++  ELN+ IP AA  G   +  ++V+ + LG  G   GI++ +   +   E+   E  + GG 
Sbjct:    3 GFRLIDIVKPILPILPEVELPFEKLPFDDKIVYTIFAGLIYLFA-QFPLVGLPKATTPNVNDPIYFLRGVFGCEPRTLLEFGLFPNISSGLILQLLAGLKVIKVNFKIQSDRELFQSLTKVFAIVQYVILTNIFIFAGYFGD--DLSVVQIGLINFQLVGAGIFTTLLAEVIDKGFGFSSGAMIINTVVIATNLVADTFGVSQIKVGEDDQTEAQGALINLIQGLRSKHKTFIGGIISAFNRDYLPNLTTTIIVLAIAIIVCYLQSVRVELPIRSTRARGTNNVYPIKLLYTGCLSVLFSYTILFYIHIFAFVLIQLVAKNEPTHIICKIMGHYENAN-NLLAVPTFPLSLLAPPTSFFKGVTQQPLTFITYSAFILVTGIWFADKWQAISGSSARDVALEFKDQGITLMGRREQNVAKELNKVIPIAAVTGASVLSLITVIGESLGLKGKAAGIVVGIAGGFSLLEVITIEYQQSGGQ 477          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Nematostella
Match: EDO36010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW4])

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 400/476 (84.03%), Postives = 441/476 (92.65%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG-SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL++++PF  VLPE++KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFG++IT+GQA++YVM+GMYG P +LG G+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSP TINTGRGTEFEGA+I+LFHL+ATRTDKVR LREAFYR NLPNL NL+AT+ VF IVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN+YVISQM+S KF GN  +NLLGTW +   G +RS P+GG+CYYMSPP++++ +  DPVH  IYI FMLGSCAFFSKTWIDVSGSSAKDVAKQLK+QQMVMRGHR+KSM+HELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EMGG M  LLF
Sbjct:    1 MGIKFLEVLRPFISVLPEVAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGSKIIEVGDTPKDRALFNGAQKLFGIIITIGQAVVYVMTGMYGDPSDLGPGICLLIIIQLFCAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATINTGRGTEFEGAVIALFHLLATRTDKVRGLREAFYRQNLPNLTNLIATIFVFGIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNIYVISQMMSAKFAGNFFVNLLGTWEEAGGGPARSYPVGGLCYYMSPPETVSHIIEDPVHACIYIFFMLGSCAFFSKTWIDVSGSSAKDVAKQLKDQQMVMRGHRDKSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEMGG-MGALLF 475          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Medaka
Match: sec61a1l (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:101169601])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/477 (84.91%), Postives = 446/477 (93.50%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDK+RALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+ GSM  LLF
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKIRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAAIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEV-GSMGALLF 476          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Medaka
Match: sec61a1l (protein transport protein Sec61 subunit alpha-like 1 [Source:NCBI gene;Acc:101169601])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 400/469 (85.29%), Postives = 441/469 (94.03%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMG 1470
            MG KFL+++KPFC VLPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG KIIEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATRTDK+RALREAFYR NLPNLMNL+ATV VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ P+GG+CYY+SPP+S  ++  DPVH  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SM+HELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+E+G
Sbjct:    1 MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRTDKIRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLDDPVHAAIYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVG 469          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000046587.1 (SEC61 translocon alpha 1 subunit [Source:NCBI gene;Acc:101175640])

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 399/469 (85.07%), Postives = 440/469 (93.82%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMG 1470
            MG KFL+++KPFC +LPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG K+IEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATR+DKVRALREAFYR NLPNLMNL+AT+ VFA+VIYFQGFRVDLPIKSARYRGQY++YPIKLFYTSNIPIILQSALVSNLYVISQMLS +F GN ++NLLGTWSD  +G  +R+ PIGG+CYY SPP+S  ++  DP+H  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SMIHELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EMG
Sbjct:    1 MGIKFLEVIKPFCAILPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKLIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRSDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSTRFSGNFLVNLLGTWSDSTSGGPARAYPIGGLCYYFSPPESFGSVLEDPIHAVIYIFFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMIHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEMG 469          
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000001548.2 (SEC61 translocon alpha 1 subunit [Source:NCBI gene;Acc:101175640])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 326/464 (70.26%), Postives = 368/464 (79.31%), Query Frame = 1
Query:   79 KFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMG 1470
            KFL+++KPFC +LPEI KPERKIQFREKVLWTAITLFIFLVCCQ+PLFGIMSS+SADPFYWMRVILASNRG+LMELGISPIVTSGLIMQLLAG K+IEVGDTPKDRALFNGAQKLFGM+IT+GQA++YVM+GMYG P E+GAG+CLLI+ QL  AGL+VL+LDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT+NTGRGTEFEGAII+LFHL+ATR+DKVRALREA                                                  FY  N+P ++   L++ ++V +          ++I    + S G A  R+ PIGG+CYY SPP+S  ++  DP+H  IYI FMLGSCAFFSKTWI+VSGSSAKDVAKQLKEQQMVMRGHRE SMIHELNRYIPTAAAFGGLCIG LSV+ADFLGAIGSGTGILLAVTIIYQYFEIFVKEQ+EMG
Sbjct:    4 KFLEVIKPFCAILPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKLIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPSEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGTEFEGAIIALFHLLATRSDKVRALREA--------------------------------------------------FYRQNLPNLMN--LIATIFVFA----------VVIYFQDSTSGGPA--RAYPIGGLCYYFSPPESFGSVLEDPIHAVIYIFFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMIHELNRYIPTAAAFGGLCIGGLSVMADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEMG 403          
BLAST of Protein transport protein Sec61 subunit alpha vs. Planmine SMEST
Match: SMESG000003007.1 (SMESG000003007.1)

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 475/475 (100.00%), Postives = 475/475 (100.00%), Query Frame = 1
Query:   70 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 1494
            MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF
Sbjct:    1 MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPLFGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKIIEVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLLIVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQNEMGGSMSTLLF 475          
BLAST of Protein transport protein Sec61 subunit alpha vs. Planmine SMEST
Match: SMESG000027245.1 (SMESG000027245.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.166e-7
Identity = 62/287 (21.60%), Postives = 113/287 (39.37%), Query Frame = 1
Query:  550 LVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVLVFAIVIYFQGFRVDLPIK--SARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSNKFRGNLIINLLGTWSDGEAG--SRSVP--IGGICY----YMSPPDSLTAMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLG 1380
            L++ +D+ +++      GI+++ +  +C   +W   SP  I    G  FEG  ++  HL  T+ D + A+R    R   P+ +      +    +I+    ++       S     ++  +  +L  T +IP  L +A+          LS      L   ++ + S  E     R VP  I  +CY     +  P      F D  +   +    + SC      WI     S   V ++  E+  + R    KS   E+ R +  ++   G  IG L+V+ DF+ 
Sbjct:    3 LLIFIDKFIEESNIEYGGIAIYNSIQVCSDFIWFLMSPVIIKDCNGRMFEGLFLAFIHLSFTQ-DPIYAIRNLISRNGHPDFIKFFVIFVSILWIIFILNVKIVFQFSDYSDCDEKRFHVHSYRLITTGSIPFRLFNAI---------YLSRSAVPFLRDRIIHSSSSVETCVVPRYVPSNIDEMCYGYSLIIQTPMPKPLEFQD--YSISFFVLKIISCIILHLNWIFYISHSPGFVHEE--EKLEISRCIAVKSR-EEIVRLLKCSSVINGTIIGVLAVVGDFIN 274          
The following BLAST results are available for this feature:
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC61A20.000e+085.53SEC61 translocon alpha 2 subunit [Source:HGNC Symb... [more]
SEC61A10.000e+084.07SEC61 translocon alpha 1 subunit [Source:HGNC Symb... [more]
SEC61A10.000e+084.39SEC61 translocon alpha 1 subunit [Source:HGNC Symb... [more]
SEC61A20.000e+081.13SEC61 translocon alpha 2 subunit [Source:HGNC Symb... [more]
SEC61A20.000e+084.82SEC61 translocon alpha 2 subunit [Source:HGNC Symb... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec-610.000e+085.68Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3... [more]
sec-610.000e+086.26Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3... [more]
sec-610.000e+086.26Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3... [more]
sec-610.000e+086.26Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3... [more]
sec-610.000e+086.26Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:G3... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sec61alpha0.000e+086.16gene:FBgn0086357 transcript:FBtr0345753[more]
Sec61alpha0.000e+086.16gene:FBgn0086357 transcript:FBtr0079266[more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec61a10.000e+084.91SEC61 translocon alpha 1 subunit [Source:NCBI gene... [more]
sec61a1l0.000e+083.65SEC61 translocon alpha 1 subunit, like [Source:NCB... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sec61a10.000e+084.91Sec61 translocon alpha 1 subunit [Source:NCBI gene... [more]
sec61a10.000e+082.60Sec61 translocon alpha 1 subunit [Source:NCBI gene... [more]
sec61a10.000e+080.95Sec61 translocon alpha 1 subunit [Source:NCBI gene... [more]
sec61a10.000e+069.89Sec61 translocon alpha 1 subunit [Source:NCBI gene... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec61a20.000e+085.53Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI... [more]
Sec61a10.000e+084.07Sec61 alpha 1 subunit (S. cerevisiae) [Source:MGI ... [more]
Sec61a20.000e+070.53Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI... [more]
Sec61a22.089e-9484.05Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI... [more]
Sec61a21.170e-4673.04Sec61, alpha subunit 2 (S. cerevisiae) [Source:MGI... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLR1|S61A2_MOUSE0.000e+085.53Protein transport protein Sec61 subunit alpha isof... [more]
sp|Q9H9S3|S61A2_HUMAN0.000e+085.53Protein transport protein Sec61 subunit alpha isof... [more]
sp|Q2KHX4|S61A2_BOVIN0.000e+085.53Protein transport protein Sec61 subunit alpha isof... [more]
sp|Q8AY32|SC61A_GADOC0.000e+085.12Protein transport protein Sec61 subunit alpha OS=G... [more]
sp|Q90ZM2|S61A1_DANRE0.000e+084.91Protein transport protein Sec61 subunit alpha-like... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FEJ40.000e+086.16Plug_translocon domain-containing protein OS=Macro... [more]
A0A267E6070.000e+086.16Plug_translocon domain-containing protein OS=Macro... [more]
A0A3B5KAN20.000e+084.70Plug_translocon domain-containing protein OS=Takif... [more]
A0A4Z2BAS40.000e+084.70Plug_translocon domain-containing protein OS=Takif... [more]
A0A4V6AN810.000e+085.02Protein transport protein OS=Collichthys lucidus O... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec61a10.000e+084.91protein transport protein Sec61 subunit alpha-like... [more]
sec61a1l0.000e+084.28protein transport protein Sec61 subunit alpha-like... [more]
sec61a10.000e+083.53protein transport protein Sec61 subunit alpha-like... [more]
sec61a10.000e+084.24protein transport protein Sec61 subunit alpha-like... [more]
sec61a1l0.000e+069.80protein transport protein Sec61 subunit alpha-like... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001374.10.000e+085.23pep scaffold:Pmarinus_7.0:GL479278:2263:18934:-1 g... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SEC610.000e+055.63Conserved ER protein translocation channel; essent... [more]
SSH11.024e-7030.90Subunit of the Ssh1 translocon complex; Sec61p hom... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360100.000e+084.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sec61a1l0.000e+084.91protein transport protein Sec61 subunit alpha-like... [more]
sec61a1l0.000e+085.29protein transport protein Sec61 subunit alpha-like... [more]
ENSORLT00000046587.10.000e+085.07SEC61 translocon alpha 1 subunit [Source:NCBI gene... [more]
ENSORLT00000001548.20.000e+070.26SEC61 translocon alpha 1 subunit [Source:NCBI gene... [more]
back to top
BLAST of Protein transport protein Sec61 subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000003007.10.000e+0100.00SMESG000003007.1[more]
SMESG000027245.12.166e-721.60SMESG000027245.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007742 ID=SMED30007742|Name=Protein transport protein Sec61 subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1668bp
TAAACATTTATATAATTTGTTTTATTACTTCAAATAAAAATTTTAGTTAA
TACGTAAAGATCGCCAACTATGGGGTTCAAGTTTCTCGATTTGGTGAAAC
CCTTTTGTCAAGTTTTACCAGAAATATCCAAACCAGAAAGAAAAATTCAA
TTTCGTGAAAAAGTGTTATGGACAGCAATTACTCTTTTCATATTTCTAGT
TTGCTGTCAAGTACCTTTATTTGGTATCATGTCATCAGAATCAGCAGATC
CATTTTATTGGATGAGAGTTATTCTTGCGTCTAACAGGGGTTCTCTTATG
GAATTGGGTATCAGTCCAATTGTAACATCTGGCCTTATAATGCAATTGTT
GGCTGGTATCAAAATTATTGAAGTAGGAGATACGCCAAAAGATCGTGCAT
TATTTAACGGAGCACAGAAATTATTTGGAATGGTTATTACTGTTGGTCAA
GCTATGTTATATGTTATGTCTGGAATGTATGGTACTCCTGGTGAACTCGG
TGCTGGAGTTTGTTTATTGATAGTTTTTCAACTTACATTTGCCGGATTAT
TGGTACTGATGTTGGACGAATTGTTACAAAAAGGATATGGTCTTGGCTCT
GGAATATCCTTGTTCATTGCAACGAATATTTGTGAAACTATTGTCTGGAA
AGCTTTTAGTCCCACAACAATTAATACTGGAAGAGGAACAGAATTTGAAG
GAGCAATTATTTCATTGTTTCATTTAATGGCCACCAGAACAGATAAAGTT
CGAGCACTCCGTGAAGCATTTTATCGAACAAATTTACCAAATCTTATGAA
TTTGTTGGCAACAGTTCTTGTTTTCGCGATCGTTATCTATTTTCAAGGAT
TCCGTGTAGATTTGCCGATTAAATCTGCTCGATATCGTGGCCAGTATAGT
TCATATCCAATTAAATTGTTCTATACCAGTAATATTCCTATTATTTTACA
AAGTGCATTGGTCTCGAACCTATACGTTATTTCGCAAATGTTGTCCAATA
AATTTAGAGGTAATCTAATTATCAATTTATTGGGTACTTGGTCAGATGGG
GAAGCCGGGTCAAGATCAGTACCCATAGGGGGTATTTGCTATTACATGTC
TCCCCCTGACAGTCTCACAGCAATGTTTCATGACCCCGTCCACGGATTTA
TCTACATTGCCTTCATGTTAGGAAGCTGTGCATTTTTCAGTAAGACTTGG
ATTGACGTGTCTGGCTCCAGTGCAAAGGATGTCGCGAAGCAGTTGAAAGA
ACAACAAATGGTGATGCGTGGTCACCGAGAAAAGTCAATGATCCACGAAT
TAAATCGATATATCCCAACTGCCGCAGCATTTGGAGGTTTGTGTATTGGC
GCACTGTCGGTATTGGCTGATTTCCTCGGCGCAATTGGTAGCGGCACTGG
AATATTGCTGGCTGTGACAATCATTTATCAGTATTTCGAAATATTCGTCA
AGGAACAGAATGAAATGGGTGGAAGCATGAGCACATTGTTGTTTTAATAT
GAATACATTTGTTTTCTTTGGTATAAATATTAATTGACCGGATTGTTCGT
TTGTATCTATGTTCGTGCAATTCATTATTTGTATTTTATGGCCATGTGCG
AGAGTATGTAGATAACATCGTTTTTGGTCGATCAAAATCTGATTAGTAAA
TACAGAATACTGGATTTT
back to top

protein sequence of SMED30007742-orf-1

>SMED30007742-orf-1 ID=SMED30007742-orf-1|Name=SMED30007742-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MGFKFLDLVKPFCQVLPEISKPERKIQFREKVLWTAITLFIFLVCCQVPL
FGIMSSESADPFYWMRVILASNRGSLMELGISPIVTSGLIMQLLAGIKII
EVGDTPKDRALFNGAQKLFGMVITVGQAMLYVMSGMYGTPGELGAGVCLL
IVFQLTFAGLLVLMLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTT
INTGRGTEFEGAIISLFHLMATRTDKVRALREAFYRTNLPNLMNLLATVL
VFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSNKFRGNLIINLLGTWSDGEAGSRSVPIGGICYYMSPPDSLT
AMFHDPVHGFIYIAFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMR
GHREKSMIHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVT
IIYQYFEIFVKEQNEMGGSMSTLLF*
back to top

protein sequence of SMED30007742-orf-2

>SMED30007742-orf-2 ID=SMED30007742-orf-2|Name=SMED30007742-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
KIQYSVFTNQILIDQKRCYLHTLAHGHKIQIMNCTNIDTNEQSGQLIFIP
KKTNVFILKQQCAHASTHFILFLDEYFEILINDCHSQQYSSAATNCAEEI
SQYRQCANTQTSKCCGSWDISI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016021integral component of membrane
GO:0030176integral component of endoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0045047protein targeting to ER
GO:0006810transport
GO:0007275multicellular organism development
GO:0039019pronephric nephron development
Vocabulary: INTERPRO
TermDefinition
IPR002208SecY/SEC61-alpha
IPR019561Translocon_Sec61/SecY_plug_dom
IPR023201SecY_dom_sf
IPR030659SecY_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019561Translocon Sec61/SecY, plug domainPFAMPF10559Plug_transloconcoord: 40..74
e-value: 9.8E-18
score: 63.7
IPR023201SecY domain superfamilyGENE3DG3DSA:1.10.3370.10coord: 28..474
e-value: 5.2E-182
score: 607.5
IPR023201SecY domain superfamilySUPERFAMILYSSF103491Preprotein translocase SecY subunitcoord: 7..462
IPR002208SecY/SEC61-alpha familyTIGRFAMTIGR00967TIGR00967coord: 29..463
e-value: 3.7E-118
score: 392.9
IPR002208SecY/SEC61-alpha familyPIRSFPIRSF004557SecY_Sec61alphacoord: 6..471
e-value: 5.4E-97
score: 322.8
IPR002208SecY/SEC61-alpha familyPFAMPF00344SecYcoord: 75..455
e-value: 6.2E-76
score: 255.6
IPR002208SecY/SEC61-alpha familyPANTHERPTHR10906SECY/SEC61-ALPHA FAMILY MEMBERcoord: 1..471
NoneNo IPR availablePANTHERPTHR10906:SF10PROTEIN TRANSPORT PROTEIN SEC61 SUBUNIT ALPHA ISOFORM 2coord: 1..471
NoneNo IPR availableTMHMMTMhelixcoord: 411..433
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 438..460
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 117..139
IPR030659SecY conserved sitePROSITEPS00756SECY_2coord: 164..182
IPR030659SecY conserved sitePROSITEPS00755SECY_1coord: 75..94