U2 snRNP auxiliary factor large subunit

Overview
NameU2 snRNP auxiliary factor large subunit
Smed IDSMED30007734
Length (bp)1487
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U2 snRNP auxiliary factor large subunit (SMED30007734) t-SNE clustered cells

Violin plots show distribution of expression levels for U2 snRNP auxiliary factor large subunit (SMED30007734) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U2 snRNP auxiliary factor large subunit (SMED30007734) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U2 snRNP auxiliary factor large subunit (SMED30007734) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007734

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007734SMESG000018652.1 SMESG000018647.1 SmedASXL_012519SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007734SMESG000018652.1 SMESG000018647.1 SmedASXL_012519SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v4_3025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007734SMESG000018652.1 SMESG000018647.1 Contig49310newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007734SMESG000018652.1 SMESG000018647.1 Contig49310uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30007734SMESG000018652.1 SMESG000018647.1 dd_Smed_v6_3025_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 390.578 bits (1002), Expect = 2.576e-131
Identity = 204/387 (52.71%), Postives = 274/387 (70.80%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 389.808 bits (1000), Expect = 6.396e-131
Identity = 204/391 (52.17%), Postives = 274/391 (70.08%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA------SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA      S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 318.546 bits (815), Expect = 1.587e-105
Identity = 173/308 (56.17%), Postives = 223/308 (72.40%), Query Frame = 2
Query:  539 MMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:    1 MMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 307          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 73.559 bits (179), Expect = 1.278e-15
Identity = 30/77 (38.96%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTE 532
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TE
Sbjct:   10 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITE 86          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: PUF60 (poly(U) binding splicing factor 60 [Source:HGNC Symbol;Acc:HGNC:17042])

HSP 1 Score: 75.485 bits (184), Expect = 6.795e-14
Identity = 46/106 (43.40%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1124 KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQI-PRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRN 1438
            K+   +E+ V+ L NMV   D+ DD E E     V EEC KFG V  V I     G +++   + KIFVEF   SET KA++AL+GR F+G+ VV   YD E++ N
Sbjct:  454 KLLRKQESTVMVLRNMVDPKDIDDDLEGE-----VTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDN 554          

HSP 2 Score: 59.3066 bits (142), Expect = 9.703e-9
Identity = 45/192 (23.44%), Postives = 84/192 (43.75%), Query Frame = 2
Query:  494 RIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTD------KNFAFLEFRSVEETNQGL-NLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRAC 1048
            R+YVG++   + E+ + + F           A   PI ++ ++ D      K FAF+E+   E     L  ++ ++  G  +K+ RP +        D +   +          ++++V  + Q L +D +K + + FG ++   L +D TTG  KGY F EY     +  A   +    LG + + V +A 
Sbjct:  130 RVYVGSIYYELGEDTIRQAF-----------APFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAF-------NRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAV 303          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 358.221 bits (918), Expect = 3.880e-119
Identity = 186/382 (48.69%), Postives = 255/382 (66.75%), Query Frame = 2
Query:  305 KNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLG-AKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            K Y++WDV PTG+E  +  E+K + + GQV              G   S  P +G +V+ Q+RR+YVGN+P G  EE M++FFN+Q+ L  L QA G+PI+  QIN DKNFAF+EFRS++ET  G+  DGI + G  LK+RRPRDY P    FD + S    + IV D+ +K+F+GGLP YL EDQVKELL +FGPL+ F+L  DS  G SKGYAF EY D ++TD+A  GL GMQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:  109 KKYRFWDVPPTGFETTTPMEYKNMQAAGQV------------PRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD-MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 358.221 bits (918), Expect = 4.038e-119
Identity = 186/382 (48.69%), Postives = 255/382 (66.75%), Query Frame = 2
Query:  305 KNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLG-AKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            K Y++WDV PTG+E  +  E+K + + GQV              G   S  P +G +V+ Q+RR+YVGN+P G  EE M++FFN+Q+ L  L QA G+PI+  QIN DKNFAF+EFRS++ET  G+  DGI + G  LK+RRPRDY P    FD + S    + IV D+ +K+F+GGLP YL EDQVKELL +FGPL+ F+L  DS  G SKGYAF EY D ++TD+A  GL GMQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:  112 KKYRFWDVPPTGFETTTPMEYKNMQAAGQV------------PRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD-MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 358.221 bits (918), Expect = 7.984e-119
Identity = 186/382 (48.69%), Postives = 255/382 (66.75%), Query Frame = 2
Query:  305 KNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLG-AKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            K Y++WDV PTG+E  +  E+K + + GQV              G   S  P +G +V+ Q+RR+YVGN+P G  EE M++FFN+Q+ L  L QA G+PI+  QIN DKNFAF+EFRS++ET  G+  DGI + G  LK+RRPRDY P    FD + S    + IV D+ +K+F+GGLP YL EDQVKELL +FGPL+ F+L  DS  G SKGYAF EY D ++TD+A  GL GMQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:  134 KKYRFWDVPPTGFETTTPMEYKNMQAAGQV------------PRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD-MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 496          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 131.339 bits (329), Expect = 3.511e-36
Identity = 69/148 (46.62%), Postives = 101/148 (68.24%), Query Frame = 2
Query: 1007 MQLGEKRIVVQRACLGA-KNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            MQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:    1 MQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 131.339 bits (329), Expect = 3.511e-36
Identity = 69/148 (46.62%), Postives = 101/148 (68.24%), Query Frame = 2
Query: 1007 MQLGEKRIVVQRACLGA-KNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            MQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:    1 MQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307178)

HSP 1 Score: 405.601 bits (1041), Expect = 2.311e-138
Identity = 206/392 (52.55%), Postives = 274/392 (69.90%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNV----EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            +K   YWDV P G+E+++  ++K + + GQ+  S+      V +   TA   P +G+T++RQARR+YVGN+P GVTEE MMEFFN+Q+ L  L QA G P++A QIN DKNFAFLEFRS++ET Q +  DGI   G +LK+RRP DY P+P   D       +VS+ + + +V D+PHK+F+GGLP YL +DQVKELL +FG LR FNLVKD+ TGLSKGYAFCEY D S+TD++  GL GMQLG+K+++VQRA +GAKNA          TQ +M+    +SNV      TEVLCL NMV  D+LRD+EEYE+I+ED+KEEC+K+G V SV+IPRP    + V G GK+FVEF +  +  KA +AL+GR FS +VVVTS++D +KY    F
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV------VPDTPQTA--VPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAAN----TTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0074234)

HSP 1 Score: 405.601 bits (1041), Expect = 2.311e-138
Identity = 206/392 (52.55%), Postives = 274/392 (69.90%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNV----EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            +K   YWDV P G+E+++  ++K + + GQ+  S+      V +   TA   P +G+T++RQARR+YVGN+P GVTEE MMEFFN+Q+ L  L QA G P++A QIN DKNFAFLEFRS++ET Q +  DGI   G +LK+RRP DY P+P   D       +VS+ + + +V D+PHK+F+GGLP YL +DQVKELL +FG LR FNLVKD+ TGLSKGYAFCEY D S+TD++  GL GMQLG+K+++VQRA +GAKNA          TQ +M+    +SNV      TEVLCL NMV  D+LRD+EEYE+I+ED+KEEC+K+G V SV+IPRP    + V G GK+FVEF +  +  KA +AL+GR FS +VVVTS++D +KY    F
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV------VPDTPQTA--VPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAAN----TTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307176)

HSP 1 Score: 405.601 bits (1041), Expect = 3.974e-138
Identity = 206/392 (52.55%), Postives = 274/392 (69.90%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNV----EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            +K   YWDV P G+E+++  ++K + + GQ+  S+      V +   TA   P +G+T++RQARR+YVGN+P GVTEE MMEFFN+Q+ L  L QA G P++A QIN DKNFAFLEFRS++ET Q +  DGI   G +LK+RRP DY P+P   D       +VS+ + + +V D+PHK+F+GGLP YL +DQVKELL +FG LR FNLVKD+ TGLSKGYAFCEY D S+TD++  GL GMQLG+K+++VQRA +GAKNA          TQ +M+    +SNV      TEVLCL NMV  D+LRD+EEYE+I+ED+KEEC+K+G V SV+IPRP    + V G GK+FVEF +  +  KA +AL+GR FS +VVVTS++D +KY    F
Sbjct:   49 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV------VPDTPQTA--VPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAAN----TTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 427          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307177)

HSP 1 Score: 385.185 bits (988), Expect = 3.241e-131
Identity = 198/372 (53.23%), Postives = 261/372 (70.16%), Query Frame = 2
Query:  362 EFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNV----EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            ++K + + GQ+  S+      V +   TA   P +G+T++RQARR+YVGN+P GVTEE MMEFFN+Q+ L  L QA G P++A QIN DKNFAFLEFRS++ET Q +  DGI   G +LK+RRP DY P+P   D       +VS+ + + +V D+PHK+F+GGLP YL +DQVKELL +FG LR FNLVKD+ TGLSKGYAFCEY D S+TD++  GL GMQLG+K+++VQRA +GAKNA          TQ +M+    +SNV      TEVLCL NMV  D+LRD+EEYE+I+ED+KEEC+K+G V SV+IPRP    + V G GK+FVEF +  +  KA +AL+GR FS +VVVTS++D +KY    F
Sbjct:    2 QYKAMQASGQIPASV------VPDTPQTA--VPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAAN----TTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 360          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: LS2 (gene:FBgn0034834 transcript:FBtr0072052)

HSP 1 Score: 318.161 bits (814), Expect = 1.137e-103
Identity = 182/398 (45.73%), Postives = 255/398 (64.07%), Query Frame = 2
Query:  320 WDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQI-----KLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQ----AFDGIVSNSMTA--------------GIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEE----TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 1432
            WD+ P GY +++  ++K + + GQ+          +++ G+   E  +I + ++RQARR+YVGN+P GVT+E MM+FFN QI     + K     DG+ ++  Q N +KNFAFLEFRS++E +Q LN DG+V+ G  LK+RRP DY P+P     A +   S  + A               IV D+P+K++VGGLP  L +DQVKELLQ+FG L+G NLV D+ T L+KG+AF EY D SVTD A  GL GM LG++R+VVQR+  G KNA     G L    P ++    IS +++    TE LCL NMV  ++L DDEE+E+I  D+K+EC+KFG V S++IPRP G      G GK+FV+F +  ++ KA+KALSGR FSG++V+TS+YD EKY
Sbjct:   62 WDIPPEGYNHLTPQQYKAMLASGQI-------ASRILSDGVHGGESAAI-SMITRQARRLYVGNIPFGVTDEEMMQFFNHQIMALGFEAKSSHYMDGNAVLTCQTNLEKNFAFLEFRSIDEASQALNFDGMVFRGQTLKIRRPHDYQPVPSISVSAMESYRSFRVPAINVAQQPAVTLPVTTIVPDSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLHGMLLGDRRLVVQRSIPGGKNAF---PGHL----PTVLQVPGISTLQDPGSPTETLCLLNMVRPEELLDDEEFEDIRTDIKQECAKFGEVRSIKIPRPIGQFPK-RGCGKVFVQFESVEDSQKALKALSGRKFSGRIVMTSYYDPEKY 443          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 400.208 bits (1027), Expect = 3.007e-135
Identity = 203/393 (51.65%), Postives = 270/393 (68.70%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQ------------AFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQP-MMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++   +LK+RRP DY PLP              F G+VS      +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +V D+A  GL GMQL +K+++VQRA +GAKNA  + I   P+ L  P +  +P        TEVLCL NMV  ++L DDEEYEEI+EDVKEECSK+G V S++IPRP    D + G GKIFVEF +  ++ KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   94 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQAQSLKIRRPHDYQPLPGMSENPSVYVPAVQFQGVVST-----VVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSNPMIQMGGIPTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFTSVYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 480          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 399.823 bits (1026), Expect = 4.167e-135
Identity = 199/383 (51.96%), Postives = 269/383 (70.23%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQP-MMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++   +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +V D+A  GL GMQL +K+++VQRA +GAKNA  + I   P+ L  P +  +P        TEVLCL NMV  ++L DDEEYEEI+EDVKEECSK+G V S++IPRP    D + G GKIFVEF +  ++ KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   94 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQAQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSNPMIQMGGIPTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFTSVYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 475          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 382.874 bits (982), Expect = 1.198e-128
Identity = 199/387 (51.42%), Postives = 276/387 (71.32%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEE-----TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +++D+A  GL GMQLG+K+++VQRA +G+KN   +GI   P+ L  P +M+    S+V +     TEVLCL NMV  ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    D + G GKIFVEF +  ++ KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   84 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTTLTGINQTPVTLQVPGLMN----SSVNQMGGIPTEVLCLMNMVAPEELLDDEEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 465          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 382.874 bits (982), Expect = 1.332e-128
Identity = 202/392 (51.53%), Postives = 277/392 (70.66%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDG---IVSNSMTAGIVQ----DTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEE-----TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +     V  S+  G+V     D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +++D+A  GL GMQLG+K+++VQRA +G+KN   +GI   P+ L  P +M+    S+V +     TEVLCL NMV  ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    D + G GKIFVEF +  ++ KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   84 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGSLPVGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTTLTGINQTPVTLQVPGLMN----SSVNQMGGIPTEVLCLMNMVAPEELLDDEEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 470          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 220.705 bits (561), Expect = 1.497e-68
Identity = 115/213 (53.99%), Postives = 148/213 (69.48%), Query Frame = 2
Query:  698 VYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQP-MMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKI 1321
            ++   +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +V D+A  GL GMQL +K+++VQRA +GAKNA  + I   P+ L  P +  +P        TEVLCL NMV  ++L DDEEYEEI+EDVKEECSK+G V S++IPRP    D + G GK+
Sbjct:    2 IFQAQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSNPMIQMGGIPTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLD-IPGTGKV 213          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 407.527 bits (1046), Expect = 8.133e-139
Identity = 202/387 (52.20%), Postives = 273/387 (70.54%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DD+EYEEI+EDV++EC K+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   34 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDFW 419          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 407.912 bits (1047), Expect = 2.443e-138
Identity = 202/387 (52.20%), Postives = 273/387 (70.54%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DD+EYEEI+EDV++EC K+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   71 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDFW 456          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 404.06 bits (1037), Expect = 1.207e-136
Identity = 204/398 (51.26%), Postives = 274/398 (68.84%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNS-------------MTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP    G+  N              + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DD+EYEEI+EDV++EC K+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   77 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLP----GMSENPSVYVPGRNLPQLWVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDFW 469          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: puf60 (poly(U) binding splicing factor 60KDa [Source:NCBI gene;Acc:100145091])

HSP 1 Score: 76.2554 bits (186), Expect = 2.893e-14
Identity = 46/106 (43.40%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1124 KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQI-PRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRN 1438
            K+   +E+ V+ L NMV   D+ DD E E     V EEC KFG V  V I     G +++   + KIFVEF   SET KA++AL+GR F+G+ VV   YD E++ N
Sbjct:  356 KLMRKQESTVMVLRNMVDPRDIDDDLEGE-----VTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMSSETQKAIQALNGRWFAGRKVVAEVYDQERFDN 456          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: puf60 (poly(U) binding splicing factor 60KDa [Source:NCBI gene;Acc:100145091])

HSP 1 Score: 75.8702 bits (185), Expect = 4.720e-14
Identity = 46/106 (43.40%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1124 KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQI-PRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRN 1438
            K+   +E+ V+ L NMV   D+ DD E E     V EEC KFG V  V I     G +++   + KIFVEF   SET KA++AL+GR F+G+ VV   YD E++ N
Sbjct:  415 KLMRKQESTVMVLRNMVDPRDIDDDLEGE-----VTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMSSETQKAIQALNGRWFAGRKVVAEVYDQERFDN 515          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 390.578 bits (1002), Expect = 1.769e-131
Identity = 204/387 (52.71%), Postives = 274/387 (70.80%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 389.423 bits (999), Expect = 5.574e-131
Identity = 204/391 (52.17%), Postives = 274/391 (70.08%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA------SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA      S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 318.546 bits (815), Expect = 1.089e-105
Identity = 173/308 (56.17%), Postives = 223/308 (72.40%), Query Frame = 2
Query:  539 MMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA  S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:    1 MMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 307          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: Uhmk1 (U2AF homology motif (UHM) kinase 1 [Source:MGI Symbol;Acc:MGI:1341908])

HSP 1 Score: 86.6557 bits (213), Expect = 3.602e-18
Identity = 43/101 (42.57%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            T VL L N++  D L +++EYE+++EDVKEEC K+G V+S+ +P+         G G++FVE+ N  ++  A K L+GR F GK VV +FY L  Y+ G+ 
Sbjct:  231 TPVLRLLNVLDDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKEN------PGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYL 325          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: Uhmk1 (U2AF homology motif (UHM) kinase 1 [Source:MGI Symbol;Acc:MGI:1341908])

HSP 1 Score: 87.0409 bits (214), Expect = 6.144e-18
Identity = 43/101 (42.57%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            T VL L N++  D L +++EYE+++EDVKEEC K+G V+S+ +P+         G G++FVE+ N  ++  A K L+GR F GK VV +FY L  Y+ G+ 
Sbjct:  320 TPVLRLLNVLDDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKEN------PGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYL 414          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|Q24562|U2AF2_DROME (Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster OX=7227 GN=U2af50 PE=1 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.316e-137
Identity = 206/392 (52.55%), Postives = 274/392 (69.90%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNV----EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            +K   YWDV P G+E+++  ++K + + GQ+  S+      V +   TA   P +G+T++RQARR+YVGN+P GVTEE MMEFFN+Q+ L  L QA G P++A QIN DKNFAFLEFRS++ET Q +  DGI   G +LK+RRP DY P+P   D       +VS+ + + +V D+PHK+F+GGLP YL +DQVKELL +FG LR FNLVKD+ TGLSKGYAFCEY D S+TD++  GL GMQLG+K+++VQRA +GAKNA          TQ +M+    +SNV      TEVLCL NMV  D+LRD+EEYE+I+ED+KEEC+K+G V SV+IPRP    + V G GK+FVEF +  +  KA +AL+GR FS +VVVTS++D +KY    F
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV------VPDTPQTA--VPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAAN----TTQSVMLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVE-VPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P26368|U2AF2_HUMAN (Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4)

HSP 1 Score: 389.808 bits (1000), Expect = 3.072e-130
Identity = 204/391 (52.17%), Postives = 274/391 (70.08%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA------SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA      S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P26369|U2AF2_MOUSE (Splicing factor U2AF 65 kDa subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=3)

HSP 1 Score: 389.423 bits (999), Expect = 3.899e-130
Identity = 204/391 (52.17%), Postives = 274/391 (70.08%), Query Frame = 2
Query:  302 KKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA------SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            KK  KYWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +VTD+A  GL GMQLG+K+++VQRA +GAKNA      S I   P+ L  P +M          TEVLCL NMV+ ++L DDEEYEEI+EDV++ECSK+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVE-VPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P90727|U2AF2_CAEBR (Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae OX=6238 GN=uaf-1 PE=3 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 2.288e-119
Identity = 187/382 (48.95%), Postives = 255/382 (66.75%), Query Frame = 2
Query:  305 KNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLG-AKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            K Y++WDV PTG+EN++  E+K + + G             V  G   S  P +G +V+ Q+RR+YVGN+P G  EE M++FFN+Q+ L  L QA G+PI+  QIN DKNFAF+EFRS++ET  G+  DGI + G  LK+RRPRDY P    FD + +    + IV D+ +K+F+GGLP YL EDQVKELL +FGPL+ F+L  DS  G SKGYAF EY D ++TD+A  GL GMQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+LR DE+YEEI+EDV+EECSK+G V S++IPRP   D  V GVGK+FVEF   S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:  125 KKYRFWDVPPTGFENITPMEYKNMQASG------------AVPRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCNLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD-MNARMPVSSIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQTRHNTHLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELRSDEDYEEILEDVREECSKYGIVRSLEIPRPYD-DHPVPGVGKVFVEFATTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 487          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P90978|U2AF2_CAEEL (Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans OX=6239 GN=uaf-1 PE=2 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 1.016e-117
Identity = 186/382 (48.69%), Postives = 255/382 (66.75%), Query Frame = 2
Query:  305 KNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLG-AKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            K Y++WDV PTG+E  +  E+K + + GQV              G   S  P +G +V+ Q+RR+YVGN+P G  EE M++FFN+Q+ L  L QA G+PI+  QIN DKNFAF+EFRS++ET  G+  DGI + G  LK+RRPRDY P    FD + S    + IV D+ +K+F+GGLP YL EDQVKELL +FGPL+ F+L  DS  G SKGYAF EY D ++TD+A  GL GMQLG+K++VVQ AC    ++ + +P     +     +D ++ +    TE+LCL NMV  D+L+ D+EYEEI+EDV++ECSK+G V S++IPRP   D  V GVGK+FVEF + S+  +A  AL+GR F+ + VVTS+YD++KY N  F
Sbjct:  134 KKYRFWDVPPTGFETTTPMEYKNMQAAGQV------------PRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD-MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQQRHNTNLPNSASAIAG---IDLSQGAG-RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPY-EDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 496          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A0R3X1A4 (U2 snRNP auxiliary factor large subunit OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6952 PE=3 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 5.662e-142
Identity = 219/397 (55.16%), Postives = 279/397 (70.28%), Query Frame = 2
Query:  311 YKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLM----LTQPMMMDPTKISNV------EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YKYWDV P G+E+M+  ++K + + GQ+  ++Y         +  N  LT  +  P  G+ V RQARR+YVGN+P   TEE MM+FFN+Q+K + L QA+G+PIIAVQIN +KNFAFLEFRSV+ET QGL LDGI++H  ALKLRRPRDY PLP   +   I+   + + +VQD+PHK+FVGGLP YL EDQVKELL +FGPL+GFNLVKD +TGLSKGYAFCEY D +VTD AC GL GMQLG+K+++VQRA +GAKNA G    PL+    L   ++ + T   N+        TEVLCL NMV  +DL +DEEYE+I+EDV+ ECSK+G V SV+IPRP    + V GVGKIFV+F +  +  KA  AL+GR F  ++VVTSFYD  KY    F
Sbjct:  110 YKYWDVPPPGFEHMTPQQYKALQASGQIPVNVYAAGQVPMPASTPNAPLTLNTNIPFAGSAVCRQARRLYVGNIPFTATEENMMDFFNKQMKAQNLVQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGILFHNQALKLRRPRDYAPLPGVSETPSIIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDPNVTDHACAGLNGMQLGDKKLIVQRASVGAKNAGGAMPPPLIQVPGLNDALVQNTTGSGNIIFRSGGPPTEVLCLLNMVDPEDLTNDEEYEDIVEDVRAECSKYGIVSSVEIPRPIPGVE-VPGVGKIFVQFASLVDCQKAATALTGRKFDNRLVVTSFYDPNKYHRREF 505          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A068Y9C9 (U2 snRNP auxiliary factor large subunit OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 6.043e-142
Identity = 219/397 (55.16%), Postives = 279/397 (70.28%), Query Frame = 2
Query:  311 YKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLM----LTQPMMMDPTKISNV------EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YKYWDV P G+E+M+  ++K + + GQ+  ++Y         +  N  LT  +  P  G+ V RQARR+YVGN+P   TEE MM+FFN+Q+K + L QA+G+PIIAVQIN +KNFAFLEFRSV+ET QGL LDGI++H  ALKLRRPRDY PLP   +   I+   + + +VQD+PHK+FVGGLP YL EDQVKELL +FGPL+GFNLVKD +TGLSKGYAFCEY D +VTD AC GL GMQLG+K+++VQRA +GAKNA G    PL+    L   ++ + T   N+        TEVLCL NMV  +DL +DEEYE+I+EDV+ ECSK+G V SV+IPRP    + V GVGKIFV+F +  +  KA  AL+GR F  ++VVTSFYD  KY    F
Sbjct:  110 YKYWDVPPPGFEHMTPQQYKALQASGQIPVNVYAAGQVPMPASTPNAPLTLNTNIPFAGSAVCRQARRLYVGNIPFTATEENMMDFFNKQMKAQNLVQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGILFHNQALKLRRPRDYAPLPGVSETPSIIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDPNVTDHACAGLNGMQLGDKKLIVQRASVGAKNAGGAMPPPLIQVPGLNDALVQNTTGSGNIIFRSGGPPTEVLCLLNMVDPEDLTNDEEYEDIVEDVRAECSKYGIVSSVEIPRPIPGVE-VPGVGKIFVQFASLVDCQKAATALTGRKFDNRLVVTSFYDPNKYHRREF 505          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: U6J590 (U2 snRNP auxiliary factor large subunit OS=Echinococcus granulosus OX=6210 GN=EGR_02775 PE=3 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 6.043e-142
Identity = 219/397 (55.16%), Postives = 279/397 (70.28%), Query Frame = 2
Query:  311 YKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLM----LTQPMMMDPTKISNV------EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YKYWDV P G+E+M+  ++K + + GQ+  ++Y         +  N  LT  +  P  G+ V RQARR+YVGN+P   TEE MM+FFN+Q+K + L QA+G+PIIAVQIN +KNFAFLEFRSV+ET QGL LDGI++H  ALKLRRPRDY PLP   +   I+   + + +VQD+PHK+FVGGLP YL EDQVKELL +FGPL+GFNLVKD +TGLSKGYAFCEY D +VTD AC GL GMQLG+K+++VQRA +GAKNA G    PL+    L   ++ + T   N+        TEVLCL NMV  +DL +DEEYE+I+EDV+ ECSK+G V SV+IPRP    + V GVGKIFV+F +  +  KA  AL+GR F  ++VVTSFYD  KY    F
Sbjct:  110 YKYWDVPPPGFEHMTPQQYKALQASGQIPVNVYAAGQVPMPASTPNAPLTLNTNIPFAGSAVCRQARRLYVGNIPFTATEENMMDFFNKQMKAQNLVQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGILFHNQALKLRRPRDYAPLPGVSETPSIIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDPNVTDHACAGLNGMQLGDKKLIVQRASVGAKNAGGAMPPPLIQVPGLNDALVQNTTGSGNIIFRSGGPPTEVLCLLNMVDPEDLTNDEEYEDIVEDVRAECSKYGIVSSVEIPRPIPGVE-VPGVGKIFVQFASLVDCQKAATALTGRKFDNRLVVTSFYDPNKYHRREF 505          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A0R3TPX5 (U2 snRNP auxiliary factor large subunit OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9552 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 8.371e-142
Identity = 218/397 (54.91%), Postives = 280/397 (70.53%), Query Frame = 2
Query:  311 YKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLM----LTQPMMMDPTKISNV------EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YKYWDV P G+E+M+  ++K + + GQ+  ++Y         +  N  LT  +  P  G+ V RQARR+YVGN+P   TE+ MM+FFN+Q+K + L QA+G+PIIAVQIN +KNFAFLEFRSV+ET QGL LDGI++H  ALKLRRPRDY PLP   +   ++   + + +VQD+PHK+FVGGLP YL EDQVKELL +FGPL+GFNLVKD +TGLSKGYAFCEY D +VTD AC GL GMQLG+K+++VQRA +GAKN+SG    PL+    L   ++ + T   N+        TEVLCL NMV  +DL +DEEYE+I+EDV+ ECSK+G V SV+IPRP    D V GVGKIFV+F +  +  KA  AL+GR F  ++VVTSFYD  KY    F
Sbjct:  108 YKYWDVPPPGFEHMTPQQYKALQASGQIPVNVYAAGQVPMPASTPNAPLTLNTNIPFAGSAVCRQARRLYVGNIPFTATEDNMMDFFNKQMKAQNLVQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGILFHDQALKLRRPRDYAPLPGVSETPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDPNVTDHACAGLNGMQLGDKKLIVQRASVGAKNSSGTLPLPLIQVPGLNDALVQNTTGSGNIILRSGGPPTEVLCLLNMVDPEDLTNDEEYEDIVEDVRAECSKYGIVSSVEIPRPIPGVD-VPGVGKIFVQFASLVDCQKAATALTGRKFDNRLVVTSFYDPNKYHRREF 503          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A0R3SJW2 (U2 snRNP auxiliary factor large subunit OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5225 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 8.554e-142
Identity = 218/397 (54.91%), Postives = 280/397 (70.53%), Query Frame = 2
Query:  311 YKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLM----LTQPMMMDPTKISNV------EETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YKYWDV P G+E+M+  ++K + + GQ+  ++Y         +  N  LT  +  P  G+ V RQARR+YVGN+P   TE+ MM+FFN+Q+K + L QA+G+PIIAVQIN +KNFAFLEFRSV+ET QGL LDGI++H  ALKLRRPRDY PLP   +   ++   + + +VQD+PHK+FVGGLP YL EDQVKELL +FGPL+GFNLVKD +TGLSKGYAFCEY D +VTD AC GL GMQLG+K+++VQRA +GAKN+SG    PL+    L   ++ + T   N+        TEVLCL NMV  +DL +DEEYE+I+EDV+ ECSK+G V SV+IPRP    D V GVGKIFV+F +  +  KA  AL+GR F  ++VVTSFYD  KY    F
Sbjct:  110 YKYWDVPPPGFEHMTPQQYKALQASGQIPVNVYAAGQVPMPASTPNAPLTLNTNIPFAGSAVCRQARRLYVGNIPFTATEDNMMDFFNKQMKSQNLVQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGILFHDQALKLRRPRDYAPLPGVSETPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDPNVTDHACAGLNGMQLGDKKLIVQRASVGAKNSSGTLPPPLIQVPGLNDALVQNTTGSGNIILRSGGPPTEVLCLLNMVDPEDLTNDEEYEDIVEDVRAECSKYGIVSSVEIPRPIPGVD-VPGVGKIFVQFASLVDCQKAATALTGRKFDNRLVVTSFYDPNKYHRREF 505          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2a (splicing factor U2AF 65 kDa subunit-like [Source:NCBI gene;Acc:103024792])

HSP 1 Score: 400.979 bits (1029), Expect = 9.302e-136
Identity = 199/392 (50.77%), Postives = 277/392 (70.66%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDG--------IVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTG----PLMLTQPMMMDPT--KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +          V   + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D +++D+A  GL GMQLG+K+++VQRA +G+KN S + TG    P+ L  P +M+ +  ++  +  TEVLCL NMV  ++L DD+EYEEI+EDV+EECSK+G V S++IPRP    + V G GKIFVEF +  ++ KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   81 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGLSVPPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTSLVGTGMNQTPVTLQVPGLMNSSMNQMGGI-PTEVLCLMNMVSPEELLDDDEYEEIVEDVREECSKYGQVKSIEIPRPVDGLE-VPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 470          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2b (splicing factor U2AF 65 kDa subunit [Source:NCBI gene;Acc:103026862])

HSP 1 Score: 400.593 bits (1028), Expect = 1.047e-135
Identity = 197/383 (51.44%), Postives = 272/383 (71.02%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVE--ETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D ++ D+A  GL GMQLG+K+++VQRA +GAKNA  + I   P+ L  P +M+ T ++ +    TEVLCL NMV  ++L DD+EYEEI+EDV++ECSK+G V S++IPRP    D + G GKIFVEF    ++ KAM+ L+GR F+ +VVVT + D + Y    F
Sbjct:   75 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSVHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGAKNATMTSINETPVTLQVPGLMN-TSMNQMGGIPTEVLCLMNMVAPEELLDDDEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFTTLYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 455          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2b (splicing factor U2AF 65 kDa subunit [Source:NCBI gene;Acc:103026862])

HSP 1 Score: 400.208 bits (1027), Expect = 1.843e-135
Identity = 197/383 (51.44%), Postives = 272/383 (71.02%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVE--ETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D ++ D+A  GL GMQLG+K+++VQRA +GAKNA  + I   P+ L  P +M+ T ++ +    TEVLCL NMV  ++L DD+EYEEI+EDV++ECSK+G V S++IPRP    D + G GKIFVEF    ++ KAM+ L+GR F+ +VVVT + D + Y    F
Sbjct:   82 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSVHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGAKNATMTSINETPVTLQVPGLMN-TSMNQMGGIPTEVLCLMNMVAPEELLDDDEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLD-IPGTGKIFVEFTTLYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 462          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:103036001])

HSP 1 Score: 91.2781 bits (225), Expect = 1.911e-19
Identity = 44/101 (43.56%), Postives = 67/101 (66.34%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            T VL L N++    L +D+EYEEI+ED++EEC K+G+V+S+ IP+         G G++FVE+ N  ++ +A + L+GRTF GK VV +FY L  Y+ G+ 
Sbjct:  332 TPVLRLLNVIDDCHLHNDDEYEEIIEDMREECQKYGSVISLLIPKEN------PGKGQVFVEYANAGDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYL 426          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:103036001])

HSP 1 Score: 91.2781 bits (225), Expect = 2.073e-19
Identity = 44/101 (43.56%), Postives = 67/101 (66.34%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            T VL L N++    L +D+EYEEI+ED++EEC K+G+V+S+ IP+         G G++FVE+ N  ++ +A + L+GRTF GK VV +FY L  Y+ G+ 
Sbjct:  332 TPVLRLLNVIDDCHLHNDDEYEEIIEDMREECQKYGSVISLLIPKEN------PGKGQVFVEYANAGDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYL 426          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 398.282 bits (1022), Expect = 1.689e-135
Identity = 205/381 (53.81%), Postives = 269/381 (70.60%), Query Frame = 2
Query:  320 WDVAPTGYENMSAAEFKQIHSGGQV-LPSLYLTEGNVVNMGL---TASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSN---SMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASG--IPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYR 1435
            WDV P G+E+++  ++K + + GQ+   +L  T       GL    A   P +G+ ++RQARR+YVGN+P GVTEE MM+FFN Q+KL  L QA G+P++AVQIN DKNFAFLEFRSV+ET Q L  DGI++ G +LKLRRP DY PLP   +    +    + + +VQDTPHKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS T  SKGYAFCEYAD +VTD+A  GL GMQLG+K+++VQRA +GAKNA+   +   P+ L  P +       +   TEVLCL NMV  ++L DDEEYE+I+ED++EEC K+G+V SV+IPRP    D + G GKIFVEF +  +  +A +ALSGR F+ +VVVT +Y+LEKY 
Sbjct:   77 WDVPPPGFEHITPLQYKAMQAAGQIPATALIATTTTATVAGLPNPAAMPVPIVGSQLTRQARRLYVGNIPFGVTEEAMMDFFNNQMKLAGLAQAPGNPVLAVQINLDKNFAFLEFRSVDETTQALAFDGIIFQGQSLKLRRPHDYQPLPGMSESPALHVPVGVVSTVVQDTPHKLFIGGLPSYLTDDQVKELLTSFGPLKAFNLVKDSATCFSKGYAFCEYADVNVTDQAIAGLNGMQLGDKKLIVQRASVGAKNANPTVVVQTPVTLQVPGLASSQVQHSGLPTEVLCLMNMVTPEELVDDEEYEDILEDIREECGKYGSVRSVEIPRPVNGLD-IPGCGKIFVEFASLLDCQRAQQALSGRKFANRVVVTQYYNLEKYH 456          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 76.2554 bits (186), Expect = 4.061e-15
Identity = 91/375 (24.27%), Postives = 149/375 (39.73%), Query Frame = 2
Query:  482 RQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRP---RDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVV-------------------------------QRACLGAKNASG----IP---------TGPLML--TQPMM-----MDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGF 1444
            R AR ++   L   +    + EFF+   K++++       I        K  A++EF  V+  +  + L G    G  + ++     ++      A    +  S TAG     P +L+VG L   + ED +K + + FG +    L+ DS TG S+GY F  +AD     KA   L G +L  + + V                                R  L AK A G    IP         TG   L  T P+M       P  I+    T+ + L NM   +  +     ++I +DV  EC K G ++ + +       D  S  G ++V+  + +  +  + AL GR F+GK++  +F  +  Y N F
Sbjct:  156 RDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRM-----ISDRNSRRSKGIAYIEFVEVDSVSLAIGLTGQRLLGVPIIVQASQAEKNRAAAAAAAAATMQKS-TAG-----PMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVGHVTERSDGSGASSFLDNDELERTGIDLGSTGRLHLMAKLAEGTGLQIPLAAQQALQMTGGFGLGTTNPVMPVLNNAAPPSIA----TQCIQLSNMFSPESEQSHTWDQDIRDDVITECMKHGGLVHIFV-------DKNSPQGNVYVKCSSVASAIATVNALHGRWFAGKMITAAFVPVPTYHNLF 508          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 66.2402 bits (160), Expect = 6.463e-12
Identity = 86/391 (21.99%), Postives = 148/391 (37.85%), Query Frame = 2
Query:  482 RQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKN------FAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGI--VQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQ--------------------------------------RACLGAKNASG------------------IPTGPLM----LTQPMM-MDPT-KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGF 1444
            R +R ++   L   +  + + EFF+   K+++           V++ +D+N       A++EF  ++     + L G    G  +        V   QA     + +  A +  +   P +L+VG L   + E  +  + + FG +    L+ D  TG SKG+ F  ++      KA   L G +L  + + V                                       R  L AK A G                  IP   LM       P++ M+PT  +S    T+   L NM       +    +EI +DV EEC+K G V+ + +       D  S  G ++V+  N    + A+ +L GR F+GK++  ++  +  Y N F
Sbjct:  171 RDSRTVFCMQLAARIRAKDLEEFFSAVGKVRD-----------VRLISDRNSRRSKGIAYIEFVDLDSVPLAIGLTGQRLLGVPI-------IVQASQAEKNRAAAAAAANLQKLASGPMRLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVNYVSDHSDVIISVGSGGGGSSFLDNDELERTGIDLTNTGRLQLMAKLAEGSGLTIPPVAQQALQMNGAIPLEALMPSLAACGPLVAMNPTFTMSPTIATQCFQLSNMFNPQSEVNSSWVQEIRDDVVEECNKHGGVVHIYV-------DQNSAEGHVYVKCPNIPVALAAVNSLHGRWFAGKMITAAYVPVPTYHNLF 536          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: rbm34 (RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-GENE-040718-77])

HSP 1 Score: 62.3882 bits (150), Expect = 7.371e-11
Identity = 49/224 (21.88%), Postives = 105/224 (46.88%), Query Frame = 2
Query:  482 RQARRIYVGNLPLGVTEEGMMEFFN-----EQIKLKELTQADGDPII---AVQINT-----DKNFAFLEFRSVEETNQGLNLDGI-VYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMG--LTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQP 1105
            ++ R ++VGNLP+ + +E + +FF      E ++L+ + +AD +  +   A+Q  T     +KN A++ F+  +   Q L+ +G  +  GF +++                  ++ +     D    +F+G LP  + ED+++   +  GP+    +V+D  +G+ KG+ +  +     TD   +   L G ++  +++ V+R+    K   G    P   ++P
Sbjct:  107 KRKRTVFVGNLPMSLAKEAVKKFFRPCGVIESVRLRCIARADPEMSLKQAAIQGKTHPQRNNKN-AYVVFKEEQGAVQALSRNGEEIQSGFHIRV------------------DAASGEKNHDHKRSVFIGNLPYDVEEDRIRSHFEPCGPVESVRVVRDRESGMGKGFGYILFKG---TDAVLLALHLDGSEMAGRKVRVKRSVKKEKIKPGRAGRPANSSRP 308          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 59.6918 bits (143), Expect = 2.329e-10
Identity = 41/167 (24.55%), Postives = 72/167 (43.11%), Query Frame = 2
Query:  485 QARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDK 985
            Q R++++G L    TEE + E++ +   + +      DP         + F F+ +  +EE N  +        G  ++ +R    VP   +  GI          Q T  KLFVGG+     E  +++    FG +   ++V D  TG  +G+AF  + D+   D+
Sbjct:   12 QMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMK-DP----SSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRA---VPRDDSRPGI----------QVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQ 160          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 54.6842 bits (130), Expect = 9.697e-9
Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  785 MTAGIVQDTPHKL-FVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEK 1024
            + AG+  + P ++ ++G +P    E+Q+ +L    GP+    ++ D  TG SKGYAF E+ D   +  A   L G QLG +
Sbjct:    7 VNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSR 87          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 53.1434 bits (126), Expect = 5.003e-8
Identity = 47/203 (23.15%), Postives = 92/203 (45.32%), Query Frame = 2
Query:  497 IYVGNLPLGVTEEGMMEFF------NEQIKLK----ELTQADGDPIIAVQINTDKN--FAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHK-LFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYAD-----HSVTDKACMGLTG----MQLGEKRIVVQ 1039
            +++GNL    T++ ++ FF      NE  K +    ++T+     + A   N  KN  F ++ F++VE+    L L     +G  + ++   +Y   P   D +        + ++ P + LFVG L   + +D +++  Q  G +    +     +G  KG+AF ++ +     +++ DK+C  + G    M+ GE R   Q
Sbjct:  127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVA-------MSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGRPLRMEYGEDRSKRQ 322          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 50.0618 bits (118), Expect = 5.559e-7
Identity = 47/192 (24.48%), Postives = 79/192 (41.15%), Query Frame = 2
Query:  491 RRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKN-----FAFLEFRSVEETNQGLN-LDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRAC 1048
            R +YVGNL   +TE+ + ++F  Q+         G PI  ++I  DKN     +AF+E+    + N  L  L+G       +K+           AF    S+S       D    LFVG L   + ++ ++   + F      +++ D  TG S+GY F  +        A   + G  L  + + +  A 
Sbjct:   75 RVLYVGNLDKAITEDILKQYF--QV---------GGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKIN---------WAFQSQQSSS-------DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAA 239          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 49.2914 bits (116), Expect = 1.023e-6
Identity = 42/192 (21.88%), Postives = 81/192 (42.19%), Query Frame = 2
Query:  476 VSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRR--PRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRA 1045
            +S+++ ++++G L    TE+ + E+F +   + +L +   DP         + F FL F      ++ +    I+  G  +  +R  PRD                     QD   K+FVGG+   +   + +E    +G +    L+ D  TG S+G+ F  Y      D+ C     +   +++I ++RA
Sbjct:  154 LSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDL-KIMKDPATG----RSRGFGFLSFEKPSSVDEVVKTQHIL-DGKVIDPKRAIPRD--------------------EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKF-IDFKDRKIEIKRA 318          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 48.521 bits (114), Expect = 1.949e-6
Identity = 65/278 (23.38%), Postives = 116/278 (41.73%), Query Frame = 2
Query:  602 IIAVQINTDKN-----FAFLEFRSVEETNQGLN-LDGIVYHGFALKL-----RRPRDYVPLPQAFDGIVSNSMTAGIVQDTPH--KLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGK 1396
            I++ +I TD+N     F F+ F       + ++ L+G++ +G  + +     R+ RD                 + + +   H   L+V  +     ++Q +EL   FGP+   +L KD+   L KG+ F  Y  H    KA   L   +L  +++ V RA    KN         M       +  ++  + + + + L  +  +DD  DDE+ E       EE + +GT+ S ++ R     +N    G  FV F    E  KA+   + +  +GK
Sbjct:  152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERD-----------------SQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKL-KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ--KKNER-------MHVLKKQYEAYRLEKMAKYQGVNLF-VKNLDDSVDDEKLE-------EEFAPYGTITSAKVMR----TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 390          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO48329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT7])

HSP 1 Score: 347.051 bits (889), Expect = 6.018e-117
Identity = 181/335 (54.03%), Postives = 230/335 (68.66%), Query Frame = 2
Query:  476 VSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNS------MTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKIS-----NVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            ++RQARR+YVGN+P GVTE  M+EFFN ++K  +L  A G+P+IA QINT++NFAF+E RSVEET Q +  DGI+  G ALK+RRP+DY P+P    G+  N+      + + +V D+PHK+F+GGLP YL EDQVKELL +FG LR FNLVKDS TGLSKGYAFCEY D  +TD A  GL GMQLG+K+++VQRA +GAK     P    M+   + +    IS      V  TEVL L NMV  D+L DDEE+EEI +DV+EECSK+G V S++IPRP        GVGKIFVEF +  +  KA  AL GR F+ +VVVTS+Y  E+Y    F
Sbjct:    1 MTRQARRLYVGNIPFGVTENLMIEFFNAKMKEAKLNTAPGNPVIAAQINTEQNFAFIELRSVEETTQAMAFDGIILQGQALKIRRPKDYQPIP----GMSENASVHVPGVVSTVVPDSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGLNGMQLGDKKLIVQRASVGAKQNLNNPQAMNMVPAQLQIPGLDISMAVPGAVAATEVLALMNMVTPDELGDDEEFEEIYDDVREECSKYGRVKSMEIPRPMEGLMEPPGVGKIFVEFSSIDDAKKAAAALGGRKFANRVVVTSYYPPEEYHRRIF 331          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 76.2554 bits (186), Expect = 7.356e-15
Identity = 61/247 (24.70%), Postives = 100/247 (40.49%), Query Frame = 2
Query:  812 PHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVV------------------------------QRACLGAKNASG------IPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGF 1444
            P +L+VG L   + E  VK + + FG +    L+ DS T  SKGY F ++ +     +A   + G +L  + + +                               RA L AK + G      +P  P +++       T ++    T    L NM      RD     +I +DV EEC+KFG ++ + +       D  S  G ++V+       + A K+L GR F+GK ++ +   L  Y   F
Sbjct:  214 PTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIGPVTERGDSSAYSFLDDEEYEKGGVELNSSARAALMAKLSQGHSAGLSVPGAPPIVSGVQQALATPVAVSLPTPCFMLTNMFDPTKERDAGWDLDIRDDVLEECNKFGPIVHIHV-------DKNSPQGIVYVKCATPDIAISASKSLHGRWFAGKQIIAAPVPLSNYHTMF 453          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO46306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK4])

HSP 1 Score: 73.1738 bits (178), Expect = 8.249e-14
Identity = 43/104 (41.35%), Postives = 62/104 (59.62%), Query Frame = 2
Query: 1124 KISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPR-PTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 1432
            K+S   E++V+ L NMV ++DL +D E+E     V +ECSKFGTV  V I +   G +++   + KIFVEF +  ET KA   L GR F G+ V    Y+ +K+
Sbjct:  399 KLSRKSESKVMVLRNMVGVEDLDEDLEHE-----VTDECSKFGTVSRVVIYKEKQGEEEDAEVIVKIFVEFTSPDETDKATSNLDGRWFGGRAVKAEAYNEDKF 497          

HSP 2 Score: 55.8398 bits (133), Expect = 2.596e-8
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 2
Query:  494 RIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTD------KNFAFLEFRSVEETNQGL-NLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRA 1045
            R+YVG++   + EE +   F+              PI  + ++ D      K FAF+E+   E     L  ++G++  G  +K+ RP +   +PQA   I      A        ++++  +   L ED +K + + FG +   +L K+  TG  KGY F EY +    + A   +    LG + + V RA
Sbjct:   65 RVYVGSINFELREEHIRTAFH-----------PFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRPSN---VPQAAPLIEQFEQEA----KKYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRA 237          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO25346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWR4])

HSP 1 Score: 59.6918 bits (143), Expect = 9.152e-11
Identity = 36/98 (36.73%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPR-PTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYR 1435
            ++V+ L NMV   ++ DD     +  +  EEC+K+G V+ V I   P GA D+ +   +IFVEF      +KA+  L+GR F G+ V  +F++L+K+R
Sbjct:   60 SKVVLLRNMVGPGEVDDD-----LQPETAEECAKYGEVVKVIIYEIPVGAPDDEAV--RIFVEFTRMESAIKAVVDLNGRYFGGRTVKANFFNLDKFR 150          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO39985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H1])

HSP 1 Score: 59.6918 bits (143), Expect = 9.933e-10
Identity = 36/98 (36.73%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPR-PTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYR 1435
            ++V+ L NMV   ++ DD     +  +  EEC+K+G V+ V I   P GA D+ +   +IFVEF      +KA+  L+GR F G+ V  +F++L+K+R
Sbjct:  298 SKVVLLRNMVGPGEVDDD-----LQPETAEECAKYGEVVKVIIYEIPVGAPDDEAV--RIFVEFTRMESAIKAVVDLNGRYFGGRTVKANFFNLDKFR 388          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2 [Source:NCBI gene;Acc:101165173])

HSP 1 Score: 377.096 bits (967), Expect = 8.277e-127
Identity = 196/382 (51.31%), Postives = 267/382 (69.90%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D ++ D+A  GL GMQLG+K+++VQRA +G+KNA  + I   P+ L  P +           TEVLCL NMV  ++L DDEEYEEI+EDV+EEC K+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   59 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGSKNATLTSINQTPVTLQVPGLNSSVTQMGGLPTEVLCLMNMVAPEELLDDEEYEEIVEDVREECGKYGQVKSIEIPRPVDGLE-VPGTGKIFVEFTSVFDAQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 439          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2 [Source:NCBI gene;Acc:101165173])

HSP 1 Score: 377.481 bits (968), Expect = 1.424e-126
Identity = 196/382 (51.31%), Postives = 267/382 (69.90%), Query Frame = 2
Query:  317 YWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD--GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNA--SGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY-RNGFF 1447
            YWDV P G+E+++  ++K + + GQ+  +  L       + +T +  P +G+ ++RQARR+YVGN+P G+TEE MM+FFN Q++L  LTQA G+P++AVQIN DKNFAFLEFRSV+ET Q +  DGI++ G +LK+RRP DY PLP   +   +    + + +V D+ HKLF+GGLP YL +DQVKELL +FGPL+ FNLVKDS TGLSKGYAFCEY D ++ D+A  GL GMQLG+K+++VQRA +G+KNA  + I   P+ L  P +           TEVLCL NMV  ++L DDEEYEEI+EDV+EEC K+G V S++IPRP    + V G GKIFVEF +  +  KAM+ L+GR F+ +VVVT + D + Y R  F+
Sbjct:   90 YWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGSKNATLTSINQTPVTLQVPGLNSSVTQMGGLPTEVLCLMNMVAPEELLDDEEYEEIVEDVREECGKYGQVKSIEIPRPVDGLE-VPGTGKIFVEFTSVFDAQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDFW 470          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:101158012])

HSP 1 Score: 96.2857 bits (238), Expect = 4.563e-21
Identity = 46/101 (45.54%), Postives = 69/101 (68.32%), Query Frame = 2
Query: 1145 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            + VL L N++    L ++EEYE+IMED+KEEC K+G+V+S+ IP+         G G++FVE+ N S++ +A + L+GRTF GK VV +FY L  Y+ G+F
Sbjct:  344 SPVLRLLNLIDDSHLHNEEEYEDIMEDMKEECQKYGSVVSLLIPKEN------PGKGQVFVEYANSSDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYF 438          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:101158012])

HSP 1 Score: 95.9005 bits (237), Expect = 5.200e-21
Identity = 46/99 (46.46%), Postives = 68/99 (68.69%), Query Frame = 2
Query: 1151 VLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            VL L N++    L ++EEYE+IMED+KEEC K+G+V+S+ IP+         G G++FVE+ N S++ +A + L+GRTF GK VV +FY L  Y+ G+F
Sbjct:  313 VLRLLNLIDDSHLHNEEEYEDIMEDMKEECQKYGSVVSLLIPKEN------PGKGQVFVEYANSSDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYF 405          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: rbm39b (RNA-binding protein 39 [Source:NCBI gene;Acc:101167788])

HSP 1 Score: 71.2478 bits (173), Expect = 7.287e-13
Identity = 89/388 (22.94%), Postives = 141/388 (36.34%), Query Frame = 2
Query:  482 RQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKN------FAFLEFRSVEETNQGLNLDG--------IVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVV-------------------------------QRACLGAKNASG------------------IPTGPLMLTQPMMMDPTKISNVEE----TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGF 1444
            R AR ++   L   +    + +FF+   K+++           V+I +D+N       A++EF         + L G        IV    A K R       L +   G              P +L+VG L   + E+ ++ + + FG + G  L+ DS TG SKGY F  +AD     KA   L G +L  + + V                                R  L A+ A G                  IP G +         P++  N+      T  L L N+       D     EI +DV EEC+K G V+ + +       D  S  G ++V+  +    +  + AL GR F+ K++  ++  L  Y N F
Sbjct:  147 RDARTVFCMQLAARIRARDLEDFFSAVGKVRD-----------VRIISDRNSRRSKGIAYIEFVETSSVPLAIGLTGQRLLGVPIIVQASQAEKNRAAAAANNLQKGSAG--------------PMRLYVGSLHFNITEEMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVGHVTERSDSSTASSFLDNDELERTGIDLGTTGRLQLMARLAEGTGLKIPPAAQQALQMTGSIPFGNMAAPAIPTPAPSQALNLPSQPLATHCLQLSNLFDPQAENDPAWASEIQDDVIEECNKHGGVVHIYV-------DKNSPQGNVYVKCPSIPAAMATVNALHGRWFARKMITAAYVPLPTYHNLF 502          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000018652.1 (SMESG000018652.1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 475/476 (99.79%), Postives = 476/476 (100.00%), Query Frame = 2
Query:   20 MSVEYSNQMDKVKEEMSIKREPNYDEPKDKRDRQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            MSVEYSNQMDKVKEEMSIKREPNYDEPKD+RDRQPRRSQEKSESRSRHRSRSHKRKRSNSHEHKSSRRRRSRDRRSRSHERRRRSTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF
Sbjct:    1 MSVEYSNQMDKVKEEMSIKREPNYDEPKDRRDRQPRRSQEKSESRSRHRSRSHKRKRSNSHEHKSSRRRRSRDRRSRSHERRRRSTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 476          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000018647.1 (SMESG000018647.1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 475/476 (99.79%), Postives = 476/476 (100.00%), Query Frame = 2
Query:   20 MSVEYSNQMDKVKEEMSIKREPNYDEPKDKRDRQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            MSVEYSNQMDKVKEEMSIKREPNYDEPKD+RDRQPRRSQEKSESRSRHRSRSHKRKRSNSHEHKSSRRRRSRDRRSRSHERRRRSTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF
Sbjct:    1 MSVEYSNQMDKVKEEMSIKREPNYDEPKDRRDRQPRRSQEKSESRSRHRSRSHKRKRSNSHEHKSSRRRRSRDRRSRSHERRRRSTSPNPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 476          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000078029.1 (SMESG000078029.1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 288/391 (73.66%), Postives = 337/391 (86.19%), Query Frame = 2
Query:  284 NPLLELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLT--QPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGA-DDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRNGFF 1447
            N  +ELKK+YKYWDV PTGYE+MS +EFK + + GQVLP++Y TE  +VN      ++PSIG+ VSRQARRIYVGN+PLGVTE+GMM+FFNEQ+KLK  TQADGDPIIAVQINTDKNFAFLEFRSVEET+QGLNLDGI+Y+GF LKLRRPRDYVPLP   D ++ NS+ AG+VQDTPHKLF+GGLP YL EDQVKELL TFGPL GFNLVKDS+TGLSKGYAFCEYADHSVTDKAC+GLTGMQLGEKRIVVQRA LGAKN +   T  L++   Q + MDP+  +  +ETE+LCLHNM+  ++L DDEEYEEI+EDVKEECSK+G+V S+QIPRPTG+ +D+ +GVGKI+VEF NKSETVKAMKAL+GRTFSG+VVVTSFYD E+YRNGFF
Sbjct:  110 NASVELKKDYKYWDVPPTGYEHMSPSEFKAMQAAGQVLPTIYATESGIVNTEQIMDQHPSIGSAVSRQARRIYVGNIPLGVTEQGMMDFFNEQMKLKLFTQADGDPIIAVQINTDKNFAFLEFRSVEETSQGLNLDGIMYNGFPLKLRRPRDYVPLPTTMDTMLPNSLAAGVVQDTPHKLFIGGLPHYLNEDQVKELLLTFGPLSGFNLVKDSSTGLSKGYAFCEYADHSVTDKACLGLTGMQLGEKRIVVQRASLGAKNPTTAATTALLIARQQQLGMDPSMGTCGQETEILCLHNMITPEELTDDEEYEEIVEDVKEECSKYGSVNSLQIPRPTGSEEDSRNGVGKIYVEFSNKSETVKAMKALAGRTFSGRVVVTSFYDPERYRNGFF 500          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000051274.1 (SMESG000051274.1)

HSP 1 Score: 395.201 bits (1014), Expect = 6.297e-134
Identity = 219/402 (54.48%), Postives = 276/402 (68.66%), Query Frame = 2
Query:  293 LELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD-------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEE---------TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 1432
            L  KK YKYWDV P G++++S A +K + + GQ+  ++Y         N  N  L   S+ P  G+ V RQARR+YVGN+P G+TE  M+E FN Q+K+K L QA+GDP+IAVQIN DKNFAF+EFRSV+ET Q L LDGI + G  LKLRRPRDYVPLP   D       G+VS      +VQ+TP+K+F+G LP YL +DQVKELL +FGPLRGFNLVKD  TGLSKGYAFCEY D SVTD AC GL GMQLG+K+I+VQRA +GAK+             PMMM P   +N E          T+VLCL NMV  +DL D+EEYE++++D+  EC K+GTV+S++IPRP      V GVGKIFVEF +  +  KA+ AL+GR F+ +VVVTS+YDL+KY
Sbjct:   59 LPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVST-----MVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHG----------LIPMMM-PFVNANFESLIAAGGVGATKVLCLMNMVDEEDLVDEEEYEDVVDDINSECGKYGTVVSLEIPRPN-PTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKY 443          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000003347.1 (SMESG000003347.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.660e-16
Identity = 89/338 (26.33%), Postives = 145/338 (42.90%), Query Frame = 2
Query:  482 RQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDGIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFC-----EYADHSVTDKACMGLTGM--------------QLGEKRIVVQRAC--LGAKNASGIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 1432
            + AR IY+  L L V    + +FF +  K+  +       ++  +    +  AF++FR VE  N+ L+L+G    G  +++R         +A +G +++S    I    P KL V  L   + E  ++E+   +G +    L+KD   G S G AF      E A + V       L G               + GE + V   A   LG      + TG L +        T I N   ++   L NM  + D  +D+  +E+ +DV  EC++FG V  V I R        S  G+I+V+  +     K +  L GR+F G+V+  ++  LE Y
Sbjct:  122 KDARTIYIWQLSLRVRTRDLEDFFVQVGKMDVVR-----LVLDNKTGKSRGVAFIQFRDVESVNKALDLNGQKLMGVPIQIRTVSS--EKCRAAEGTMNSSY---IYFRGPTKLCVSNLHPQINEQMIEEIFAPYGKIDELRLMKD-IRGTSLGTAFILFRKGENAKNVVEQMNDFNLAGQLLKIAPVVEEGGLNEFGENQGVSMTAADRLGLMAKLAVGTG-LQVVPKANAVQTPIIN---SQCFVLSNMFDVKDAHEDKFCKEVQDDVVGECNQFGGVYHVHIDRK-------SPRGEIYVKCPSIYVANKCVSTLHGRSFDGRVITANYIPLEHY 437          
The following BLAST results are available for this feature:
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2AF22.576e-13152.71U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF26.396e-13152.17U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF21.587e-10556.17U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF21.278e-1538.96U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
PUF606.795e-1443.40poly(U) binding splicing factor 60 [Source:HGNC Sy... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uaf-13.880e-11948.69Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-14.038e-11948.69Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-17.984e-11948.69Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-13.511e-3646.62Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-13.511e-3646.62Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2af502.311e-13852.55gene:FBgn0005411 transcript:FBtr0307178[more]
U2af502.311e-13852.55gene:FBgn0005411 transcript:FBtr0074234[more]
U2af503.974e-13852.55gene:FBgn0005411 transcript:FBtr0307176[more]
U2af503.241e-13153.23gene:FBgn0005411 transcript:FBtr0307177[more]
LS21.137e-10345.73gene:FBgn0034834 transcript:FBtr0072052[more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2b3.007e-13551.65U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
u2af2b4.167e-13551.96U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
u2af2a1.198e-12851.42U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
u2af2a1.332e-12851.53U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
u2af2b1.497e-6853.99U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbp8.133e-13952.20myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
mbp2.443e-13852.20myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
mbp1.207e-13651.26myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
puf602.893e-1443.40poly(U) binding splicing factor 60KDa [Source:NCBI... [more]
puf604.720e-1443.40poly(U) binding splicing factor 60KDa [Source:NCBI... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2af21.769e-13152.71U2 small nuclear ribonucleoprotein auxiliary facto... [more]
U2af25.574e-13152.17U2 small nuclear ribonucleoprotein auxiliary facto... [more]
U2af21.089e-10556.17U2 small nuclear ribonucleoprotein auxiliary facto... [more]
Uhmk13.602e-1842.57U2AF homology motif (UHM) kinase 1 [Source:MGI Sym... [more]
Uhmk16.144e-1842.57U2AF homology motif (UHM) kinase 1 [Source:MGI Sym... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24562|U2AF2_DROME2.316e-13752.55Splicing factor U2AF 50 kDa subunit OS=Drosophila ... [more]
sp|P26368|U2AF2_HUMAN3.072e-13052.17Splicing factor U2AF 65 kDa subunit OS=Homo sapien... [more]
sp|P26369|U2AF2_MOUSE3.899e-13052.17Splicing factor U2AF 65 kDa subunit OS=Mus musculu... [more]
sp|P90727|U2AF2_CAEBR2.288e-11948.95Splicing factor U2AF 65 kDa subunit OS=Caenorhabdi... [more]
sp|P90978|U2AF2_CAEEL1.016e-11748.69Splicing factor U2AF 65 kDa subunit OS=Caenorhabdi... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3X1A45.662e-14255.16U2 snRNP auxiliary factor large subunit OS=Hydatig... [more]
A0A068Y9C96.043e-14255.16U2 snRNP auxiliary factor large subunit OS=Echinoc... [more]
U6J5906.043e-14255.16U2 snRNP auxiliary factor large subunit OS=Echinoc... [more]
A0A0R3TPX58.371e-14254.91U2 snRNP auxiliary factor large subunit OS=Rodento... [more]
A0A0R3SJW28.554e-14254.91U2 snRNP auxiliary factor large subunit OS=Hymenol... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2a9.302e-13650.77splicing factor U2AF 65 kDa subunit-like [Source:N... [more]
u2af2b1.047e-13551.44splicing factor U2AF 65 kDa subunit [Source:NCBI g... [more]
u2af2b1.843e-13551.44splicing factor U2AF 65 kDa subunit [Source:NCBI g... [more]
uhmk11.911e-1943.56U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
uhmk12.073e-1943.56U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2a1.689e-13553.81U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
RBM394.061e-1524.27RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
RBM396.463e-1221.99RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
rbm347.371e-1121.88RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-... [more]
HNRNPA2B12.329e-1024.55heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RNA159.697e-933.33Component of the cleavage and polyadenylation fact... [more]
NOP135.003e-823.15Nucleolar protein found in preribosomal complexes;... [more]
PUB15.559e-724.48Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
HRP11.023e-621.88Subunit of cleavage factor I; cleavage factor I is... [more]
PAB11.949e-623.38Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483296.018e-11754.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339267.356e-1524.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463068.249e-1441.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253469.152e-1136.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO399859.933e-1036.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2a8.277e-12751.31U2 small nuclear RNA auxiliary factor 2 [Source:NC... [more]
u2af2a1.424e-12651.31U2 small nuclear RNA auxiliary factor 2 [Source:NC... [more]
uhmk14.563e-2145.54U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
uhmk15.200e-2146.46U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
rbm39b7.287e-1322.94RNA-binding protein 39 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018652.10.000e+099.79SMESG000018652.1[more]
SMESG000018647.10.000e+099.79SMESG000018647.1[more]
SMESG000078029.10.000e+073.66SMESG000078029.1[more]
SMESG000051274.16.297e-13454.48SMESG000051274.1[more]
SMESG000003347.11.660e-1626.33SMESG000003347.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007734 ID=SMED30007734|Name=U2 snRNP auxiliary factor large subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1487bp
TATATAAATCTTATATGAAATGTCAGTTGAATACTCAAATCAGATGGATA
AAGTCAAAGAAGAAATGTCTATTAAACGTGAGCCAAATTATGATGAGCCT
AAAGATAAGCGAGATAGACAACCTCGTAGAAGTCAGGAAAAGTCGGAGAG
TAGAAGTCGTCATCGATCTCGAAGTCATAAGCGCAAAAGATCAAATTCAC
ACGAGCATAAATCATCTAGAAGACGCCGTAGTAGAGATAGACGGTCAAGG
AGTCATGAAAGACGTAGAAGGTCAACGTCACCTAATCCATTACTTGAATT
AAAAAAAAATTATAAATATTGGGATGTAGCTCCAACAGGTTATGAAAATA
TGTCAGCTGCTGAATTTAAGCAAATACATTCTGGTGGACAGGTTCTTCCT
TCTTTGTATTTAACCGAAGGGAATGTGGTAAATATGGGGTTGACTGCGTC
AGAATATCCTTCCATTGGTAACACTGTTAGTAGACAGGCAAGGCGTATAT
ATGTTGGTAATCTCCCACTTGGTGTTACAGAGGAAGGAATGATGGAGTTC
TTTAACGAACAGATAAAATTGAAAGAATTAACACAGGCGGATGGTGATCC
AATTATAGCTGTTCAGATTAATACAGATAAAAATTTTGCTTTTTTGGAAT
TTAGGTCAGTTGAAGAAACAAATCAAGGACTAAATCTCGATGGAATAGTT
TATCATGGATTTGCATTAAAATTGAGACGACCACGAGACTATGTTCCTTT
GCCACAAGCATTTGATGGTATTGTATCAAATTCAATGACTGCAGGAATTG
TTCAAGATACCCCACATAAGTTATTTGTCGGTGGTTTACCACAATACCTT
GGAGAAGATCAGGTTAAAGAATTATTGCAAACTTTTGGGCCTCTTAGAGG
ATTTAATCTTGTTAAAGATTCTACAACTGGTTTATCCAAAGGATATGCAT
TTTGTGAATATGCCGATCATTCTGTTACAGATAAAGCTTGTATGGGTCTT
ACTGGTATGCAGCTTGGGGAAAAACGGATTGTTGTGCAACGGGCTTGTCT
AGGAGCCAAAAATGCCAGTGGAATTCCTACAGGACCGCTAATGTTAACGC
AACCCATGATGATGGATCCCACAAAAATTTCCAATGTTGAAGAAACCGAA
GTATTATGTCTTCACAACATGGTGATGATTGATGACCTTAGAGACGATGA
AGAATATGAGGAAATAATGGAAGACGTAAAGGAAGAATGTTCTAAATTTG
GTACCGTGTTAAGTGTACAAATCCCACGGCCAACCGGAGCTGATGATAAT
GTTAGCGGAGTCGGTAAAATATTTGTGGAGTTTTATAATAAATCCGAAAC
AGTTAAAGCGATGAAAGCCTTATCGGGCAGAACATTTAGTGGAAAAGTCG
TTGTAACATCTTTTTATGACCTTGAAAAATATAGAAACGGATTTTTTTAA
AAATAATAAATGTTATAAATTTTTATTTGGTTATTTA
back to top

protein sequence of SMED30007734-orf-1

>SMED30007734-orf-1 ID=SMED30007734-orf-1|Name=SMED30007734-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MSVEYSNQMDKVKEEMSIKREPNYDEPKDKRDRQPRRSQEKSESRSRHRS
RSHKRKRSNSHEHKSSRRRRSRDRRSRSHERRRRSTSPNPLLELKKNYKY
WDVAPTGYENMSAAEFKQIHSGGQVLPSLYLTEGNVVNMGLTASEYPSIG
NTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQI
NTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFDG
IVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKD
STTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNAS
GIPTGPLMLTQPMMMDPTKISNVEETEVLCLHNMVMIDDLRDDEEYEEIM
EDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKA
LSGRTFSGKVVVTSFYDLEKYRNGFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008380RNA splicing
GO:0006397mRNA processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006529U2AF_lg
IPR035979RBD_domain_sf
IPR003954RRM_dom_euk
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 160..237
e-value: 1.1E-7
score: 41.6
coord: 268..341
e-value: 1.2E-18
score: 78.0
coord: 385..465
e-value: 0.0077
score: 25.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 402..462
e-value: 3.0E-6
score: 27.0
coord: 161..234
e-value: 8.0E-5
score: 22.4
coord: 269..338
e-value: 1.5E-15
score: 56.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 159..241
score: 13.089
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 267..345
score: 14.453
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 384..469
score: 10.906
IPR003954RNA recognition motif domain, eukaryoteSMARTSM00361rrm2_1coord: 385..465
e-value: 0.0064
score: 25.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 374..477
e-value: 3.7E-31
score: 109.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 245..318
e-value: 1.2E-55
score: 189.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 159..340
e-value: 1.2E-55
score: 189.9
IPR006529U2 snRNP auxilliary factor, large subunit, splicing factorTIGRFAMTIGR01642TIGR01642coord: 19..475
e-value: 6.9E-139
score: 461.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..83
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 8..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..92
NoneNo IPR availablePANTHERPTHR23139RNA-BINDING PROTEINcoord: 27..474
NoneNo IPR availablePANTHERPTHR23139:SF9SPLICING FACTOR U2AF 65 KDA SUBUNITcoord: 27..474
NoneNo IPR availableCDDcd12231RRM2_U2AF65coord: 267..343
e-value: 7.54487E-44
score: 146.992
NoneNo IPR availableCDDcd12230RRM1_U2AF65coord: 158..239
e-value: 3.39732E-40
score: 137.287
NoneNo IPR availableCDDcd12232RRM3_U2AF65coord: 377..465
e-value: 1.00871E-41
score: 141.539
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 159..241
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 266..469