Protocadherin gamma-B5

Overview
NameProtocadherin gamma-B5
Smed IDSMED30007727
Length (bp)3898
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin gamma-B5 (SMED30007727) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin gamma-B5 (SMED30007727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin gamma-B5 (SMED30007727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin gamma-B5 (SMED30007727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007727SMESG000036217.1 SmedASXL_007510SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007727SMESG000036217.1 SmedASXL_012077SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007727SMESG000036217.1 dd_Smed_v6_19816_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30007727SMESG000036217.1 OX_Smed_1.0.08920ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 273.092 bits (697), Expect = 3.594e-75
Identity = 235/856 (27.45%), Postives = 396/856 (46.26%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +L  +   +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   72 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAGK----PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 872          
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 273.092 bits (697), Expect = 3.655e-75
Identity = 235/856 (27.45%), Postives = 396/856 (46.26%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +L  +   +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   72 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAGK----PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 872          
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 273.092 bits (697), Expect = 3.904e-75
Identity = 235/856 (27.45%), Postives = 396/856 (46.26%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +L  +   +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   61 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAGK----PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 861          
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 273.092 bits (697), Expect = 3.904e-75
Identity = 235/856 (27.45%), Postives = 396/856 (46.26%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +L  +   +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   61 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAGK----PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 861          
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 272.707 bits (696), Expect = 3.909e-74
Identity = 234/855 (27.37%), Postives = 394/855 (46.08%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN--DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +      +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   72 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 872          
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 166.392 bits (420), Expect = 6.121e-41
Identity = 220/809 (27.19%), Postives = 350/809 (43.26%), Query Frame = 3
Query:  423 KENKY-FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDR-KIYLPQAIDNDVTE-----KNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVE--------------VNGKICCYEP--------------DGMNNLQPFTFHPD-----PSIT-------------QESNIFE---------IKSRITFDREEFLNNERIHPIRTAL----------LICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGY-FDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYL-LSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEI-KVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            ++N Y F+++   GTI T S +D E I      N  A + T    ++V                 DEND  P    +F T     + +L +   +  P  I + + E     +N  + Y +       F +N  S TG   ++ L  LD E  S H +++EA + G+    +   I   V D NDN P F  S+Y I I EN+ + + I +I A D DK A L Y L+++ ++ I     V   GWI +   ++ E ++   F V+V DG  ++   + I V D ND  P I+   S + + +   S   +  I + D D  +               NG+I    P               G      + FHP      P                QE  +F+         I SR + D  E   +  I   +++L           I +  +  N    TIT   ++ I D+NDN P F + +Y     EN+     I  V+A D D  ++SR+ Y+I+  ++N   + + SG I +++  DRE    Y + ++A D G P       V +T+ D +DN P+   S  F VE   +V +G P+  L A D D  E+   RF+L    +G  F +  N G ++   S D EK+  Y ++++++D     +   +V+    + DVNDN+P F +P YL +S +N A               EI GQ      A D+D++ NGKI YS+  P     YF+I+   G + +  Q L +  +    + V A+D+GVP L   K +L +L D
Sbjct: 1592 QDNDYNFTISPFDGTIFTNSPLDFENI-KTYRFNITAGKSTSQVIIHV----------------TDENDEAP----RFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVN--STTGD--ILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVA-TGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCS-DHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTIT-KATIKIVDINDNSPRFDQQLYRFNVTENSGPKL-IGHVIARDID--RSSRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF--SRIFHVEVPEDVRIGEPVIQLSASDAD--EHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVN----VKDVNDNAPIFEKPEYLFISEENSA---------------EI-GQ----FHASDMDSENNGKIRYSVTSP-----YFKIEPSTGVLSRFRQQLPQPLMS---LKVTATDHGVPRLQ--KTVLAHLVD 2331          

HSP 2 Score: 84.3445 bits (207), Expect = 6.352e-16
Identity = 83/333 (24.92%), Postives = 155/333 (46.55%), Query Frame = 3
Query:  405 LRYKF-SKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNE--EEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKI 1385
            +RY   S+ + +  + + +G + TKS++D EE  +     C             +D      I        D NDN P F    ++F     S   L+          I  D+ +++ ++ YE+   +   EF    + +++G+  +  +++LD E++S + +I+EA ++G   ++    +   VLD +DN P F++  + + +PE+  +   + ++ A D D+ +   + LD   +    R+   +  G + +N  LD+E  Q +   V++ DG +   T++ + V D+ND  P I   P  L I E   +   +GQ   SD DS E NGKI
Sbjct: 1975 IRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSE-----CLV----FIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLI-------GHVIARDI-DRSSRVFYEIVGGDANHEF----MVTESGQ--IESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIPFRV--DENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVNDNAP-IFEKPEYLFISEE--NSAEIGQFHASDMDS-ENNGKI 2277          

HSP 3 Score: 68.5514 bits (166), Expect = 4.286e-11
Identity = 51/178 (28.65%), Postives = 91/178 (51.12%), Query Frame = 3
Query: 1581 NAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLIS---SSDFSVEENRNVSLGPIGYLKAKDDDI-AENGEIRFDLMWPH 2087
            N   T T  ++++++ +N + P+    I  I  +EN  I     ++ A D+D G +  ++Y IL  +D     F +DS SG + ++K FD E+   Y    +A+D G PS  T     I I D NDN P+  S   ++  S + N  V++     ++A D+D+  +N ++++ L+  H
Sbjct:  610 NRNTTQTSIITLIVKPLNQHSPIC--QITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAI-----VQANDNDVDVKNQKLQYHLLNYH 780          

HSP 4 Score: 58.9214 bits (141), Expect = 2.999e-8
Identity = 41/119 (34.45%), Postives = 59/119 (49.58%), Query Frame = 3
Query: 1626 DVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRI-TYDILES-------NDFKIDSVSGWI--NAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPP 1952
            DVNDN P+F   +  +   E   I   +    ATD DEG+N  I  Y++++S       + F I    G++        DRE  D Y + + A D G P L+++  +NI I D NDNPP
Sbjct:  109 DVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPP 227          

HSP 5 Score: 55.0694 bits (131), Expect = 4.146e-7
Identity = 67/249 (26.91%), Postives = 109/249 (43.78%), Query Frame = 3
Query: 1902 TTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYL----KAKDDDIAENGEI-RFDLMWPHKGYFDITP------NGTIYAKVS--FDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLG-VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL 2606
            + + + I + D NDN P         V+        PIG+      A D D  +NG I +++L+        ++P      +G ++ +V+   DRE  D Y MRL   D G   +  +  HL I ILD+NDN P F                      + L+   +P   L ++ A DLD+++N  ++Y + +P G     F I  +   I V+Q  +   +      V A D+GVPPLS    +++N+
Sbjct:   99 SIIHILIDVLDVNDNSPIF----PIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVP-ELSSSCHLNILILDINDNPPNF------------------GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRI-LPSGPTSEMFSISDEN--ILVTQNNTEC-LQRCEFVVEARDSGVPPLSTTLNIVVNM 320          

HSP 6 Score: 54.299 bits (129), Expect = 7.728e-7
Identity = 71/298 (23.83%), Postives = 125/298 (41.95%), Query Frame = 3
Query: 1782 DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS--DFSVEENRNVSLGP--IGYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSP 2660
            +F I    G I      D E +  Y   I A         +T +V I + D ND  P+ I+    +  V E  +    P  IG   A+D D  +NG + + ++  +   F + +  G I + +  DRE+   + + +   D G  +   T   + I + D+NDN+P+F    Y                 I++S     G  ++ I A D   DK+ ++ YSL+    +   F I+   G I V+  ++R +   +R  V  +D        +++ + +  D  P +N+ + SDI  P
Sbjct: 1597 NFTISPFDGTIFTNSPLDFENIKTYRFNITAG-------KSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATS-KILIHVGDINDNTPEFELSSYF----------------IKISENSKIGSKIIRILATD--KDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMIND-RNSDIFVP 1867          
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 161.77 bits (408), Expect = 1.374e-39
Identity = 170/627 (27.11%), Postives = 281/627 (44.82%), Query Frame = 3
Query:  792 LNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEA--IDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG-LDYE-IDQMHLFVVEVFDGVYAASTTICIKVT--DINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERI----HPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYF---DITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL---SDIKVLLINLADIPP 2621
              +D+ +G+  + + K++D E    H + + A+        +   +   VLD  DN P F + +Y   I E+ P+ T +  + A  +D  +   + Y L        + L  +  +  +I     LD E +  + L V+    G     +T  +++T  D+ND  P    +   +TI EN+     +  +K +D D    NGK+                    S+   S I  +   I +   E    ERI     PI TA++   DG       L+ T  L++ + D+ND+ P    +   I   EN  I   + +V A D+D G N  I Y +  S DF ID  SG I   K+ DRE    Y + + A+D G PSLNT+  + + + D NDN P      +++V  +  +  G  I  LKA D+D  E+ +I + +    +  F   DI   G I + VS + +++D   +R+ IS   +   Q   V + + I DVN ++P F + P+     ++  P ++P            G  ++T+KA D D   N +I YS+       ++F ID   G+I VS  L R D  ++ + V ASD+  PPL   + I+V+L ++ D  P
Sbjct:  213 FTLDTMSGE--IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG---KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED-FGTNGKV------------------HYSMASSSGIGGLT--IDYSTGEVTLRERIDAKNSPI-TAVIRAKDGA---QPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILS-VSGELKRQDHK-VRVEISATDQGGLQGRCV-VNVFIDDVN-SAPYFNDHPF-----SVKIPEHSPI-----------GYPVITLKAEDHDRGDNARIVYSID----SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP 782          

HSP 2 Score: 155.606 bits (392), Expect = 1.046e-37
Identity = 196/758 (25.86%), Postives = 315/758 (41.56%), Query Frame = 3
Query:  420 SKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRD-----RKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN-----------DFKIDSVSGWINAMKIFDREEMDHYV-VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP--RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            S+    F+L   SG I    ++D E +          D+  +  T     + +  A  T V    D  DN P+F       ++S    +R+       +    A D D  E N +I Y L +   +   L I++K+G   +     LD E+ S   + + A ++G  +++S  +++  V+D NDN P F   +Y +TI EN  +   I  ++A D D     ++ Y + +S    I  L +    G + L   +D +   +   V+   DG   A ++   + I V DIND  P +      +T++EN+  G  VG++   D DS             G N +  ++         + +   IK+    DRE           R +L + +   GT    L  + T++V+++D+NDN P F +  YN+   E     + I  + A D DE Q  +ITY I E++              I SVSG        + +  DH V V I A D G   L     VN+ I D N  P    +   FSV+   +  +G P+  LKA+D D  +N  I + +      +F I P+ G I      DRE    + + +  SD+       T   + + + D+NDNSPQF    Y          T +   P+        G   + + AID D   NG + Y L      P  + F +DR  G ++VS  L R       + + A D G P LS    + + L+D+
Sbjct:  207 SRSQNLFTLDTMSGEIRLAKSMDREVL----------DKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIF------EKDSYFGEIREDAPIGTTVLSVFARDLDSGE-NGEIEYSLGEGNGKNL-LAINAKSG--VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS--GIGGLTIDYSTGEVTLRERIDAKNSPITA-VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS-------------GPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRET--------TARYSLKVTARDMGT--PSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSG--------ELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSY--------AATISEDIPV--------GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDV 885          

HSP 3 Score: 145.976 bits (367), Expect = 1.050e-34
Identity = 156/548 (28.47%), Postives = 251/548 (45.80%), Query Frame = 3
Query:  957 NEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQE-EGWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKI--CCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF-SVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL-KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            N   F Q  YV  +PE+TP+ T I  ++A     +  L Y +        + LF +    G I L + +D E+   H+  V  ++ V    +ASTT+ + V D+ D +P    +     I+E+   GT V  +   D DS E NG+I     E +G N L         +I  +S + +  +         L+ E +  IR  L + +   GT   + T    ++V+  DVNDN PVF    YN+  +EN  I A I  V ATD+D G N ++ Y +  S+      ID  +G +   +  D +      V I+A+D   P+L++TV + I + D ND+ P LI++    ++EE  NV++G  +G + A D+D   NG I++ +        D   +G I      DRE   RY +++   D G  +   T   + + + D+NDN+P F +  Y     N+      P            G  ++T+KA+D D D+  KI+Y + +    V    +I   G  + VS  L R D    R+ + A+D G
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHA-SSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGE-NGEIEYSLGEGNGKNLL---------AINAKSGVIQTAAP--------LDRETLSLIR--LDVIASDKGTPKRESTAMVEITVV--DVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE--NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID-EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLN-TSTTIAVVLKDINDNAPTFDKKEY-----NVTISEEMPR-----------GSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG 661          

HSP 4 Score: 140.969 bits (354), Expect = 3.076e-33
Identity = 182/728 (25.00%), Postives = 306/728 (42.03%), Query Frame = 3
Query:  402 QLRYKFSKENK--YFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLP------QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYA--ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLK--AKDDDIAENGEIRFDL----MWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGV-PRYFEIDRDGGEIKVSQTLSRSD 2522
            ++ Y   + N     ++  KSG I T + +D E +         +D+ T         E++ +  IT V    D NDN PVF            N+     I +P      +A D D    N K+ Y +  +      L ID  TG+  V + + +DA++ S  T ++ A +       S + +   V+D ND+ P    +  +IT+ EN  +   + ++ AID D      + Y ++ S    I      ++ G I   + LD E    +   V   D G  +   STTI + + DIND  P        +TI E +  G+ +  +K  D D                   Q  T+  + +  +  +I +I  +            + H +R  +        T+   L     ++V I+DVN + P F +  +++   E++ I   +  + A D D G N+RI Y I  S  F+ID  SG I+     DRE+   + V + A DH +P LNT+ ++ + + D NDN PQ  SSS ++   + ++ +G   +L+  A D DI  NG + + L      P    F +   +GT+      DRE+     + +   D G  +       + + + DVNDN+P F +  Y L          A  +P+        G  + TI A D D   N  IS+  +I  G   + F+I+ D  +  V + L+R++
Sbjct:  304 EIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPK------RESTAMVEITVV----DVNDNAPVFA-------SDSYNVTILENITIPAVIATVKATDEDFG-TNGKVHYSM-ASSSGIGGLTIDYSTGE--VTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID-----EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND-----------------EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEI------SATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-YAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAPTFEQLSYDL--------YIAENSPV--------GSTVGTIVARDADEGDNADISF--RIFGGADAKLFDIEEDAEQNGVVRILTRAE 959          

HSP 5 Score: 134.806 bits (338), Expect = 2.341e-31
Identity = 140/548 (25.55%), Postives = 245/548 (44.71%), Query Frame = 3
Query:  714 AIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG-LDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLIS-SSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITP----NGT--IYAKVSFDRE-KEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSR-DNI 2306
            AID D +  N  I Y + +  E+F    ID  +G   +   K LD E+ + +++ + A + G     +   I   + D NDN P F++  Y +TI E  P  + I  ++A+D D+  +++YR++ + +  +  +  + ++G I+   G L  +  ++ + +     G       + + + D+N   P  + +P  + I E+   G  V  +K  D D  + N +I       +++ Q F   P       S+  + + R TF                ++++ +  H +    L  +  + V+++D+NDN P FT S Y     E+  +     QV A D D G N  + Y + ES+       F++D  SG +      DRE+    V+ I A+D G PSL+   ++ +T+ D NDN P     S D  + EN  V    +G + A+D D  +N +I F +        FDI      NG   I  +  FD E K +++   L+ S     +     +H    + DVNDN P   +   L++R DN+
Sbjct:  503 AIDED-SGPNGIIKYSM-EGSEDFI---IDEDSG--LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD-NARIV----YSIDSSQFFRIDPSSGDISVSSDLDREDRATF----------------SVIVTASDHAS--PPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVG-STVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIH----VSDVNDNKPALKDFVILMNRFDNV 1013          

HSP 6 Score: 119.013 bits (297), Expect = 1.615e-26
Identity = 149/561 (26.56%), Postives = 243/561 (43.32%), Query Frame = 3
Query:  414 KFSKENKY-FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY--EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIK---AQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENR--NVSLG-PIGYLKAKDDD 2042
            K+S E    F + E SG I T   +D E             + ++  T       S     T   + +D NDN P F  K      SE  + R  +I   +A+DND   +++KI Y + + + E F + +D       + V   L    + +H V +E         + + V+   + D N + P+FN   + + IPE++P+   +  ++A D D+   AR+ Y +D+S      + F +    G I ++  LD E       +V   D        ST I + + DIND +P    +    TI E++  GT   Q+   D D +  NG +  +  E     ++Q F       + + S    + S++  DRE+F        I   +     G  + +A   IT TLS    DVNDN P F +  Y+++  EN+ + + +  ++A D DEG N+ I++ I    D   F I+  +     ++I  R E D+     K        +  L++TV V I + D NDN P L    DF +  NR  NV +   IG++ A D D
Sbjct:  515 KYSMEGSEDFIIDEDSGLIKTTKLLDRE----------TTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISE-EMPRGSQIITLKAVDND---EDQKITYRIEEADREVFSI-LDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDAD-IGPNGIVDYFLNESSSSPSIQLF------RLDRTSGTLRVSSKL--DREQFA------VIVLPIFARDRGTPSLSAASEITLTLS----DVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL---KDFVILMNRFDNVQMARQIGFIPAFDPD 1028          

HSP 7 Score: 91.6633 bits (226), Expect = 3.228e-18
Identity = 111/407 (27.27%), Postives = 181/407 (44.47%), Query Frame = 3
Query:  600 VFLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-----VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDF 1787
            V +F D+ ++ P F   PF  K    S I       +   +A D+D  + N +I+Y +  +  +FFR  ID  +G   + V  +LD E ++  +VI+ A +       +   I+  + D NDN P F  S+Y  TI E+ P+ T+  ++ AID D      + Y L+ S      +LF L +  G + ++  LD E  Q  + V+ +F         +A++ I + ++D+ND  P        L I EN   G+ VG I   D D  + N  I  +   G  + + F    D    +++ +  I +R  FD E   N           L  S G      QL+ T  + + + DVNDN+P   + +  +   +N  +   I  + A D D  QN+ + Y  LE ND 
Sbjct:  669 VNVFIDDVNSAPYFNDHPFSVKIPEHSPIGY----PVITLKAEDHDRGD-NARIVYSI--DSSQFFR--IDPSSGD--ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE--QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADIS-FRIFGGADAKLFDIEED---AEQNGVVRILTRAEFDYEAKANKFFFE------LQASSG------QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY-FLEENDL 1042          

HSP 8 Score: 88.9669 bits (219), Expect = 1.997e-17
Identity = 91/320 (28.44%), Postives = 142/320 (44.38%), Query Frame = 3
Query: 1707 IHQVLATDKDEGQNSRITY-------DILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFS-VEENRNVSLGPIGY----LKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVI--ASDNGVPPLSDIKVLLINLADI 2615
            I  ++A+ K    +S+  Y       D    N F +D++SG I   K  DRE +D +++ + A +  +P+++ +  V + + D  DN P     S F  + E+      PIG     + A+D D  ENGEI + L   + K    I   +G I      DRE      + +  SD G   K+E+   + I ++DVNDN+P F    Y ++  +NI  P                  ++ T+KA D D   NGK+ YS+    G+     ID   GE+ + +   R D  +  I  +  A D   P LS    L IN+ DI
Sbjct:  180 IETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRED-----APIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTP-KRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPA-----------------VIATVKATDEDFGTNGKVHYSMASSSGIGG-LTIDYSTGEVTLRE---RIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDI 472          
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 144.05 bits (362), Expect = 3.666e-34
Identity = 157/585 (26.84%), Postives = 246/585 (42.05%), Query Frame = 3
Query:  924 VIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES-----------NDFKIDSVSGWINAMKIFDREEMDHYV-VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP--RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            +++  V+D NDN P F   +Y +TI EN  +   I  ++A D D     ++ Y + +S    I  L +    G + L   +D +   +   V+   DG   A ++   + I V DIND  P +      +T++EN+  G  VG++   D DS             G N +  ++         + +   IK+    DRE           R +L + +   GT    L  + T++V+++D+NDN P F +  YN+   E     + I  + A D DE Q  +ITY I E+           +   I SVSG        + +  DH V V I A D G   L     VN+ I D N  P    +   FSV+   +  +G P+  LKA+D D  +N  I + +      +F I P +G I      DRE    + + +  SD+       T   + + + D+NDNSPQF    Y          T +   P+        G   + + AID D   NG + Y L      P  + F +DR  G ++VS  L R       + + A D G P LS    + + L+D+
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS--GIGGLTIDYSTGEVTLRERIDAKNSPITA-VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS-------------GPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRET--------TARYSLKVTARDMGT--PSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSG--------ELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSY--------AATISEDIPV--------GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDV 526          

HSP 2 Score: 138.272 bits (347), Expect = 2.154e-32
Identity = 167/655 (25.50%), Postives = 278/655 (42.44%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLP------QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYA--ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLK--AKDDDIAENGEIRFDL----MWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGV-PRYFEIDRDGGEIKVSQTLSRSD 2522
            D NDN PVF            N+     I +P      +A D D    N K+ Y +  +      L ID  TG+  V + + +DA++ S  T ++ A +       S + +   V+D ND+ P    +  +IT+ EN  +   + ++ AID D      + Y ++ S    I      ++ G I   + LD E    +   V   D G  +   STTI + + DIND  P        +TI E +  G+ +  +K  D D                   Q  T+  + +  +  +I +I  +            + H +R  +        T+   L     ++V I+DVN + P F +  +++   E++ I   +  + A D D G N+RI Y I  S  F+ID  SG I+     DRE+   + V + A DH +P LNT+ ++ + + D NDN PQ  SSS ++   + ++ +G   +L+  A D DI  NG + + L      P    F +   +GT+      DRE+     + +   D G  +       + + + DVNDN+P F +  Y L          A  +P+        G  + TI A D D   N  IS+  +I  G   + F+I+ D  +  V + L+R++
Sbjct:    8 DVNDNAPVFA-------SDSYNVTILENITIPAVIATVKATDEDFG-TNGKVHYSM-ASSSGIGGLTIDYSTGE--VTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID-----EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND-----------------EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEI------SATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-YAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAPTFEQLSYDLYI--------AENSPV--------GSTVGTIVARDADEGDNADISF--RIFGGADAKLFDIEEDAEQNGVVRILTRAE 600          

HSP 3 Score: 137.887 bits (346), Expect = 2.873e-32
Identity = 139/472 (29.45%), Postives = 217/472 (45.97%), Query Frame = 3
Query: 1239 IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERI----HPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYF---DITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL---SDIKVLLINLADIPP 2621
            I V D+ND  P    +   +TI EN+     +  +K +D D    NGK+                    S+   S I  +   I +   E    ERI     PI TA++   DG       L+ T  L++ + D+ND+ P    +   I   EN  I   + +V A D+D G N  I Y +  S DF ID  SG I   K+ DRE    Y + + A+D G PSLNT+  + + + D NDN P      +++V  +  +  G  I  LKA D+D  E+ +I + +    +  F   DI   G I + VS + +++D   +R+ IS   +   Q   V + + I DVN ++P F + P+     ++  P ++P            G  ++T+KA D D   N +I YS+       ++F ID   G+I VS  L R D  ++ + V ASD+  PPL   + I+V+L ++ D  P
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED-FGTNGKV------------------HYSMASSSGIGGLT--IDYSTGEVTLRERIDAKNSPI-TAVIRAKDGA---QPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILS-VSGELKRQDHK-VRVEISATDQGGLQGRCV-VNVFIDDVN-SAPYFNDHPF-----SVKIPEHSPI-----------GYPVITLKAEDHDRGDNARIVYSID----SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP 423          

HSP 4 Score: 134.42 bits (337), Expect = 3.180e-31
Identity = 142/548 (25.91%), Postives = 245/548 (44.71%), Query Frame = 3
Query:  714 AIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG-LDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLIS-SSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDI----TPNGT--IYAKVSFDRE-KEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSR-DNI 2306
            AID D +  N  I Y + +  E+F    ID  +G   +   K LD E+ + +++ + A + G     +   I   + D NDN P F++  Y +TI E  P  + I  ++A+D D+  +++YR++ + +  +  +  + ++G I+   G L  +  ++ + +     G       + + + D+N   P  + +P  + I E+   G  V  +K  D D  + N +I  Y  D   + Q F   P       S+  + + R TF                ++++ +  H +    L  +  + V+++D+NDN P FT S Y     E+  +     QV A D D G N  + Y + ES+       F++D  SG +      DRE+    V+ I A+D G PSL+   ++ +T+ D NDN P     S D  + EN  V    +G + A+D D  +N +I F +        FDI      NG   I  +  FD E K +++   L+ S     +     +H    + DVNDN P   +   L++R DN+
Sbjct:  144 AIDED-SGPNGIIKYSM-EGSEDFI---IDEDSG--LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD-NARI-VYSID---SSQFFRIDPSSGDISVSSDLDREDRATF----------------SVIVTASDHAS--PPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVG-STVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIH----VSDVNDNKPALKDFVILMNRFDNV 654          

HSP 5 Score: 91.2781 bits (225), Expect = 4.946e-18
Identity = 111/407 (27.27%), Postives = 181/407 (44.47%), Query Frame = 3
Query:  600 VFLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-----VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDF 1787
            V +F D+ ++ P F   PF  K    S I       +   +A D+D  + N +I+Y +  +  +FFR  ID  +G   + V  +LD E ++  +VI+ A +       +   I+  + D NDN P F  S+Y  TI E+ P+ T+  ++ AID D      + Y L+ S      +LF L +  G + ++  LD E  Q  + V+ +F         +A++ I + ++D+ND  P        L I EN   G+ VG I   D D  + N  I  +   G  + + F    D    +++ +  I +R  FD E   N           L  S G      QL+ T  + + + DVNDN+P   + +  +   +N  +   I  + A D D  QN+ + Y  LE ND 
Sbjct:  310 VNVFIDDVNSAPYFNDHPFSVKIPEHSPIGY----PVITLKAEDHDRGD-NARIVYSI--DSSQFFR--IDPSSGD--ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE--QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADIS-FRIFGGADAKLFDIEED---AEQNGVVRILTRAEFDYEAKANKFFFE------LQASSG------QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY-FLEENDL 683          
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 134.035 bits (336), Expect = 4.655e-31
Identity = 162/622 (26.05%), Postives = 266/622 (42.77%), Query Frame = 3
Query:  741 NRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYR-LDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIK--ENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE--FLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI-GYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            +++I Y L QN++E   L +D+ +G   V + K  D E Q ++   + A N   +   S I I+ +  D NDN P F  + Y +T+ E       +  + A D D      +SY  L  S   +I  +      G +   + L     + HL V     G  ++  +  I +T I+ +T     + SK  I+  E+++ G  +G +    +       K   Y  D  +N          SI +++    +   +  D  +   LN +   P            G +N    + F     IED NDN P F+ S+  I   E+  +H   + V A+DKD+ +N  + Y I+ S   +  +ID  +G ++   + D E   +Y + +KA D G P  ++ + + I + D NDN P+    S +++E   N     I G + A+D D  ENG+I + +    + YF I    G +Y K S DRE      + +   D G   +  T     I +LDVNDN      PP  LS   I  P  +P +             + TI A+D D   NG + Y  ++         + +  G++ + + L+ SD    R+ VI SD GVP
Sbjct:  572 SKRIRYSL-QNQDE--HLTVDTMSGT--VCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPV-----TGEVFAQKPLAR--GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK------VKYSIYSGDQDHNF---------SIDEDTGKIYVTRYLDADVHDTVLLNIQATLP-----------SGESNQTQVVIF-----IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF-EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE-YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSST-ASARISVLDVNDN------PPSCLSITPIVVPAGSPLS-----------TAIGTIVAMDPDKGLNGSVLYRAQL----QSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 2 Score: 130.183 bits (326), Expect = 6.789e-30
Identity = 164/627 (26.16%), Postives = 271/627 (43.22%), Query Frame = 3
Query:  792 LNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT-ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFD--REEFLNNERIHPIRTALLICSDGHGT---NNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGY-FDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PP 2621
            ++ID +TG+ FV     +D    S     + A + G     + + +  ++LD     P F ++ + + IPE+TP+ T + K+ A +     + R+ Y L N  +     L +    G + + +  D+E  + +   V   +     ST+ I I++ D+ND  P  + N   LT++E       +  +  SD DS                     ++H    I  ES+ F I   +T +   ++ L   R H + +A     DG G    N+A + IT      + D +   P F+ S Y I   E+      I  V       G  S++ Y I    + ++F ID  +G I   +  D +  D  ++ I+A      S  T  +V I I D NDNPPQ  SS  + S+ E+  +   P   ++A D D  +NGE+R+ ++  H G   +I    G +      D E    Y +R++ +D G   +      L I +LDVNDN+P+F +  Y +         N+P           P  I+  + A D D+ +NG+I Y  +I  G   YF ID   G +   +++ R  I    I ++A D GVPP S      I++ D+   PP
Sbjct:  483 VSIDKETGRIFVP--NTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE----HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDS---------------GTFGEVSYH----ILSESSSFSINP-VTGEVFAQKPLARGRFHLVVSA----KDGGGQSSENSANIHIT------VIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQT--QVVIFIEDHNDNPPQFSSSLVEISIREDLKLH-EPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMT-LFIHVLDVNDNAPEFEKSWYTMEVLE-----NSP-----------PKTIVGKVVARDKDSLENGQIVY--RITNG-SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 3 Score: 125.176 bits (313), Expect = 1.929e-28
Identity = 173/730 (23.70%), Postives = 301/730 (41.23%), Query Frame = 3
Query:  423 KENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPF---VVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDIND--ETPNIHI----NPSKLTIKENLISGTFVGQIKISD--RDSVE--VNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            + +K+  + E+SG I+T + +D E+         K D       V V +    + I+  V   +DENDN P F  +      SE   L      LP   D D  + +      L  N    F+L    K  +     +VV   LD E +  + +++EA + G   K  Q+    E++D NDN P F++S Y  ++  N  + +++  ++A D D  + +R+SY +  +   +    F + + G I     L        + VV    G  + S++  + +T +     +P + I      +   + EN   G+ V ++ I+   RD+    +     C                 P  T +++++ +      DRE        H ++   L+  DG      Q+ I     + I D+NDN P +  S  +I     N        + A D D GQN  I Y +L++    ID  +G I      D          ++A+D G+P+L+T ++V   + D    PPQ    + + VE   +  +G  +  + A +     +  IR+ L    +     T +GT+  + +FD EK+  Y   + I+ N   N + +   + I++ DVNDN P F    Y L+     GP               P + L+ + A D+D+   G++SY +   L     F I+   GE+   + L+R   G + + V A D G
Sbjct:   64 QTSKFLKVDERSGEISTIAHLDYEK-------RSKFD----IVAVKVEESGETIDILVEV---DDENDNAPSFADQVVKLEISEFAQL-GTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKL-ASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS-NSNFAISQSGVITTTASL-LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALC-----------------PQQTDQAHVYLLLLCGILDRE----TASEHHLK--FLLEKDG------QIIIEHPQLLTIGDINDNAPQWHSSQIHISL---NRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQF-EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTV-IATNA--NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVRE--GPK--------------PEEPLLVVSASDMDSGTFGEVSYHI---LSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGG 717          

HSP 4 Score: 117.087 bits (292), Expect = 5.780e-26
Identity = 143/617 (23.18%), Postives = 260/617 (42.14%), Query Frame = 3
Query:  396 STQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEI-DQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKI 2240
            S ++RY    ++++ ++   SGT+  + T D E+            Q +   TV   + NS  +        +D NDN P+F +  + H         +  + +  A D D +    ++ Y +      F   +I+  TG+ F    K L   ++    +++ A + G +  ++   I   V+D +   P F++S Y I   E+      I  + A+   K +  S   D++  +        ++ G I + R LD ++ D + L +        +  T + I + D ND  P    +  +++I+E+L        ++ SD+D  + NG++              + HP  SI  +    ++ +    D E   N +        L + +   G       +T  + VL  DVNDN P F +S Y +  +EN+     + +V+A DKD  +N +I Y I   ++ F ID   G +   +  DRE + H  ++I A+D G P  ++T    I++ D NDNPP  +S +   V     +S   IG + A D D   NG + +         F +  NG +Y +   +   E    + + +SD G   K     H+ ++I
Sbjct:  572 SKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEK------------QKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLVVSASDMD-SGTFGEVSYHILSESSSF---SINPVTGEVFA--QKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSID-------EDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKK-NGEV---------RYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYK--------LRVKATDLGIPPRSSNMTLFIHVL--DVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTA-IGTIVAMDPDKGLNGSVLYRAQL-QSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKS-VVCHVPVRI 1136          

HSP 5 Score: 100.523 bits (249), Expect = 6.911e-21
Identity = 129/498 (25.90%), Postives = 215/498 (43.17%), Query Frame = 3
Query:  969 FNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEI-DQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAH-IHQVLATDKDEGQNSRITYDILE--SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDR--NDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL 2435
            F + TY+ TI E  P    I K++     + A L+Y +   V+  I   F V  EG I  N  LD EI ++  L V+    G     T + ++V ++ND  P+  ++  +  + ENL  G++V  +   D D++         +  G     P  F+    I Q +    + + + F+         + P  T  +  +DG          TFT L++ + D+NDN P F++ +Y                ++ A D D      +TY + +  S+ F++   SG +  MK+      + Y+VT+ A D+G PS +T+V V++ IG+    D P    +   F V EN  + L  IG L  +     E+ E  + +  P     F I   G ++     DRE+   +  ++ I DN     Q+      + +LD NDN P F    Y LS +D++A                  GQ +  I A D D+ +NG++SY +
Sbjct: 1832 FLKQTYLSTIDEGLPRGQFIAKLQP----ELAGLTYSI---VEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSG-QQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQT---PTHFN----IDQFTGTIHLTAPLDFE---------VLPEHTLTIKATDGSFD-------TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGAL-FMKVLP-PAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGL-QIGNLSGE-----ESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEI-DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAH-----------------GQKIGQIMASDQDSGENGRVSYRI 2269          

HSP 6 Score: 96.2857 bits (238), Expect = 1.516e-19
Identity = 163/687 (23.73%), Postives = 278/687 (40.47%), Query Frame = 3
Query:  621 NDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITI-PENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDE---TPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFT--FHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKI--FDREEMDHY-----VVTIKAQDHGNPSLNTT--VKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI-GYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTL-SRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGL 2627
            NDNVP FP   K  R  E NL     +    A D D     R  L      +      NID  TG   + +   LD E    HT+ ++A  +G  +  + + I   V D NDN P F++  Y  T+ P          KIEA D D    L+Y L          +F V  E   +  + L    ++  + V    +GV + ST++ + V     E    P       +  + EN   G  +G +  S  +S E + +I   E   + ++  F   F   P   ++    E +  I     E + ++++         C                  V++ D NDN PVFT   Y +   ++      I Q++A+D+D G+N R++Y IL  ND  I +++    ++++  ++  ++D +      + ++A+DHG+P+      V+V++ +   + + P  +    + V    + S+G +   ++A +     N  + + L   H+G   I    G +  K   D E E    M L +SD    N +   V L I +  V++ +P F +  Y L              PI     E  GQ    ++AID D   +G + YS+          +I+   G I++ + L SR ++   +I V+A  +          L I   D+ P L
Sbjct: 1921 NDNVPSFPMS-KPRRVPE-NLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPT-HFNIDQFTGT--IHLTAPLDFEVLPEHTLTIKA-TDGSFDTFTNLTIF--VSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSS----SIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNL--SGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEID---NEMMTSQKVQ--------CK---------------CHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPV-YEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLK-EHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDG---NGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQ------------IPISTPAGESVGQ----MQAIDEDGGVHGVVKYSIS---DRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSL 2543          

HSP 7 Score: 90.8929 bits (224), Expect = 5.463e-18
Identity = 143/580 (24.66%), Postives = 228/580 (39.31%), Query Frame = 3
Query:  963 PFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRIT---FDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES-----NDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITI-GDRNDNPP----QLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVS-------FDREKEDRYCMRLRISDNGK---ENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGS-YRIHVIASDNGVPPLS-DIKVL--LINLADIPP 2621
            P F Q     T+PE+  + T I  I     +++A   Y +    +   + L + +  G I     LDYE  +    +V V       +  I ++V D ND  P+      KL I E    GT      ++D D  + +          +NN                 +F++ SR        +  +N +     R    +  +               S+ I D NDN PVF+ S Y      N  I +H+  V ATD D G+NSRI+YDI ++     ++F I           +      D  VV   A DHG+PSL+++  V IT+ G    +PP     L+ S+   + EN       +G + A+     +  + +  L+    G   + P  T  A V         DRE    + ++  +  +G+   E+ Q       + I D+NDN+PQ+      +S +   G +                    T+ A D D  +NG I YS+           ID++ G I V  T+   +IGS  +  V A D G P LS D++V+  L++    PP
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISG-KREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYE-KRSKFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNN-----------------VFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVV---ASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENST-----LGSIVARVSIAQQYRDTKLRLI----GSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ------LLTIGDINDNAPQWHSSQIHISLNRTQGGSR-------------------TLTAKDPDLGQNGWIRYSVLD----TELVSIDKETGRIFVPNTID-CNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPP 538          

HSP 8 Score: 80.8777 bits (198), Expect = 6.962e-15
Identity = 114/475 (24.00%), Postives = 205/475 (43.16%), Query Frame = 3
Query:  585 AIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQM----HLFVVEVFDGVYAASTT-----ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE-SNDFKIDSVSGWINAMK-IFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLI 1961
            ++  +V + E E  + P F    F+F+    S+I L           I N   E++R+  Y + Q+ E     +ID K G+ FV     +D E ++ H   +E  NE M  +K Q      VLD NDN P F    Y +++ ++      I +I A D D  +  R+SYR+ +   L I  + L  + G I LN   D ++D+        +VE  D  + A        + +K++  +   P   +   ++ + E+   GT + +I+ S+R  +  +G +   + +    L          I  ++    +K+ + ++ E         PI +  L  SDG+G      +    L +++E V++  PVFT+S Y +    +      + Q+ A D+D G +  + Y I +  +  KI+  +G I   K +  R  +    +T+ A         TTV + I   D   + P+L+
Sbjct: 2113 SVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGL----------QIGNLSGEESREFHYRI-QDPEASKIFSID-KFGRLFVA--GPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNI--VTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLK-EHQGKL---------GIDVKTGELTLKTHLDWESE---------PIISMYLSVSDGNGR-----SAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKLL 2547          

HSP 9 Score: 79.7221 bits (195), Expect = 1.645e-14
Identity = 125/490 (25.51%), Postives = 202/490 (41.22%), Query Frame = 3
Query: 1158 LDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIHIN-PSKLTIKENLISGTFVGQIKISDRDSVEVNGKIC---CYEPDGMNNLQPFTFHPDPSITQESNI--FEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKD-DDIAENGEIRFDLMWPHKG----YFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS 2579
            LD E  Q HL ++ + DG     S T+ + V D ND  P +  + PS+L I E+   G  + + + SD D +  NGK       +  G  +L P T   D  + + S++  ++IK R+       L  E+        L  S+ +    A+  + F     +  +++  P                  A +   LA          +TY I+E N    F +DS  G I      DRE ++ Y + +     G        +V++ + + NDN P    S    V EN  V    +  + AKD D++A    +R+ L+    G    +F+I    GTI+     D E    + + ++ +D   +    T+ +L I + D+NDN+P F +P Y               +P   S    PGQ    I+A DLDA   G ++YSL    G    F +  + G + +       +   Y + V A+DNGVP  S
Sbjct: 1687 LDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMD-IGQNGKFSFELLEDSSGSLDLVPET--GDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEK-------NLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLP-------------RGQFIAKLQPELAG---------LTYSIVEGNIDSAFSVDS-EGVIRTNLELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVG-SYVATVGAKDVDNLAP---LRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD----TFTNLTIFVSDINDNAPTFSKPLY-----------QTTVSPATFS----PGQPFAKIEAHDLDA--RGALTYSLG--QGSSSIFRVAPESGALFMKVLPPAGE--RYLVTVTATDNGVPSFS 2111          

HSP 10 Score: 77.7962 bits (190), Expect = 6.284e-14
Identity = 115/511 (22.50%), Postives = 204/511 (39.92%), Query Frame = 3
Query:  792 LNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD------GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQ-PFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITF---------TLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMWPHKGYFDITP--NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQ 2267
             +ID  TG   + ++  L       + +I+EA+  G     + +++   V D ND+ PF      V+ +P +      ++++ AID DK   + Y L  +     +  F + E+                 +FVVE         G      T+ I+ TD+ D T        K   ++ L+  +   +      D    +  I    P G   LQ  F    D  +   S  FE+KS                   + ++  S    T   + TI           TL + +E V    P  + +   +  +E N       ++LAT   E    R   +   +  F I+S +G I+ + + DRE    +++ I   D G  S N +  V +T+ D+NDN PQL +S+   +E   +  +G + +  +A D DI +NG+  F+L+    G  D+ P     +  ++S        + ++LR+ D+G       YV    K L++++ +PQ
Sbjct: 1376 FSIDQFTGD--ITLIDTLHWHVTPTYNLIVEAFTSG---PGTTLLVTVNVDDVNDHTPFIVSQPTVL-LPSSYRKGGMVHRVVAIDLDKDPEIRYSLKYAGSEVAKEFFKIDEKSG--------------EIFVVESSSALSTSFGGAGLPETLTIRATDLQDLT--------KFDEQKVLLKASNASRSTWHFFDEQHKDVTILSTSPQGSQILQLKFQEGVDLQLIPSSPHFELKS-------------------SKIVQKSASVATGTQRFTIVAQKDDELDYSTLKIHVEPVFTEPPKISSTSCGVVTIEENVGIEDFKRILATGMTEESRFRFQGN---APKFSINSTTGSISVLPL-DREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLS----SLQSWKIKLRVVDHGVPG---LYVE---KNLEISNRNPQ 1823          

HSP 11 Score: 62.3882 bits (150), Expect = 2.565e-9
Identity = 87/368 (23.64%), Postives = 150/368 (40.76%), Query Frame = 3
Query: 1785 FKIDSVSGWINAMKIFDREEMDHY-VVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEI-RFDLMWPH--------------KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP--RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPK---TWQMFGSTNNVLIVVVLSGISAILVVV-------LITVISCMLNPCRNHNSHIF 2804
             K+D  SG I+ +   D E+   + +V +K ++ G      T+ + + + D NDN P   +     +E +    LG    L    D      ++ RF ++  +              +   D+  NG +      DRE  D+Y + +   D GK  K    +   I+I+D NDN+P F    Y  S                +SI    G  L+T++A D D  +N +ISY +K     P    F I + G    ++ T S     ++ + V+ASD+G P LS   V+ I +           GS ++SP     W +  ++ +++    L  I A + +        L  + S  L P +   +H++
Sbjct:   69 LKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE-----TIDILVEVDDENDNAPSF-ADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQL------DREFRDKYELLIEAQDGGKPAKI-GQLRCSIEIIDANDNAPVFSRSRYTAS------------VSANISI----GSHLITVQATDADIGENSRISYDIK-KTSAPSNSNFAISQSG---VITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVL----------GSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVY 393          
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 124.02 bits (310), Expect = 4.583e-28
Identity = 179/720 (24.86%), Postives = 292/720 (40.56%), Query Frame = 3
Query:  546 TCTVNVWDENSFLAIITT-VFLFEDENDNVPVFPFKFKTHRESE-------INLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKE-------KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRL----DNSVKLAIRRLFLVQEEGWIILNRGLDYEI-DQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLT-IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHA---HIHQVLATDKDE--GQNSRITYDILES------NDFKIDSVSGWINAMKIFDRE--EMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN--------GTIYAKVSFDRE---KEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDN 2561
            T T+   D  S +A   T V    D ND VP F     T    E       +     + I   +AID D      ++ Y +    N EE     ID  TG+ F    +  D E    + + +EA +  +          K  + ++  + D NDN P F +  Y+  + E+     ++  I+A D DK + L Y L       +   +R      + G I +   LD+E  DQ HL ++   DG + A+T + I + D+ND  P         T I+E++     +  +  +D D  E + +I  Y  +G    + F       I + S   E+      DR+        + +  A  I  DG+G     L     + V + D+NDN P+F E ++         IH+   +   V A D D+   +N+ I Y I+ +      + F+ID  +G I AM+  DRE      +++ ++A D G PS      V I + D NDN P    +  + SVEE   +    + +     D+ A++    + L      YF +T +        G +  K   D E   + D + + +R+SD    +  E  VH  + ++D ND++P          R+++         P   SI    G+   T      D D      + +       R F ID+D G ++V+ TL R DI  Y + + A DN
Sbjct: 1179 TLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPN--EKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVR-----TDSGTIFVKEPLDFEASDQYHLVLI-ASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRI-VYRLEGQGADEVF------RIGKYSGTIELVK--ALDRDPPAGVPSWNFVVQA--IDDDGNG-----LVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLS-EESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG--RHDAEAAVH--VALVDRNDHAPHIHGATEHRVREDV---------PRGTSI----GRYTAT------DRDAGDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN 1849          

HSP 2 Score: 121.324 bits (303), Expect = 2.964e-27
Identity = 196/801 (24.47%), Postives = 329/801 (41.07%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFL--------AIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRK-------IYLPQAIDNDVTEKNRKILYELHQNEEEFFR-LNIDSKTG----KPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRL-------FLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAA---STTICIKVTDINDETPNIHINPS---KLTIKENLISGTFVGQIK-ISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQ--------VLATDKD-EGQNSRITYDIL------ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSL-------NTTVKVNITIGDRNDNPP-----QLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGY--FDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDAD-KNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSR---SDIGSYRIHVIASD---NGVPPLSDIKVLLINLADIPP 2621
            FS+ E +G +  +  +   ++ +       A+ P +  TV V D+ S          +  T +   ED N+N P FP      + S+I  + +         I   +A D+D +  N  I+Y L+  + E  +   ID +TG     P VV     D E++    V ++A + G +          EV+D NDN P F + +Y  ++     + T++  + A D D    A ++Y L+                  + +  G I L + +  +  +    V+   +G+  A   S  + + V D   + P    +P     +T+ EN+     + + + +S  DS   +         G  N     F         +   E+      D E+  N        T  L  +D      +++  T T  V + DVND  P FT  ++     E    + H+ +        V A D D +G  + + Y I+      E+  F+ID ++G I   + FDRE++D Y++T++A D    +L          VKV I I D NDN P     + I     S  E  +V       +  K  D+ ++  +R+ L+    G   F + T +GTI+ K   D E  D+Y + L  SD         Y+H    I DVNDN+PQF +  Y              TT IE  + +IP ++L  + A D D D K+ +I Y L+   G    F I +  G I++ + L R   + + S+   V A D   NG+   +D++V + ++ D  P
Sbjct:  798 FSIDEHTGLVKLRHGVSAADLAE-------AENP-INLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP---DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDD-SSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNN-------YTLTLTATD----MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDV-------ITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIH----IEDVNDNAPQFEQQKYA-------------TTVIEEDV-DIP-KVLFNVHATDADQDEKSSRIVYRLE-GQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP 1544          

HSP 3 Score: 95.9005 bits (237), Expect = 1.621e-19
Identity = 120/481 (24.95%), Postives = 205/481 (42.62%), Query Frame = 3
Query:  393 KSTQLRYKFSKE--NKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDE--NSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLP--QAID-NDVTEKNRKILYELHQNE----EEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILE--AWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTAR---LSYRLDNSVKLAIRRLFLVQEE--------GWIILNRGLDYE----IDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNN-LQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHA-HIHQVLATDKDEGQ 1745
            KS+++ Y+   +  ++ F + + SGTI     +D +           A  P+    V   D+  N  +          D NDN P+FP +   + E     +    +Y    QA D +D T +N  I Y + +N+    E  FR  ID  TGK F   +++LD E  S    I+E  A + G+  ++    +  +V D NDN PFF ++ Y  ++ E  P+   +    A D D+ A+    +Y+L           F V  +        G + + + LDYE     D  HL  + V DG + A   + + + D ND  P+IH   ++  ++E++  GT +G+   +DRD+    G    +  +  ++  + FT   D +         ++   T DRE+         I    LI      +NN    +   ++V ++DVNDN P          F EN  ++     ++ ATD+D  +
Sbjct: 1469 KSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDP---------PAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFR--IDQNTGKIFA--MRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESD-----YFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLG-IRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDA----GDTARFRINRQSDPKRQFTIDQDGT---------LRVAHTLDRED---------IAVYNLIIEAYDNSNNIGRQM---VAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAE 1904          

HSP 4 Score: 92.4337 bits (228), Expect = 2.272e-18
Identity = 102/370 (27.57%), Postives = 166/370 (44.86%), Query Frame = 3
Query: 1608 LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDH----YVVTIKAQDHGNP-SLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWP---------------HKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGK-----ENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVS-------QTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            L++ I+DVNDN P FT  +Y     E+  ++  I +V A DKD G NSRITY + ++++F I+S +G I+A    D ++++     Y   + A+DHG P SL+++  ++I   + ND     + +S ++     +   G P+  ++A+D   A+  E+ +  M                 H G   +  +G   A ++   E E+   + + + D+G           +Y  L I I DVN+N P+F   P      +IA         I    Y+     +V ++A D D+  NG I YSL       R  F IDR  G +  S       +T  R D     + V A+D G  PL       + + DI
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-DNHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLR-HGVSAADLA---EAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF---PDCAKYSDIA--------KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRED-----VTVKATDRGDRPLIGFCQFSVEVVDI 972          

HSP 5 Score: 86.2705 bits (212), Expect = 1.552e-16
Identity = 125/465 (26.88%), Postives = 197/465 (42.37%), Query Frame = 3
Query:  768 QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSN-HTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHL---FVVEVFDG----VYAASTTICIKVTDINDETPNIHINPSKLT--IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITF-DREEFLNNERIHPIRTALLICSDGHGTNNAQLTIT--FTLSVLIEDVNDNRPVFTES-----IYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMK--IFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDL 2075
            ++E ++FR  ID  TG   +  L + D  +    H + + A  +    ++S + +   + D NDN P F +  Y   + E+ PL+  I K+ A+D D    +R++Y +DN         F +   G I     LD  ++++ H    F V   D       ++S  I I+  + NDE+  + +  S+ T  + E+   GT V QI+  D D  EV              +  F      SI + + + +++  ++  D  E  N     PI   +++  DG        T T   TL + IEDVN+N+P F +      I  I           I +V ATD D   N  I Y +  +       F ID  +G +      +FDRE      VT+KA D G+  L    + ++ + D NDN PQ    S + SV     V    I    A D+D A N EI + L
Sbjct:  579 EDETKWFR--IDPSTGIIHLTRLLDFDDPALPKLHKLKVTARED---NRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN-------HNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESA-VFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLF------SIDEHTGLVKLRHGVSAADLAEAEN-----PINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVF-AFDNDAAHNAEITYSL 1018          

HSP 6 Score: 73.1738 bits (178), Expect = 1.542e-12
Identity = 171/750 (22.80%), Postives = 297/750 (39.60%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEK------KSQIVIKFEVLDFNDNEP-FFNQSTYVITIPENTPLSTNIYKIEAIDPDK-TARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRG-----LDYEIDQMHLFVVEVFDG---VYAAST-----TICIKVTDINDETPNIHINPSKLTIKENLISGTF------VGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI--------LESNDFK----IDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNP-SLNTTVKVNITIGDRNDNPPQLISSSDF--SVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHK---------GYFDITPNGTIYAKV----SFDREKEDRYCMRLRISD-NGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADK-NGKISYSLKIPLGVP-----RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD----------IKVLLINLADIPPGLNNQK 2639
            +D NDNVP F     T +  E ++  ++ I    A+D D T  N +I Y +  +    F +N + +     +     LDA+ Q N    +  +N   ++        S  +I     + ND    F   S Y   + E+    T + +I+A D D+     S+   N        LF + E  G + L  G     L    + ++L V+   DG   VY + T     T+ I + D+N+  P    + +K +    ++ GT+      + +++ +D DS   NG I  Y      +     F     I +++ +      + FDRE         P     +  +D     +  L      SV + D+NDN P F    Y         +   +  V A D D   N+ ITY +           ND      ++  SG I  +K     +   ++  + A D+G P +L ++ +V + + D+    P+  +S D    +  + NV L   I   +A     + N ++ + L                F+   NG  + +V      D E+ + Y + L  +D   +    +T+V   +++ DVND  PQF       + D   G  +   TP E  + +  G+ +VT+KAID D+D    ++ Y +   +G       ++F ID   GEI  ++   R  I  Y + V ASD  V  L            +++++ ++ D  P    QK
Sbjct:  633 DDVNDNVPTFTRPLYTAQVRE-DIPLNQTILKVTAVDKD-TGDNSRITYSVDNHN---FSINSNGE-----ISAKVRLDAD-QLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDS-SANGDI-VYSLYYTQSESRKAF----VIDRQTGVLTPSPHVVFDRE-------TRPREDVTVKATD---RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV---VEVRDVNDVVPQF-------TVDLFTGTIDEEMTPNE-HLEKTNGKPIVTVKAIDTDSDGPQNEVHYRI---VGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQK 1339          

HSP 7 Score: 63.1586 bits (152), Expect = 1.504e-9
Identity = 165/711 (23.21%), Postives = 279/711 (39.24%), Query Frame = 3
Query:  711 QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTG----KPFVVVLKNLDAESQSNHTVILEAWNEGM------KEKKSQIVIKFEVLDFNDNEPFF---NQSTYVITIPENTPLS--TNIYKIEAIDPDKTAR--LSYRLDNSVKLAIRRLFLVQEEGWIIL---NRGLDYEIDQMHLFVVEVFDGVYAASTTIC---IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQES----NIFEIKSRITFDREEFLNNERIHPIRTALLI---CSDGHGTNNA-QLTITFTLSVLIEDVNDNRPVFTES---IYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------------FKIDSVSGWINA--MKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLI-----SSSDFSVEENRNVSL---GPIGYLKAKDDDI-AENGEIRFDLMWPHKG----YFDITP-NGTIYAKVSFDREKEDRYCMRLRISDN------GKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQK 2639
            QA D D  E     + +  ++ ++    +ID  TG    +  V      +AE+  N TVI++  ++G       K   S   +   + D N+N+P F    + + +  I E T  +    I K+EA D D +A   + Y L    +   R+ F++  +  ++    +   D E        V+  D         C   ++V DIND +P       + ++      GT V  +   D D+   N +I             ++   D +  +E     + FE+ +R    R   +   +  P++T   I    +D +G   A Q +   TL+VL  D     P +  S      I   EN  ++  I +  A    + +NS + Y +  S               K ++ + W+    M+  D E++++Y +T+ A D  +   +T   V + + D ND  PQ        + D  +  N ++      PI  +KA D D      E+ + ++    G    +F I    G I+    FDREK D Y + +  SD       G     +  V + I I DVNDN+P F E  Y+                  +   E  G  ++TIKA DLD  K+  + Y L    G    F +  D G I V + L       Y + +IASD      +++ + + ++ D  P    QK
Sbjct:  771 QARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQ--DDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL-YYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAH-NAEIT------------YSLEIDTTAGEEHQNDLDFFELVNR----RSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVL--DKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIG----------------RVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQK 1440          
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 194.897 bits (494), Expect = 1.269e-49
Identity = 200/759 (26.35%), Postives = 321/759 (42.29%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVF-PFKFKTH-RESEINLLRDRKIYLPQAIDNDVTEKN-RKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESN--IFEIKSR----ITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---------------SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEEN-RNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRY--FEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            F +   SG I     +D E            D+  ++ T  +                 D NDN PVF P ++K   RES     +     +   +  D    N  ++ Y +   NE   FR  ID  TG+ FVV    L   +Q  H + + A + G     +  V+   ++D     P F ++ Y   + E+ P  T +  + A   D   R   R             +    G I + + LD+E     L  ++   G   VY   T + I+V D+ND  P    +  ++++ E+   G  +      D+DS   +G++                    S+ +ES   +F I +R    I     ++ +++R     T ++  +DG       L+   T+ V ++DVNDN PVF +  Y++   E+  I+A I QV A+D D G N+RITY I++               S  F I   SGWI      DRE  D Y +T+ A D+G P+ +   +V + + D NDN P+   S  +F +EEN R  S+  +G + A D D+ EN  IR+ L+ P    F + P  G I  +   DRE  + Y + +   D G   +    V + I + DVNDN+P+  +P      D ++     P           PG  +V ++A+D D  +N  I+YS+        +  F ID   G I+    L   +   YR+ V ASD G PP   +++L + + D+
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK------------MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFR--IDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYG-HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGS-SGQVTY------------------SLVKESGKGLFAIDARSGHLILSQHLDYESSQR----HTLIVTATDG---GVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSV--VGVVTASDLDLGENAAIRYSLL-PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS-ARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQP-----------PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 193.741 bits (491), Expect = 3.075e-49
Identity = 196/692 (28.32%), Postives = 312/692 (45.09%), Query Frame = 3
Query:  591 ITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLK---NLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEA--IDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTT--ICIKVTDINDETPNIHI----NPSKLTIKENLISGTFVGQIKISDRDSVE--VNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDL--MWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYR------IHVIASDNG 2564
            I  +   +DENDN P FP +   H E   N  R+ K  L  A D D+   N +    +  N  + FRL+   +      + L+    LD E+   +++++EA + G    +  + +   + D NDN+P FNQS Y  T+PEN  + T++ ++ A   D D+   + Y ++       +   +    G I +N+ LD+E  ++H  VV   D G     TT  + I+VTD+ND  P I++    + +   I E+   G FV +I + D DS     N  +     DG   L           T++++I+ +   +  DRE   N          L + +   GT    L  + ++ + I DVNDN P F + +Y+   ME       + QVLA D+DEG NS +TY + E+ +     F+ID  +G I      D E      +T+ A+D G P L++T  V +TI D NDN P    S  + SV EN      P+G     + A D D   N  + + +   + H   F++ + +G I      D E+   Y   +  +D G  +   T   + +++ DVNDN P F    Y +S R++    + A +TPI            V + A D D    G++SY + +       F IDR  GEI V     R D+ S R      +++ A+D G
Sbjct:  158 IRVLVTVKDENDNAPTFP-QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----------TTRDNSIYLVIVHLPLDREIVSN--------YTLSVVATDKGT--PPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE-----PVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPI------------VAVVATDPDYGNFGQVSYRI-VAGNEAGIFRIDRSTGEIFV----VRPDMLSVRTQPMHMLNISATDGG 803          

HSP 3 Score: 171.4 bits (433), Expect = 2.546e-42
Identity = 191/725 (26.34%), Postives = 303/725 (41.79%), Query Frame = 3
Query:  429 NKYFSLTEKSGTITTKSTIDLE---EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL--------DNSVKLA--IRRLFLVQEEGWIILNRGLDYEI-DQMHLFVVEVFDGVYAA--STTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFM-ENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVS--LGPIGYLKAKDDDIAENGEIRF-DLMWPH----------KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISD-NGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIP--GQILVTIKAIDLDADKNGKISYSLKIPLGVPRYF 2465
            + YFS+   SG I     +D E   ++  N +A            VN+                ED NDN P F     +      +E+       +Y   A D D +  + ++ Y L +   +     ID+++G   +++ ++LD ES   HT+I+ A + G+    + + I  +V D NDN P F +  Y + + E+  ++  I ++ A D D    AR++YR+         NS+  +   +   +    GWI L   LD E  D+  L V+   +G  AA   T + ++V D ND  P    +  +  I+ENL  G+ VG +  SD D  E N  I  Y    +N+   F  HP   +T E     I +R   DRE          +R    +  +         +    + + + DVNDN P   +   ++  + E       + +V A D+D GQN+ ITY I++  D      F ID  SG I    + D EE   Y + + A D GNP   T   + + + D NDN P   SSS  F V E+  +   +G I  ++   D +  + E  F DL   +          +  FDI   +G +      DRE +  + + +R  D     N Q + + + I++ DVNDN+P++                  P  PI+L + E    G I+    A D D   NG + Y L       RYF
Sbjct:  872 DGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIE--------------VEDVNDNAPEFEASMVRISVPESAELGA----PLYAAHAHDKD-SGSSGQVTYSLVKESGKGL-FAIDARSGH--LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIR-YSLLPINS--SFQVHP---VTGE-----ISTREPLDRE----------LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW------------------PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI------RYF 1528          

HSP 4 Score: 155.992 bits (393), Expect = 1.149e-37
Identity = 189/734 (25.75%), Postives = 313/734 (42.64%), Query Frame = 3
Query:  585 AIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKN----RKILY--ELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEG---MKEKKSQIVIKFEVLDFNDNEPFF------NQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGL-----DYEIDQMHLFVVEVFDGVY----AASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPD--PSITQESNIFEIKSRITF---------DREEFLNNERIHPIRTALLICSDGHG-TNNAQLTITFTLSVLIEDVNDNRPVFTE-SIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNP-SLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIG----YLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIP-LGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPG 2624
            + IT      D NDN P +P      +    + +  +    I+   A D D         R I Y  +L++++E+   L  +DS TG   + +   LD E+   + +I++A ++     +  ++ + ++  +LD ND+ P F         T  + I + T +   +  I A+D D     +L+Y +         R  +  + G I L + L     D E       ++   D        +S  + + V   ++  P       + TI EN+ SG+FV Q+        E N  +    P G+ N     FH D    I      F+ +S+ ++         +R+  L++  +   R+     SD  G T+N Q     T+ + + DVNDN P F   S Y +   EN+     IH V+A+D DEG N+ + Y I   N    F IDS SG ++A +  DRE+   Y + I+A D G P S      + I + D+NDN P+  +S    SV+E+      P+G     + A D D+  N  + + L    +  F I   +G I      DRE +  Y   +  +D G+   +   V + I +LD+NDN P F   PY+                 ++     PGQ L+ ++A+D D   N +I YSL      V   F I+   G +  SQ+L+        + V+A D G PP S + ++ + + + P G
Sbjct: 1467 SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTI----IHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGA--LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG--RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAE-NANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRS-----SDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED-----APLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIG----------------QVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQG 2160          

HSP 5 Score: 155.606 bits (392), Expect = 1.654e-37
Identity = 165/642 (25.70%), Postives = 270/642 (42.06%), Query Frame = 3
Query:  792 LNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKE--KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL-------DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV------YAASTTICIKVTDINDETPNIHINP-------SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE--SND-FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVN-----------------------ITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
             +ID  +G   +VV + LD E QS   + + A +       + S I +K EV D NDN P + Q    + + E TP+ T I+   A D D      L YRL       + S + A+    +    G + L   LD+E  Q +L +V+  D           S T+ +++ D ND  P+  ++P       + L I +    G  V  I   D DS + NG++  YE  G N    F       I  ++ I E+   +    E+     R +     L+I +  HG    + + +  L ++++  ++N P F +++Y    +EN    + + QV A      +N+ ++Y+I    +ND F +D   G I     FDRE    YV+ +  +D    S  ++  V                        IT+GD NDN P+    S + +    N   G I  + A D D   N ++ + +   + G  F I  +    +    DRE+  RY ++++ SD G+   ++ + ++ I + D NDN+P+F      LS+   +   +AP            G  +V I A+D D   N ++ YSL         F ID   G I     L R    SY   V+A+D G
Sbjct: 1426 FDIDRHSGN--LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGD-NGQLT-YEITGGNGEGRF------RINSQTGIIELVKSLPPATEDVEKGGRFN-----LIIGAKDHGQPEPKKS-SLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFK-----LSKYTGSVQEDAPL-----------GTSVVQISAVDADLGVNARLVYSLANE--TQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 6 Score: 123.635 bits (309), Expect = 7.669e-28
Identity = 184/741 (24.83%), Postives = 307/741 (41.43%), Query Frame = 3
Query:  597 TVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV-IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQM-HLFVVEVFDGVYAASTTICIK--VTDINDETPNIHINPS--KLTIKENLISGTFVGQIKI--SDRDSVEVNGKICCYEPDGMNNL----------QPFTFHPD----PSITQESNIFEI------------------KSRITFDREEF-LNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKID-SVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYA----------KVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFM--EPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQI-----LVTIKAIDLDADK-NGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTL---SRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            T+F+ ED+NDN P F     T    E   L    + +  A+D D+   N +++Y L  NE ++ +  ID ++G   +  +  LD E Q+++  ++ A + G  E +S  V ++  VLD NDN P F +  Y+  +P        + K++A+D D    A + Y L+        +  +    G +  ++ L  E  ++ HL VV    G    S+   I+  + +    TP +       ++ +KEN  SGT + Q+    SD    +V         DG+ +L          +P     D    PS++  S    +                  +S+       F L N + + IR  L+       T +A    ++  L + +ED NDN P F++  +     E N+    + QV A D D G N+R+ Y I++    N F I+ + SG +    + DRE  D Y + I A D G P +  T  + + I D NDN P    ++  +V E   +    I  + A D D       R       +   DI  N +I+A          K   D E +  Y + +  SD   E +      L +++ D NDN+P F+  +PP   +              I  +I EI   +     L+T+ A D D++  N K+ Y ++        F +    G + V+ +    + S  G Y + +IA D G P L    +L +   D
Sbjct: 1939 TIFV-EDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLG-VNARLVYSL-ANETQW-QFAIDGQSG--LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVAR-----TADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELG-AVITSISANDVDTYPALTYRLGA----ESTVDIE-NMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR----TVLTVRVNDENDNAPVFLAQQPPAYFA--------------ILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE---PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND 2640          

HSP 7 Score: 107.071 bits (266), Expect = 9.055e-23
Identity = 98/353 (27.76%), Postives = 159/353 (45.04%), Query Frame = 3
Query: 1602 FTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL---ISSSDFSVEENRNVSLGP-IGYLKAKD-DDIAENGEIRFDLMWPHKGYFDITP-NGTIY---AKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL-KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
             T+++ I+DVNDN+P+F +S Y     EN  +   + QV A+D D  +N  + Y I          F+ID  +G I   K  D E  + + + + A+DHG   L TT  V+I + D NDN P +     S D S + + +   G  +  +   D D   E   +   L     G+F +T  + +IY     +  DRE    Y + +  +D G      +   + ++I DVNDN P+F +  Y  +   +A P                G  ++ + A D D   N  ++YSL + P    ++F+ID   G I     +        ++ V+A D GVPPLS    +L+ + D+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASK-SIFLRITDVNDNPPEFEQDLYHANVMEVADP----------------GTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDV 604          

HSP 8 Score: 93.5893 bits (231), Expect = 1.331e-18
Identity = 165/708 (23.31%), Postives = 281/708 (39.69%), Query Frame = 3
Query:  579 FLAIITTVFL-FEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQ--AIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKN---LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRL---FLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETP---------NIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGK-ICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE-----GQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVT-IKAQDHGNP-----SLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY----LKAKDDDI--AENGEIRFDLMW---PHKGYFDITPNGTIYAKVSFDREKEDR-YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP------RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            FLA    + +  EDENDN P F  K      SE N   ++  ++ Q  A D+D     R   + +  N +  F +         F  +++    LD E +  + + + A +EG+ +      I+ +++D NDN+P F  +  ++T+ E T L   I  I A D D    L+YRL     + I  +    L +  G ++L R LDYE+ Q +   V   D  + A T + ++V D ND  P            I P+   I E+L     +  +  +D DS   N K I   EP      + F+ HP   +    N+  ++  ++   + F+            +I  D        L  +  L V   D    R  F ++ Y     E   + + + Q+     D+       N    +++L+S           I  +K  DRE  D Y +  + +  HG P     + ++ + V ITI D NDN P    S+ +  E +    L P+ Y    L+A D D     N E+ +D+      H    D+   G ++     D +   + Y + +R  D+  +    +     +++ D NDN P+F    Y+           A   P+  S++           A DLD    G+++YS+      P      + F +D + G +  +          Y + ++ASD G
Sbjct: 2301 FLASYAELVIELEDENDNSPKFSQKQFVATVSEGN---NKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE------PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP----AQEGFSVHPSNGVVS-VNMSRLQPAVSSSGDYFVR-----------IIAKDA---GKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSK---------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE---LAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLV-TGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFL--------AENEPVGSSVFR--------AHASDLDKGPFGQLNYSIG---PAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 9 Score: 86.6557 bits (213), Expect = 1.360e-16
Identity = 110/409 (26.89%), Postives = 174/409 (42.54%), Query Frame = 3
Query: 1473 EIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDS-------------VSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFS-VEENRNVSLGPIGYLKAKDDDIAENGEIRFDL---MWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGG--EIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PP 2621
            EI++++  DRE           R +  + +      N ++ +T      ++D NDN P F ++  +I F EN         + A D D    +   Y+I+  N    F++ S             +SG++      DRE    Y + I+A D G P L   + VNITI D NDN P    S  F+ V EN  V    +  + A D D  ENG + + +       +  F I P  G IY   + D E ++ + + +   D+G E   ET   + I++ DVNDN P        LS D  A P        ++S    PG+ +  I   D D+ K    + ++ +  G   +    RD     + V   L R  + +Y + V+A+D G PPL   K + + + D+   PP
Sbjct:  131 EIRTKVKLDRE----------TRASYSLVAIPLSGRNIRVLVT------VKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFL------DRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTS-VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHG-EQPLETTAFVSIRVTDVNDNQPTINV--IFLSDD--ASP--------KISESAQPGEFVARISVHDPDS-KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPP 502          

HSP 10 Score: 67.781 bits (164), Expect = 8.759e-11
Identity = 115/522 (22.03%), Postives = 204/522 (39.08%), Query Frame = 3
Query:  615 DENDNVPVF-----PFKFKTHRE-SEIN--LLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQS-NHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMH--LFVVEVFDG-------VYAASTTICIKVTDINDETPNIHINPS-KLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGY 2096
            DENDN PVF     P  F      SEI+  L  D  +    A D D    N K++Y +   +E F   ++    G   V + +   A S S ++ V + A + G    KS  +++ +  D       F Q+ Y   I E  PL + + ++     D++  +    + S        F + +   I+L + LD E + ++    V+    G         ++  ++ I + D ND  P    +   +  I E       + Q++  D D          Y+    N+   FT      I   + +  + +R+ +D             ++  LI       +   L       + + D NDN P F  + Y  F  EN  + + + +  A+D D+G   ++ Y I  +         F++DS SG + +  +FD E+   Y + + A D G    +  V+V I    R++  PQ    +  F +     +  G  +G + A D D   +G + + L  PH  +
Sbjct: 2524 DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGF---SVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESA-------FELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFT------IDLVTGVLFVNNRLDYDSGA----------KSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIE--SRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 11 Score: 67.781 bits (164), Expect = 8.908e-11
Identity = 85/316 (26.90%), Postives = 139/316 (43.99%), Query Frame = 3
Query:  588 IITTVFLFEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDV-TEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVK-LAIRRLFLVQEEGWIILNRGL-DYEIDQ---MHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKE--NLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFD 1499
            +I T+    D NDN P+F    K   E SE+  LR   I   QAID D     N +++Y++   N+E  F   ID  TG  FV    + D+ ++S   +I    +   +   S    + E+ D NDNEP F  + YV  + EN P+ +++++  A D DK    +L+Y +  +    +  ++F V  E  ++ +  + DYE  Q   M L   ++  G   AS  + +++   ++ TP       +  +     L  G  VGQ+  +D DS           PDG    Q    H    + + S    IK ++  D
Sbjct: 2738 VIITIL---DANDNFPIFDRSAKYEAEISELAPLR-YSIAQLQAIDADQENTPNSEVVYDITSGNDEHMF--TIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM--GGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDS----------GPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 12 Score: 64.6994 bits (156), Expect = 7.688e-10
Identity = 87/356 (24.44%), Postives = 145/356 (40.73%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFN-QSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAAS----TTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL 1958
            I   V D NDN P F   S Y +++PEN+     I+ + A D D+   A L Y +       +   F +      +  R LD E    +   ++  D     S      I I V D ND  P   ++    +++E+   GT V QI   D D + VN ++       + N   + F    +I  +S +     ++  DRE       +      +++ +DG        T+   ++VL  D+NDNRP+F    Y             + +V A D D G N+ I Y +   N      F+I+  +G ++A +    E      + + A+D GNP  ++   + + IG+     P L
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGG---NLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVY----SLANETQWQF----AIDGQSGLITTVGKL--DRE-------LQASYNFMVLATDGGRYEVRSATVPVQINVL--DINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVL 2164          

HSP 13 Score: 58.5362 bits (140), Expect = 5.396e-8
Identity = 81/311 (26.05%), Postives = 126/311 (40.51%), Query Frame = 3
Query: 1782 DFKIDSVSGWINAMKIFDREEMDHY-VVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS---DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITP----NGTIYAKVS----FDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL-KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PPGLNNQKGSDINSPK 2663
            D  ID  +G I      DRE    Y +V I       P     ++V +T+ D NDN P    +S   +F     R V       L A+D D+      R++++  +    F ++     +G +Y  +      DRE    Y + +   D G       ++ + I I DVNDN P F +  Y  +      P NA      L +Y           A D DAD+NG + Y++ +      + F ID   G I +++ L       + + V+A D+G  PL     + I + D+    P +N    SD  SPK
Sbjct:  122 DLAIDRATGEIRTKVKLDRETRASYSLVAI-------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKR---TLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATV-----PENATVGTSVLQVY-----------ASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPK 405          
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 194.897 bits (494), Expect = 1.269e-49
Identity = 200/759 (26.35%), Postives = 321/759 (42.29%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVF-PFKFKTH-RESEINLLRDRKIYLPQAIDNDVTEKN-RKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESN--IFEIKSR----ITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---------------SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEEN-RNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRY--FEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            F +   SG I     +D E            D+  ++ T  +                 D NDN PVF P ++K   RES     +     +   +  D    N  ++ Y +   NE   FR  ID  TG+ FVV    L   +Q  H + + A + G     +  V+   ++D     P F ++ Y   + E+ P  T +  + A   D   R   R             +    G I + + LD+E     L  ++   G   VY   T + I+V D+ND  P    +  ++++ E+   G  +      D+DS   +G++                    S+ +ES   +F I +R    I     ++ +++R     T ++  +DG       L+   T+ V ++DVNDN PVF +  Y++   E+  I+A I QV A+D D G N+RITY I++               S  F I   SGWI      DRE  D Y +T+ A D+G P+ +   +V + + D NDN P+   S  +F +EEN R  S+  +G + A D D+ EN  IR+ L+ P    F + P  G I  +   DRE  + Y + +   D G   +    V + I + DVNDN+P+  +P      D ++     P           PG  +V ++A+D D  +N  I+YS+        +  F ID   G I+    L   +   YR+ V ASD G PP   +++L + + D+
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK------------MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFR--IDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYG-HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGS-SGQVTY------------------SLVKESGKGLFAIDARSGHLILSQHLDYESSQR----HTLIVTATDG---GVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSV--VGVVTASDLDLGENAAIRYSLL-PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS-ARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQP-----------PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 193.741 bits (491), Expect = 3.075e-49
Identity = 196/692 (28.32%), Postives = 312/692 (45.09%), Query Frame = 3
Query:  591 ITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLK---NLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEA--IDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTT--ICIKVTDINDETPNIHI----NPSKLTIKENLISGTFVGQIKISDRDSVE--VNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDL--MWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYR------IHVIASDNG 2564
            I  +   +DENDN P FP +   H E   N  R+ K  L  A D D+   N +    +  N  + FRL+   +      + L+    LD E+   +++++EA + G    +  + +   + D NDN+P FNQS Y  T+PEN  + T++ ++ A   D D+   + Y ++       +   +    G I +N+ LD+E  ++H  VV   D G     TT  + I+VTD+ND  P I++    + +   I E+   G FV +I + D DS     N  +     DG   L           T++++I+ +   +  DRE   N          L + +   GT    L  + ++ + I DVNDN P F + +Y+   ME       + QVLA D+DEG NS +TY + E+ +     F+ID  +G I      D E      +T+ A+D G P L++T  V +TI D NDN P    S  + SV EN      P+G     + A D D   N  + + +   + H   F++ + +G I      D E+   Y   +  +D G  +   T   + +++ DVNDN P F    Y +S R++    + A +TPI            V + A D D    G++SY + +       F IDR  GEI V     R D+ S R      +++ A+D G
Sbjct:  158 IRVLVTVKDENDNAPTFP-QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----------TTRDNSIYLVIVHLPLDREIVSN--------YTLSVVATDKGT--PPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE-----PVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPI------------VAVVATDPDYGNFGQVSYRI-VAGNEAGIFRIDRSTGEIFV----VRPDMLSVRTQPMHMLNISATDGG 803          

HSP 3 Score: 171.4 bits (433), Expect = 2.546e-42
Identity = 191/725 (26.34%), Postives = 303/725 (41.79%), Query Frame = 3
Query:  429 NKYFSLTEKSGTITTKSTIDLE---EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL--------DNSVKLA--IRRLFLVQEEGWIILNRGLDYEI-DQMHLFVVEVFDGVYAA--STTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFM-ENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVS--LGPIGYLKAKDDDIAENGEIRF-DLMWPH----------KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISD-NGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIP--GQILVTIKAIDLDADKNGKISYSLKIPLGVPRYF 2465
            + YFS+   SG I     +D E   ++  N +A            VN+                ED NDN P F     +      +E+       +Y   A D D +  + ++ Y L +   +     ID+++G   +++ ++LD ES   HT+I+ A + G+    + + I  +V D NDN P F +  Y + + E+  ++  I ++ A D D    AR++YR+         NS+  +   +   +    GWI L   LD E  D+  L V+   +G  AA   T + ++V D ND  P    +  +  I+ENL  G+ VG +  SD D  E N  I  Y    +N+   F  HP   +T E     I +R   DRE          +R    +  +         +    + + + DVNDN P   +   ++  + E       + +V A D+D GQN+ ITY I++  D      F ID  SG I    + D EE   Y + + A D GNP   T   + + + D NDN P   SSS  F V E+  +   +G I  ++   D +  + E  F DL   +          +  FDI   +G +      DRE +  + + +R  D     N Q + + + I++ DVNDN+P++                  P  PI+L + E    G I+    A D D   NG + Y L       RYF
Sbjct:  872 DGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIE--------------VEDVNDNAPEFEASMVRISVPESAELGA----PLYAAHAHDKD-SGSSGQVTYSLVKESGKGL-FAIDARSGH--LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIR-YSLLPINS--SFQVHP---VTGE-----ISTREPLDRE----------LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW------------------PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI------RYF 1528          

HSP 4 Score: 155.992 bits (393), Expect = 1.149e-37
Identity = 189/734 (25.75%), Postives = 313/734 (42.64%), Query Frame = 3
Query:  585 AIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKN----RKILY--ELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEG---MKEKKSQIVIKFEVLDFNDNEPFF------NQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGL-----DYEIDQMHLFVVEVFDGVY----AASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPD--PSITQESNIFEIKSRITF---------DREEFLNNERIHPIRTALLICSDGHG-TNNAQLTITFTLSVLIEDVNDNRPVFTE-SIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNP-SLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIG----YLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIP-LGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPG 2624
            + IT      D NDN P +P      +    + +  +    I+   A D D         R I Y  +L++++E+   L  +DS TG   + +   LD E+   + +I++A ++     +  ++ + ++  +LD ND+ P F         T  + I + T +   +  I A+D D     +L+Y +         R  +  + G I L + L     D E       ++   D        +S  + + V   ++  P       + TI EN+ SG+FV Q+        E N  +    P G+ N     FH D    I      F+ +S+ ++         +R+  L++  +   R+     SD  G T+N Q     T+ + + DVNDN P F   S Y +   EN+     IH V+A+D DEG N+ + Y I   N    F IDS SG ++A +  DRE+   Y + I+A D G P S      + I + D+NDN P+  +S    SV+E+      P+G     + A D D+  N  + + L    +  F I   +G I      DRE +  Y   +  +D G+   +   V + I +LD+NDN P F   PY+                 ++     PGQ L+ ++A+D D   N +I YSL      V   F I+   G +  SQ+L+        + V+A D G PP S + ++ + + + P G
Sbjct: 1467 SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTI----IHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGA--LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG--RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAE-NANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRS-----SDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED-----APLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIG----------------QVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQG 2160          

HSP 5 Score: 155.606 bits (392), Expect = 1.654e-37
Identity = 165/642 (25.70%), Postives = 270/642 (42.06%), Query Frame = 3
Query:  792 LNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKE--KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL-------DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV------YAASTTICIKVTDINDETPNIHINP-------SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE--SND-FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVN-----------------------ITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
             +ID  +G   +VV + LD E QS   + + A +       + S I +K EV D NDN P + Q    + + E TP+ T I+   A D D      L YRL       + S + A+    +    G + L   LD+E  Q +L +V+  D           S T+ +++ D ND  P+  ++P       + L I +    G  V  I   D DS + NG++  YE  G N    F       I  ++ I E+   +    E+     R +     L+I +  HG    + + +  L ++++  ++N P F +++Y    +EN    + + QV A      +N+ ++Y+I    +ND F +D   G I     FDRE    YV+ +  +D    S  ++  V                        IT+GD NDN P+    S + +    N   G I  + A D D   N ++ + +   + G  F I  +    +    DRE+  RY ++++ SD G+   ++ + ++ I + D NDN+P+F      LS+   +   +AP            G  +V I A+D D   N ++ YSL         F ID   G I     L R    SY   V+A+D G
Sbjct: 1426 FDIDRHSGN--LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGD-NGQLT-YEITGGNGEGRF------RINSQTGIIELVKSLPPATEDVEKGGRFN-----LIIGAKDHGQPEPKKS-SLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFK-----LSKYTGSVQEDAPL-----------GTSVVQISAVDADLGVNARLVYSLANE--TQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 6 Score: 123.635 bits (309), Expect = 7.669e-28
Identity = 184/741 (24.83%), Postives = 307/741 (41.43%), Query Frame = 3
Query:  597 TVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV-IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQM-HLFVVEVFDGVYAASTTICIK--VTDINDETPNIHINPS--KLTIKENLISGTFVGQIKI--SDRDSVEVNGKICCYEPDGMNNL----------QPFTFHPD----PSITQESNIFEI------------------KSRITFDREEF-LNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKID-SVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYA----------KVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFM--EPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQI-----LVTIKAIDLDADK-NGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTL---SRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            T+F+ ED+NDN P F     T    E   L    + +  A+D D+   N +++Y L  NE ++ +  ID ++G   +  +  LD E Q+++  ++ A + G  E +S  V ++  VLD NDN P F +  Y+  +P        + K++A+D D    A + Y L+        +  +    G +  ++ L  E  ++ HL VV    G    S+   I+  + +    TP +       ++ +KEN  SGT + Q+    SD    +V         DG+ +L          +P     D    PS++  S    +                  +S+       F L N + + IR  L+       T +A    ++  L + +ED NDN P F++  +     E N+    + QV A D D G N+R+ Y I++    N F I+ + SG +    + DRE  D Y + I A D G P +  T  + + I D NDN P    ++  +V E   +    I  + A D D       R       +   DI  N +I+A          K   D E +  Y + +  SD   E +      L +++ D NDN+P F+  +PP   +              I  +I EI   +     L+T+ A D D++  N K+ Y ++        F +    G + V+ +    + S  G Y + +IA D G P L    +L +   D
Sbjct: 1939 TIFV-EDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLG-VNARLVYSL-ANETQW-QFAIDGQSG--LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVAR-----TADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELG-AVITSISANDVDTYPALTYRLGA----ESTVDIE-NMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR----TVLTVRVNDENDNAPVFLAQQPPAYFA--------------ILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE---PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND 2640          

HSP 7 Score: 107.071 bits (266), Expect = 9.055e-23
Identity = 98/353 (27.76%), Postives = 159/353 (45.04%), Query Frame = 3
Query: 1602 FTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL---ISSSDFSVEENRNVSLGP-IGYLKAKD-DDIAENGEIRFDLMWPHKGYFDITP-NGTIY---AKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL-KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
             T+++ I+DVNDN+P+F +S Y     EN  +   + QV A+D D  +N  + Y I          F+ID  +G I   K  D E  + + + + A+DHG   L TT  V+I + D NDN P +     S D S + + +   G  +  +   D D   E   +   L     G+F +T  + +IY     +  DRE    Y + +  +D G      +   + ++I DVNDN P+F +  Y  +   +A P                G  ++ + A D D   N  ++YSL + P    ++F+ID   G I     +        ++ V+A D GVPPLS    +L+ + D+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASK-SIFLRITDVNDNPPEFEQDLYHANVMEVADP----------------GTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDV 604          

HSP 8 Score: 93.5893 bits (231), Expect = 1.331e-18
Identity = 165/708 (23.31%), Postives = 281/708 (39.69%), Query Frame = 3
Query:  579 FLAIITTVFL-FEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQ--AIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKN---LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRL---FLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETP---------NIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGK-ICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE-----GQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVT-IKAQDHGNP-----SLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY----LKAKDDDI--AENGEIRFDLMW---PHKGYFDITPNGTIYAKVSFDREKEDR-YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP------RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            FLA    + +  EDENDN P F  K      SE N   ++  ++ Q  A D+D     R   + +  N +  F +         F  +++    LD E +  + + + A +EG+ +      I+ +++D NDN+P F  +  ++T+ E T L   I  I A D D    L+YRL     + I  +    L +  G ++L R LDYE+ Q +   V   D  + A T + ++V D ND  P            I P+   I E+L     +  +  +D DS   N K I   EP      + F+ HP   +    N+  ++  ++   + F+            +I  D        L  +  L V   D    R  F ++ Y     E   + + + Q+     D+       N    +++L+S           I  +K  DRE  D Y +  + +  HG P     + ++ + V ITI D NDN P    S+ +  E +    L P+ Y    L+A D D     N E+ +D+      H    D+   G ++     D +   + Y + +R  D+  +    +     +++ D NDN P+F    Y+           A   P+  S++           A DLD    G+++YS+      P      + F +D + G +  +          Y + ++ASD G
Sbjct: 2301 FLASYAELVIELEDENDNSPKFSQKQFVATVSEGN---NKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE------PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP----AQEGFSVHPSNGVVS-VNMSRLQPAVSSSGDYFVR-----------IIAKDA---GKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSK---------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE---LAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLV-TGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFL--------AENEPVGSSVFR--------AHASDLDKGPFGQLNYSIG---PAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 9 Score: 86.6557 bits (213), Expect = 1.360e-16
Identity = 110/409 (26.89%), Postives = 174/409 (42.54%), Query Frame = 3
Query: 1473 EIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDS-------------VSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFS-VEENRNVSLGPIGYLKAKDDDIAENGEIRFDL---MWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGG--EIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PP 2621
            EI++++  DRE           R +  + +      N ++ +T      ++D NDN P F ++  +I F EN         + A D D    +   Y+I+  N    F++ S             +SG++      DRE    Y + I+A D G P L   + VNITI D NDN P    S  F+ V EN  V    +  + A D D  ENG + + +       +  F I P  G IY   + D E ++ + + +   D+G E   ET   + I++ DVNDN P        LS D  A P        ++S    PG+ +  I   D D+ K    + ++ +  G   +    RD     + V   L R  + +Y + V+A+D G PPL   K + + + D+   PP
Sbjct:  131 EIRTKVKLDRE----------TRASYSLVAIPLSGRNIRVLVT------VKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFL------DRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTS-VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHG-EQPLETTAFVSIRVTDVNDNQPTINV--IFLSDD--ASP--------KISESAQPGEFVARISVHDPDS-KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPP 502          

HSP 10 Score: 67.781 bits (164), Expect = 8.759e-11
Identity = 115/522 (22.03%), Postives = 204/522 (39.08%), Query Frame = 3
Query:  615 DENDNVPVF-----PFKFKTHRE-SEIN--LLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQS-NHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMH--LFVVEVFDG-------VYAASTTICIKVTDINDETPNIHINPS-KLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGY 2096
            DENDN PVF     P  F      SEI+  L  D  +    A D D    N K++Y +   +E F   ++    G   V + +   A S S ++ V + A + G    KS  +++ +  D       F Q+ Y   I E  PL + + ++     D++  +    + S        F + +   I+L + LD E + ++    V+    G         ++  ++ I + D ND  P    +   +  I E       + Q++  D D          Y+    N+   FT      I   + +  + +R+ +D             ++  LI       +   L       + + D NDN P F  + Y  F  EN  + + + +  A+D D+G   ++ Y I  +         F++DS SG + +  +FD E+   Y + + A D G    +  V+V I    R++  PQ    +  F +     +  G  +G + A D D   +G + + L  PH  +
Sbjct: 2524 DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGF---SVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESA-------FELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFT------IDLVTGVLFVNNRLDYDSGA----------KSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIE--SRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 11 Score: 67.781 bits (164), Expect = 8.908e-11
Identity = 85/316 (26.90%), Postives = 139/316 (43.99%), Query Frame = 3
Query:  588 IITTVFLFEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDV-TEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVK-LAIRRLFLVQEEGWIILNRGL-DYEIDQ---MHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKE--NLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFD 1499
            +I T+    D NDN P+F    K   E SE+  LR   I   QAID D     N +++Y++   N+E  F   ID  TG  FV    + D+ ++S   +I    +   +   S    + E+ D NDNEP F  + YV  + EN P+ +++++  A D DK    +L+Y +  +    +  ++F V  E  ++ +  + DYE  Q   M L   ++  G   AS  + +++   ++ TP       +  +     L  G  VGQ+  +D DS           PDG    Q    H    + + S    IK ++  D
Sbjct: 2738 VIITIL---DANDNFPIFDRSAKYEAEISELAPLR-YSIAQLQAIDADQENTPNSEVVYDITSGNDEHMF--TIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM--GGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDS----------GPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 12 Score: 64.6994 bits (156), Expect = 7.688e-10
Identity = 87/356 (24.44%), Postives = 145/356 (40.73%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFN-QSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAAS----TTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL 1958
            I   V D NDN P F   S Y +++PEN+     I+ + A D D+   A L Y +       +   F +      +  R LD E    +   ++  D     S      I I V D ND  P   ++    +++E+   GT V QI   D D + VN ++       + N   + F    +I  +S +     ++  DRE       +      +++ +DG        T+   ++VL  D+NDNRP+F    Y             + +V A D D G N+ I Y +   N      F+I+  +G ++A +    E      + + A+D GNP  ++   + + IG+     P L
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGG---NLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVY----SLANETQWQF----AIDGQSGLITTVGKL--DRE-------LQASYNFMVLATDGGRYEVRSATVPVQINVL--DINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVL 2164          

HSP 13 Score: 58.5362 bits (140), Expect = 5.396e-8
Identity = 81/311 (26.05%), Postives = 126/311 (40.51%), Query Frame = 3
Query: 1782 DFKIDSVSGWINAMKIFDREEMDHY-VVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS---DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITP----NGTIYAKVS----FDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL-KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PPGLNNQKGSDINSPK 2663
            D  ID  +G I      DRE    Y +V I       P     ++V +T+ D NDN P    +S   +F     R V       L A+D D+      R++++  +    F ++     +G +Y  +      DRE    Y + +   D G       ++ + I I DVNDN P F +  Y  +      P NA      L +Y           A D DAD+NG + Y++ +      + F ID   G I +++ L       + + V+A D+G  PL     + I + D+    P +N    SD  SPK
Sbjct:  122 DLAIDRATGEIRTKVKLDRETRASYSLVAI-------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKR---TLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATV-----PENATVGTSVLQVY-----------ASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPK 405          
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 182.956 bits (463), Expect = 6.886e-46
Identity = 197/745 (26.44%), Postives = 334/745 (44.83%), Query Frame = 3
Query:  405 LRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD-KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY-EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             ++  + +  +F +++ SG +  + T+D E+       N      T T  V       F A    +    DENDN P F   F +   +E N  +   +    A D D T  N  I Y L  + E    + +ID  +G  ++ +L +LD E QS +   + A + G  +  +++ +  +++D+NDN P F      +++ EN    T +  +  IDPD +   + + + +  K A    F + + G + + + LD E    +   +   DG + A   + I V DIND TP        ++  E++  GT + ++K  D D      K+  Y    G +         D SI +ES I ++ S    DRE         P    +    DG        +    + + + D+NDN P+F+ + Y +   E+  ++  I +V A DKD G N +I Y ++  N   FKI   +G I   K  DRE +  + +T+KA+D G P L++   V + I D NDNPP+  S   +S +   N + G  +  + A   DI  N +I + +M  + +G F + +  G +    + D E    Y + ++  D G        YV+  I ILD+NDNSP F++  Y ++              +   I+   G  ++ +KA D D+D NG ++Y+++    + + F ID   G I VS+ L R  I  Y + + A D G P   +   + IN+ D
Sbjct: 2793 FKFSIAADQDHFMISD-SGELILQQTLDREQ---QESHNLIVVAETSTVPV-------FFAYADVLIDVRDENDNYPKFDNTFYSASVAE-NSEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSG--WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQA---QFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGAD---------DFSIGKESGILKVAS--ALDRE-------TTPKYKLVAHVQDGKDFTQECFS---EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF-SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVN--ISILDINDNSPTFLQNLYRIN--------------VNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 154.451 bits (389), Expect = 3.910e-37
Identity = 168/636 (26.42%), Postives = 291/636 (45.75%), Query Frame = 3
Query:  741 NRKILYELHQNE-EEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE-FLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNR--PVFTESIYNIFFMENNHIHAHIHQVLATDKDE-GQNSRITYDILESNDFKIDSVS--GWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDN------PPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTI-YAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS 2579
            N K+++ +   + +  FR  ID   G+  + ++  LD E Q+ + + +  ++ G   K +  ++   +LD NDN P   ++     + E+  + T ++ + A D D    A+++Y L     +      +    G + LN+ LD E    +   +   DG   V ++   + + V D+ND  P   +      ++E+L  GT +  I+  D D              G N    F+   +   TQ+  +F I       R + +L+  N+++H +  + +   DG    +  LT   ++ ++I DVN+NR  P F + +Y     EN      +  V A D D    NS+ITY I   +   I +V+  G I ++   D E  + Y +T+ AQD     L+  V+V I + + NDN      P   ++ ++ SVE   NV    I  LKA D DI     I ++++  +  GYF+I +  G I   +   DRE +  + + + ISDNG      T   + + +LD+NDNSP+F +  Y      +  P++A              Q +  + AID D+ +NG+I+YS+K   G  + F ID   G I +++ L   +   + IH+ A DNG+P  S
Sbjct:  804 NGKLVFAISDGDYDSVFR--IDPDRGE--LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDI-------------GPNAEIQFSLKEE---TQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI---DG---GDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVE---NVE---IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVY-----KVQVPSSATVN-----------QSIFQVHAIDSDSGENGRITYSIKSGKGKNK-FRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKS 1383          

HSP 3 Score: 151.369 bits (381), Expect = 3.407e-36
Identity = 187/683 (27.38%), Postives = 302/683 (44.22%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEF-LNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDL-MWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLG-VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-SD--IKVLLINLADIPP 2621
            D NDN PVF    +     E N L    +     ID D+ EK     + +  +++  F++    K+G+ F+   K LD E    + + + A +     K +   ++ +V D NDN P+  +  Y I+  E+  + T + +++AID D  ++L + L            + +E G + +   LD E    +  V  V DG        + I I V DIND  P   +   ++++ E+    T + ++   D+D   VN +I  Y   G N       H    I++ + I  I+   + DRE   L N         L + ++  G    +L    T++V I D+NDN P F+   Y+   +EN      + +V AT  D G N+ I Y I+  N+   FK+DS +G +      D E    Y +TI+A D G P L+    VNI+I D NDN P  + +  + +  N ++ +G  I  +KA D+D   NG + +++    + G F I P NGTI      DRE    Y + ++  D G   +  + V + I ILD NDN+P F    Y                 + L    + G + +T K  D D   N    Y+  I  G     F +++DG  ++ +   + +    + I V   DNG PPL SD  + V +I  +  PP
Sbjct: 2959 DYNDNAPVFKLPIEGLSVFE-NALPGTVLINLLLIDPDI-EKQEMDFFIVSGDKQAQFQI---GKSGELFIA--KPLDREQLMFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGK---GADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD-FGVNRQIK-YSLMGEN-------HDYFKISKSTGI--IRLHKSLDRETISLFN---------LTVKAEDCGV--PKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNL-YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNS-VPININILDTNDNAPIFSSSNY----------------SVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGS-LRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPP 3586          

HSP 4 Score: 144.821 bits (364), Expect = 3.329e-34
Identity = 205/774 (26.49%), Postives = 329/774 (42.51%), Query Frame = 3
Query:  402 QLRYKFSKEN-KYFSLTEKSGTITTKSTIDLE--------EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDV-TEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLT-IKENLISGTFVGQIK-----ISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITF-DREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAH-IHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF----SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDIT----PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            ++RY+  K N + F L  KSG ++ K  ++             D     C ++ P     V V D +                  +PVF  +F T     +++  D ++Y   ++  +  +   R ++Y +    + F    ID  TG  FVV    LD E  S+H V + A  + +    +++V+   ++D ND  P      Y +TIPEN    T I KI A D D    A+LSY +++        LF +   +G + L   LDYE  + H  VV V D      ++ + + I V D+ND  P   + PS  T +    + G FV   K     ISD DS+E       Y+    N LQ +      SI + + +  +++ + F D+   + N          +  SDG  T  A+L I    S+L E+V    P+F +S Y     EN  +H H I  V A+D D G  + + Y+I+       F ID  +G I +   FDRE+ D YVV +K  D G      ++KV +     ++ P  L+         +VE N+ +       +KAKDDDI +NG + F ++     K   D+       G I  K   +    + Y   +R SD G E +  + V + I+I++ + N P F +   LL            +TP        PG +L  +  I          +Y+ K  +   +   +  D GE+ + QTL R    S+ + V+A  + VP       +LI++ D
Sbjct: 2174 EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQ---VKVIDRS------------------MPVFEKQFYT-----VSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSF---EIDYNTGSIFVV--NELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAP-CFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLE-------YKIVYGNELQTY------SIDKLTGVISLQNMLNFTDKSSTVLN----------ISVSDGVHTAYARLKI----SLLPENVY--SPLFDQSTYEAQVPEN-LLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD-VNDNVPYFLLKEYKMVVSTTVEANQTILT-----VKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRG-EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKI--------IESTP--------PGTVLTKLHMIG---------NYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRD 2852          

HSP 5 Score: 141.739 bits (356), Expect = 2.995e-33
Identity = 178/691 (25.76%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVI--LEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRR-----LFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE----FLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSV--EENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIY----EIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-------RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKV 2591
            +D NDN P +  K + H  +  ++     +   +AID D   K R   Y   +  ++F   +I  ++G   + V   LD E+   + ++  ++   +  +E  S+I+I   V D NDN P F+ + Y +++PE+  L+T I K+ A+D D      + ++  +K ++         + +  G I L++ LD E   +    V+  D GV    +  T+ + + DIND  P   +      I EN   GT V ++  +  D + VN  I  +   G N    F          +S   ++    T D E     FL  + I      L        +NNA + I+      I D+NDN P F +++Y I   E+  + + I  V ATD+D   N  +TY+I   ++   F ID  +G I+  +  DRE + HY + I+A D G+P    +V +NI I D NDN P + SSS++SV  +ENR +    + +  +  D+        FD+   ++ G F +  +G++     F+   +D + +++R+ DNG      +   + +KI++      +   PP +              TP+E++I     +  G  +  + A   D DK  ++++SL   +  P       + F I  + G+I     +S  DIG Y+++V  SD      S +K+
Sbjct: 3058 KDINDNTP-YCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDF---SIGKESG--ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIIT--VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD------FGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSG-NEQGKFKM--------DSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL--------SNNAYVNIS------ILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIE------ESQYPPIV--------------TPLEVTINSFEDDFSGAFIGKVHA--SDQDKYDELNFSL---VSGPDDMYQSSKLFNISNNTGKI---YAISNLDIGLYKLNVSVSDGKFHVFSIVKI 3678          

HSP 6 Score: 140.584 bits (353), Expect = 6.627e-33
Identity = 188/758 (24.80%), Postives = 332/758 (43.80%), Query Frame = 3
Query:  435 YFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE--DENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV----IKFEVLDFNDNEPFFNQSTY--VITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-----SDIKVLLINLADIPPGLNNQK 2639
            YF +  K+G I TT+  +D E            +Q      V + D  S +   T+  +    D NDN P F    +K +    + +N    + I+   AID+D  E N +I Y +   + +  +  IDS+ G   + + K LD++++    + ++A + G+  KKSQ      +   V   + N P   + T   V+ + EN      + +I A+D D   +L Y + N         ++ Q+ G I+L++ LDYE  Q +   + V DG + A T + ++V DIND  P    +   + I EN+   + + Q+  +DRD      K   Y      +          SI+   N+  +  R+ F++           I    +      G  N    I     V + D ND+ P FT  I      E+  I + + +V A D+D G N+ I Y I+  N    F+ID   G I      +  ++  Y++ +KA D GNP L++ + V+I +    ++PP+   +++ ++E   N+ +G  +  + A+      +  I F+++  +    F I P+ G I    + D E    + + ++ ++   E+  +   ++ I ILD NDN P F++  Y+      A P +A      L +++     L T++  D D   NG + Y +   L    +F+ID   G I++ + L       Y   V  SD G P L     + + + +IN+ D PP  N ++
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE------------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN----QSIFQVHAIDSDSGE-NGRITYSIKSGKGKN-KFRIDSQRGH--IHIAKPLDSDNE--FEIHIKAEDNGIP-KKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD-DDNDQLWYNISNGND--DNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLHATQDPSSLALFRIDSIS--GNVI-VTQRLDFEKTA-------QHILIVFVKDQGAPGKRNYAKII-----VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKF-PTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQ---NIIIHILDANDNIPYFVQNEYVG-----ALPESAAIGSYVLKVHDSSKDHL-TLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERE 1936          

HSP 7 Score: 132.88 bits (333), Expect = 1.355e-30
Identity = 151/605 (24.96%), Postives = 253/605 (41.82%), Query Frame = 3
Query:  825 VVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            +++ + LD E Q +H +I+ A    +    +   +  +V D NDN P F+ + Y  ++ EN+    ++ K+ A D D      + Y L++  +  I+ +F +    GWI L   LD E+   + F V   D  +    A   + IK+ D ND  P   +    L++ EN + GT +  + + D D  +          D     Q         I +   +F  K     DRE+ +            +I +DG  T  A + I       ++D+NDN P   +  Y+I   E+  I   + +V A D D     R       ++DF I   SG +      DRE    Y +    QD  + +     ++ IT+ D NDN P + S + + V    +  L   I  + A D D   N +I++ LM  +  YF I+ + G I    S DRE    + + ++  D G   K  +   + + ILD+NDN P+F    Y  S   +   T+              G  +  + A  +D   N  I Y + +       F++D   G++ ++ TL       Y + + A D G PPLS+   + I++ DI
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE-NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQ---------IGKSGELFIAKP---LDREQLM-------FYNLSIIATDGKFTAKANVEID------VKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMP-IFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSMRQY--SCKILENATH--------------GTEVCKVYATSIDIGVNADIHYFI-MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          

HSP 8 Score: 127.102 bits (318), Expect = 7.163e-29
Identity = 190/773 (24.58%), Postives = 320/773 (41.40%), Query Frame = 3
Query:  399 TQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ--NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNE--PFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT---ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNI--------FEIKSRI----TFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVK---VNITIGDRNDNPPQLI-SSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKI---PLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             Q+ Y  S E   F++   +G +     +D E          K D   +  T          +      L +D NDN PVF  +    +  E +L R   + + +A+D D+   N +I + L +   +EE FR  ID  TG   +     LD E++  H +I+ A + G     S + I   ++D N+N   P F+   Y   + EN P  T +  + A D D     ++++Y +     L I   F V ++G I     LD E    +   +   D      +    + I+V + ND  P                         ++D+    VN      E   +  L+ F    DP+ T   NI        FEI S+     T +R+    N+  H +  A+   SD +G+     T    +SVL  D+NDN P F + +Y +    +  ++  I QV A D D G+N RITY I      N F+IDS  G I+  K  D +  + + + IKA+D+G P  + T +   V + +   + N P ++  +S+  V+   N   G  +  + A DDD   N ++ +++   +    ++    NG I      D E +  Y + + ++D         + +L ++++D+NDN PQF +  Y ++              I  +I E    +++ + A D D DK  K+ Y L     P  +   F ID   G + V+Q L       + + V   D G P   +   +++N+ D
Sbjct:  910 AQVTYALSVECSDFTVNATTGCLRLNKPLDRE----------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVRE-DLPRGTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFR--IDKHTGA--IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI---FAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIP-------------------------LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI---SD-NGSPVLSSTSRIVVSVL--DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD----GTFTAFTNLLVQVIDINDNPPQFAKDVYHVN--------------ISENIEE--ESVIMQLHATDRDEDK--KLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 9 Score: 115.931 bits (289), Expect = 1.785e-25
Identity = 152/569 (26.71%), Postives = 248/569 (43.59%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDY-EIDQMHLFVVEVFDGVY-------AASTTICIKVTDINDETPNIHINP-SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYE-----PDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGN--PSLNTTVKVNITIGDRNDNPPQLISSSD-FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDR-YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASD 2558
            I  +VLD ND  P F  + Y + IPE+TP   +I K+ A D D      + Y L     L     F +    G I L + L Y E     L VV    G +       A+ T + I V  +N   P I     S +T   N +     G ++++D+D+  +NG I   E     PDG       TF    + T++    E+      +++ F+ N         L + ++  GT   +     ++ + I+  + N P+FT+ IY +   E   I+  + ++  +D D G+N+ +  +I+   E ++F+I+  SG +   K  D E+   Y +T+ A D  N      ++ KV I++ D NDN P   + +   S+ EN N++   +  L AKD D  EN  I + +   +   F+I   +G +      D E   R Y + +R SD G   +++T + L I + D+NDN PQF        R N  G     + P+        G  +    AID DA     ISY L         F +D   G + +S  L ++ + +  + V A+D
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL-----LMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPL---IYGIVRVNDKDT-GINGNIGRLEIVDGNPDG-------TFLLKAAETKDEYYIELNQFAHLNQQHFIYN---------LTLLAEDLGT--PRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINEN-NLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF-------ERVNCYGKV-TKSAPM--------GTEVFVTSAIDFDA--GDIISYRLS-DGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 114.005 bits (284), Expect = 8.641e-25
Identity = 177/683 (25.92%), Postives = 291/683 (42.61%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLD-NSVKLAIRRLFLVQ-EEGWIILNRGLDYE-IDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPD-GMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINA--MKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGY-FDITPNGTIYAKVSFDREKEDRYCM----RLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            D ND+ P F  K    +  E   +   K+   +AID D +  N +I Y +   N    F   ID   G   + +  NL+      + + ++A + G     SQI +   V    ++ P F  +   I I EN P+ T + ++       TAR S  +  N +   I   F +    G I++N  +DYE I   +L V        ++   I I + D ND  P    N     + E+   G++V ++  S +D + +  K    + D G+N +  +    D +     N F+I S  T    E L   +   +   T  +  SD  G      T T  +++ + +VND  PVF E   N+        +  + QV A D D   N  + +DI++ N    F+I+  +G I     +I + E    Y + ++A D G  S    VK+ + +   + N      S  FS  EN N  +  IG +    + + EN E R  ++ P + +   I+        V FDRE +D Y +    +  + D    N +     + I +LDVNDN P F+  PY  +                +SI +  G I++ +KAIDLD+ +NG++ Y LK   G    F++DR  GE+ + Q +   +  +Y + V A D  + P S    L + + D
Sbjct: 1604 DHNDHHPEFTAKIIQSKVPESAAI-GSKLAEVRAIDRD-SGHNAEIQYSIITGNVGSVFE--IDPTFG--IITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQV-------TARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK----DADVGVNGMVEYHIVDDLA----KNFFKIDS--TTGAIELLRQLDYETNAGYTFDVTVSD-MGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD-GIFSAILIVKIKV-LSAIDSNFAFQRESYRFSAFEN-NTKVATIGLVNVIGNTLDENVEYR--ILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYAT----------------VSIDDPKGTIIMQVKAIDLDSAENGEVRYELK--KGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVID 2235          

HSP 11 Score: 113.62 bits (283), Expect = 8.715e-25
Identity = 125/442 (28.28%), Postives = 201/442 (45.48%), Query Frame = 3
Query: 1287 PSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEEN--RNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG--YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDN--SPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLD-ADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD 2582
            P +L+I E++  G  V  I+  DRD +  NGK+     DG  +   F   PD          E++     DRE    NE +  I          +   N   + +  L + I DVNDNRPV  +++      E+  I   +H + ATD D G N+++TY + +E +DF +++ +G +   K  DRE+ D+Y + I A+D G+P L++   V + + D NDN P   +    F V E+  R   L  I   +A D+DI  N EI+F L    +    F I  + G I  +   D E +  + + +   D G +    + + + I I+DVN+N  +P+F +  Y           N P            G  ++ + A D+D  D N KI+YS+    G+   F ++  G    +SQ L       Y + + A D  + PLS+
Sbjct:  776 PQELSINESVQLGETVAWIEAKDRD-LGYNGKLVFAISDGDYD-SVFRIDPDRG--------ELQIIGYLDRER--QNEYVLNITV--------YDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVI---EAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVY-----EGKVKENKPK-----------GTFVMNVTARDMDTVDLNSKITYSITGGDGLG-IFAVNDQGSITSLSQ-LDAETKNFYWLTLCAQDCAIVPLSN 1175          

HSP 12 Score: 110.538 bits (275), Expect = 8.210e-24
Identity = 164/671 (24.44%), Postives = 296/671 (44.11%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNI-YKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY--EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLAT----DKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL---KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            D NDN P+F      +    I+  +   I   +AID D  E N ++ YEL +   E F+L  D K+G+  + + ++++  ++ N+ + + A++  +    S+  ++ +V+D   + P F +  Y +++ E+  + + +   IEA  P     L   L  ++    +   +    G I +   LDYE    H   +   D   GVYA    + + + D+ND  P I  +   LTI EN   GT + +I  +D DS   N K+  Y    +G NN + F          + N++ +K+ + +++ ++ +          +++    HG+    L+    + + ++D+NDN P F E  Y         + A   Q +A     DKD      + Y I+  N+   + ID ++G I+   + +  +    V+ I   D  + +     ++ I++   N   P L   S +  +   N+  G  I  +KA D D      + ++++    K  F I    G I +KV+FDREK+D Y + L++SD G    +  +  L + ++DVNDN P F+   Y +            +T +E +      Q ++T+KA D D   NG + + +        V    EI+   G+I          + SY+  V ASD G P
Sbjct: 2132 DVNDNCPLF-VNMPYYATVSIDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNGELFKL--DRKSGE--LSIKQHVEGHNR-NYELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESP-----LGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYA-EVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDS-GANAKLSYYIESINGQNNSELFYID-----VTDGNLY-LKTPLDYEQIKYHH----------IVVNVKDHGS--PSLSSRSNVFITVKDLNDNAPCFVEPSY----FTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSP-LFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG---GKFGFASLKVIVVDVNDNVPYFLLKEYKM----------VVSTTVEAN------QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEP 2741          

HSP 13 Score: 110.153 bits (274), Expect = 1.150e-23
Identity = 177/719 (24.62%), Postives = 318/719 (44.23%), Query Frame = 3
Query:  555 VNVWDENS-FLAIITTVFL-FEDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLV-QEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT------------LSVLIEDVNDNRPVFTESIYNIFFMEN---NHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH---KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPP 2621
            VNV D  S  L+  + VF+  +D NDN P F  P  F    +  +  +R + + LP+A D D+++ +      ++ NE + +  +ID  TG   V+ L+N+   +  + TV+  + ++G+    +++  K  +L  N   P F+QSTY   +PEN     NI  ++A D D    A L Y +   V   ++++FL+ Q  G I      D E    ++ +++V DG       ++ + V D+ND  P   +   K+ +   + +   +  +K  D D V+ NG +         + Q         I Q+SN   +K  I         NE+   I       ++ +G N+ Q  +  +            +S+ I + + N P F +S   +  +E+     +   +H +         N    + I    D  + S SG +   +  DRE+ + + + + A+    P       V I + D NDN P+  ++    SV EN    +  +  + A D D   NG+IR+ L       +  FDI   +G I    S DRE +  Y  ++  +DNG   K +  V + IKI+D NDN+P F  P        I G          LS++E  +PG +L+ +  ID D +K  ++ + + +       F+I +  GE+ +++ L R  +  Y + +IA+D      +++++ + ++ D  P
Sbjct: 2419 VNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFT---KVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY--SIDKLTG---VISLQNMLNFTDKSSTVLNISVSDGVHTAYARL--KISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVD-NGSV---------HFQ---------IVQKSNDKAVKDVIEI-------NEKTGDI--VFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI--------GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVK-VSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHP-KHDAKVPVTIKIVDYNDNAPVFKLP--------IEG----------LSVFENALPGTVLINLLLIDPDIEKQ-EMDFFI-VSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP 3065          

HSP 14 Score: 103.219 bits (256), Expect = 1.502e-21
Identity = 159/661 (24.05%), Postives = 271/661 (41.00%), Query Frame = 3
Query:  639 FPFKFKTHRESEI-NLLRDRKIYLPQAIDNDVTEK-NRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWN---EGMKE--KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEI--KSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            F F+ +++R S   N  +   I L   I N + E    +IL     N  + F + I S   K   V+    D E +  + + +EA +   +GM    +++   I   VLD NDN P F    Y  T+  + P  T I +++AID D       R +  +K     LF L ++ G + + + ++   ++ +   V  +DG +   S+   ++V  I+   P        +++KE+         +++    SV +  +     P G + +         +I+ ES  FEI   +   F   E L+ E+I     ++       G     +     LSV I DVND  P     IYN+   EN      I ++ ATD D G N++++Y I   N       F ID   G +      D E++ ++ + +  +DHG+PSL++   V IT+ D NDN P  +  S F+      V    +   KA D DI++   + + +++ +  + Y      G I  +   +   +    + + +SD         Y  L I +L  N  SP F +  Y                P  L    + G  ++T+KA D D      + Y + +   + + F ID+  G I    T  R     Y + +  SD G
Sbjct: 2031 FAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRIL-----NPTQLFDIGISSGALKTTGVIF---DREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYE--LKKGNGELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKED---------VEMYSALSVSIEAE----SPLGRSLIY--------TISSESQSFEIDYNTGSIFVVNE-LDYEKISSHDVSIRATDSLSG-----VYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD----GVHTAYARLKISLLPENVYSPLFDQSTY------------EAQVPENL----LHGHNIITVKASDGDFGTYANLYYEI-VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG 2632          

HSP 15 Score: 101.293 bits (251), Expect = 5.056e-21
Identity = 167/670 (24.93%), Postives = 266/670 (39.70%), Query Frame = 3
Query:  402 QLRYKFSKEN--KYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELH--QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVN---GKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE----------GQNSRITYDI---LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIG--DRNDNPPQLISSSDFSVEENRNVSLGP-------IGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFD---REKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS 2294
            QL Y  S  N    F + + +G I     +D E             Q +   T++V D  +F A    +    D NDN P F  K   H     N+  +  I    A D D   +++K+ Y LH  Q+        IDS +G   V+V + LD E  + H +I+   ++G   K++   I   V D ND+ P F        +PE+  + + + ++ AID D    A + Y +   +   +  +F +    G I L   L+    Q ++  V+  D      ++   + I VT   ++ P    N   + I ENL  GTFV Q+      S+  N   G I              +F  +PS    + +  I   I ++  +  N          L +     GTN A  +    + + I D NDN P F ++ Y     E+  I +++ +V  + KD           G N  + Y I   L  N FKIDS +G I  ++  D E    Y   +   D G P L++T   ++TI   + ND PP          E   NV+L         +  + AKD   A+N  +RFD++  +    F I     I    +F+    E +  Y + +R SD          + + IK+L   D++  F    Y  S
Sbjct: 1438 QLWYNISNGNDDNTFYIGQDNGNILLSKYLDYET------------QQSYNLTISVTD-GTFTAFTNLLVQVIDINDNPPQFA-KDVYHVNISENIEEESVIMQLHATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGN--VIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNI------------NESFRINPS----TGVIVINGNIDYESIKVFN----------LTV----KGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-------NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD----GIFSAILIVKIKVLSAIDSNFAFQRESYRFS 2041          

HSP 16 Score: 100.138 bits (248), Expect = 1.278e-20
Identity = 87/334 (26.05%), Postives = 146/334 (43.71%), Query Frame = 3
Query: 1632 NDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            N +RP F      +   E+  +   +  + A D+D G N ++ + I + +    F+ID   G +  +   DRE  + YV+ I   D GNP+ +T+  + ITI D NDN P +I  +  +     +  +G + + L A D D   N ++ + L      +      G +      DREK+D Y + +   D G      E  V++ +   DVNDN+P F    Y+   R+++                   G +L  I+A+D D   N +I +SLK        F ID+  G I+    L   +   + + V A D G P L+    ++I + D+
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRP-VIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVD--DVNDNAPVFGVQEYIFKVREDLP-----------------RGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 17 Score: 94.3597 bits (233), Expect = 6.816e-19
Identity = 134/549 (24.41%), Postives = 242/549 (44.08%), Query Frame = 3
Query:  612 EDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVK--LAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTI-----CIKVTDINDETPNIHINPSK--LTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNG 2195
            E+ENDN+P+   P  +    E+ +    + +I   +A D D+ +  + I Y +   N   +F   IDSKTG       + LD E+Q+ H + +   + G     S   I   VLD NDN P F+Q  Y + +P +  ++ +I+++ AI  D  +  + R+  S+K      +  +  + G I + + LD + ++  + +    +G+   S T       + V   +   P I    S+  + + EN   G  V QI   D D+ ++   I     D        TF+    I Q++    +   + ++ ++  N           L  S   GT  A     FT L V + D+NDN P F + +Y++   EN    + I Q+ ATD+DE  + ++ Y +  + D      F+IDS+SG +   +  D E+   +++ +  +D G P      K+ + + D ND+ P+  +    S           +  ++A D D   N EI++ ++  + G  F+I P  G I    + +  K   Y ++++  D G
Sbjct: 1184 ENENDNIPLTDKPVYYVNVTEASV---ENVEIITLKAFDPDI-DPTQTITYNIVSGNLVGYFE--IDSKTG-VIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAI--DSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD-NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDN-------TFY----IGQDNGNILLSKYLDYETQQSYN-----------LTISVTDGTFTA-----FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLG 1693          

HSP 18 Score: 74.3294 bits (181), Expect = 7.693e-13
Identity = 137/581 (23.58%), Postives = 246/581 (42.34%), Query Frame = 3
Query:  969 FNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAI-----RRLFLVQEE--------------GWIILNRGL--DYEID-QMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPS-IT-------QESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRP-VFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRIT-YDILESN---DFKIDSVSG---WINAMKIFDREEMDHYV--VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGK-ENKQETYVHLCIKILDVNDNSPQFMEPPYLLS--RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIG-SYRIHVIASDNGVP 2570
            F+ S Y +TIPEN+   T     + +  ++ A L   L+  VK  I      +LF  +E+                ++LNR    +Y I  + H+ + +     Y     I IKV D ND +P  +     + I E+      + ++   D D + +NG+I  Y    M++ + F  HP    IT        E++ FE+ + + +DR  ++N++     +T                     +S+ ++ VN   P +FT++  ++    N  I+  +      DKD G N  I   +I++ N    F + +      +   +  F      H++  +T+ A+D G P       V I I   + N P       + S+ E   +++ P+  LK  D D+ +N  +  +++  ++G  F I P+ G +Y     D EK+  Y + +   D     +++++   + I + D+NDN P F     ++S   +N+A                  G  +V + A D D+ +N  ISYS+     VP  FEID   G +K +  L    +  +Y + + ASD G+P
Sbjct:   62 FSHSVYNVTIPENSLGKT---YAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDAD-LGINGEI--YYSLLMDS-EYFAIHPTTGEITLLQQLQYAENSHFEL-TVVAYDRGSWVNHQNHQASKTK--------------------VSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVR---VNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINM-PVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA------------------GSFVVKLTAKDRDSGENSYISYSIANLNAVP--FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLP 590          
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 182.956 bits (463), Expect = 6.886e-46
Identity = 197/745 (26.44%), Postives = 334/745 (44.83%), Query Frame = 3
Query:  405 LRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD-KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY-EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             ++  + +  +F +++ SG +  + T+D E+       N      T T  V       F A    +    DENDN P F   F +   +E N  +   +    A D D T  N  I Y L  + E    + +ID  +G  ++ +L +LD E QS +   + A + G  +  +++ +  +++D+NDN P F      +++ EN    T +  +  IDPD +   + + + +  K A    F + + G + + + LD E    +   +   DG + A   + I V DIND TP        ++  E++  GT + ++K  D D      K+  Y    G +         D SI +ES I ++ S    DRE         P    +    DG        +    + + + D+NDN P+F+ + Y +   E+  ++  I +V A DKD G N +I Y ++  N   FKI   +G I   K  DRE +  + +T+KA+D G P L++   V + I D NDNPP+  S   +S +   N + G  +  + A   DI  N +I + +M  + +G F + +  G +    + D E    Y + ++  D G        YV+  I ILD+NDNSP F++  Y ++              +   I+   G  ++ +KA D D+D NG ++Y+++    + + F ID   G I VS+ L R  I  Y + + A D G P   +   + IN+ D
Sbjct: 2793 FKFSIAADQDHFMISD-SGELILQQTLDREQ---QESHNLIVVAETSTVPV-------FFAYADVLIDVRDENDNYPKFDNTFYSASVAE-NSEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSG--WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQA---QFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGAD---------DFSIGKESGILKVAS--ALDRE-------TTPKYKLVAHVQDGKDFTQECFS---EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF-SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVN--ISILDINDNSPTFLQNLYRIN--------------VNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 154.451 bits (389), Expect = 3.910e-37
Identity = 168/636 (26.42%), Postives = 291/636 (45.75%), Query Frame = 3
Query:  741 NRKILYELHQNE-EEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE-FLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNR--PVFTESIYNIFFMENNHIHAHIHQVLATDKDE-GQNSRITYDILESNDFKIDSVS--GWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDN------PPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTI-YAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS 2579
            N K+++ +   + +  FR  ID   G+  + ++  LD E Q+ + + +  ++ G   K +  ++   +LD NDN P   ++     + E+  + T ++ + A D D    A+++Y L     +      +    G + LN+ LD E    +   +   DG   V ++   + + V D+ND  P   +      ++E+L  GT +  I+  D D              G N    F+   +   TQ+  +F I       R + +L+  N+++H +  + +   DG    +  LT   ++ ++I DVN+NR  P F + +Y     EN      +  V A D D    NS+ITY I   +   I +V+  G I ++   D E  + Y +T+ AQD     L+  V+V I + + NDN      P   ++ ++ SVE   NV    I  LKA D DI     I ++++  +  GYF+I +  G I   +   DRE +  + + + ISDNG      T   + + +LD+NDNSP+F +  Y      +  P++A              Q +  + AID D+ +NG+I+YS+K   G  + F ID   G I +++ L   +   + IH+ A DNG+P  S
Sbjct:  804 NGKLVFAISDGDYDSVFR--IDPDRGE--LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDI-------------GPNAEIQFSLKEE---TQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI---DG---GDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVE---NVE---IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVY-----KVQVPSSATVN-----------QSIFQVHAIDSDSGENGRITYSIKSGKGKNK-FRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKS 1383          

HSP 3 Score: 151.369 bits (381), Expect = 3.407e-36
Identity = 187/683 (27.38%), Postives = 302/683 (44.22%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEF-LNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDL-MWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLG-VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-SD--IKVLLINLADIPP 2621
            D NDN PVF    +     E N L    +     ID D+ EK     + +  +++  F++    K+G+ F+   K LD E    + + + A +     K +   ++ +V D NDN P+  +  Y I+  E+  + T + +++AID D  ++L + L            + +E G + +   LD E    +  V  V DG        + I I V DIND  P   +   ++++ E+    T + ++   D+D   VN +I  Y   G N       H    I++ + I  I+   + DRE   L N         L + ++  G    +L    T++V I D+NDN P F+   Y+   +EN      + +V AT  D G N+ I Y I+  N+   FK+DS +G +      D E    Y +TI+A D G P L+    VNI+I D NDN P  + +  + +  N ++ +G  I  +KA D+D   NG + +++    + G F I P NGTI      DRE    Y + ++  D G   +  + V + I ILD NDN+P F    Y                 + L    + G + +T K  D D   N    Y+  I  G     F +++DG  ++ +   + +    + I V   DNG PPL SD  + V +I  +  PP
Sbjct: 2959 DYNDNAPVFKLPIEGLSVFE-NALPGTVLINLLLIDPDI-EKQEMDFFIVSGDKQAQFQI---GKSGELFIA--KPLDREQLMFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGK---GADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD-FGVNRQIK-YSLMGEN-------HDYFKISKSTGI--IRLHKSLDRETISLFN---------LTVKAEDCGV--PKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNL-YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNS-VPININILDTNDNAPIFSSSNY----------------SVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGS-LRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPP 3586          

HSP 4 Score: 144.821 bits (364), Expect = 3.329e-34
Identity = 205/774 (26.49%), Postives = 329/774 (42.51%), Query Frame = 3
Query:  402 QLRYKFSKEN-KYFSLTEKSGTITTKSTIDLE--------EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDV-TEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLT-IKENLISGTFVGQIK-----ISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITF-DREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAH-IHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF----SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDIT----PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            ++RY+  K N + F L  KSG ++ K  ++             D     C ++ P     V V D +                  +PVF  +F T     +++  D ++Y   ++  +  +   R ++Y +    + F    ID  TG  FVV    LD E  S+H V + A  + +    +++V+   ++D ND  P      Y +TIPEN    T I KI A D D    A+LSY +++        LF +   +G + L   LDYE  + H  VV V D      ++ + + I V D+ND  P   + PS  T +    + G FV   K     ISD DS+E       Y+    N LQ +      SI + + +  +++ + F D+   + N          +  SDG  T  A+L I    S+L E+V    P+F +S Y     EN  +H H I  V A+D D G  + + Y+I+       F ID  +G I +   FDRE+ D YVV +K  D G      ++KV +     ++ P  L+         +VE N+ +       +KAKDDDI +NG + F ++     K   D+       G I  K   +    + Y   +R SD G E +  + V + I+I++ + N P F +   LL            +TP        PG +L  +  I          +Y+ K  +   +   +  D GE+ + QTL R    S+ + V+A  + VP       +LI++ D
Sbjct: 2174 EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQ---VKVIDRS------------------MPVFEKQFYT-----VSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSF---EIDYNTGSIFVV--NELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAP-CFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLE-------YKIVYGNELQTY------SIDKLTGVISLQNMLNFTDKSSTVLN----------ISVSDGVHTAYARLKI----SLLPENVY--SPLFDQSTYEAQVPEN-LLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD-VNDNVPYFLLKEYKMVVSTTVEANQTILT-----VKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRG-EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKI--------IESTP--------PGTVLTKLHMIG---------NYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRD 2852          

HSP 5 Score: 141.739 bits (356), Expect = 2.995e-33
Identity = 178/691 (25.76%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVI--LEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRR-----LFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE----FLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSV--EENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIY----EIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-------RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKV 2591
            +D NDN P +  K + H  +  ++     +   +AID D   K R   Y   +  ++F   +I  ++G   + V   LD E+   + ++  ++   +  +E  S+I+I   V D NDN P F+ + Y +++PE+  L+T I K+ A+D D      + ++  +K ++         + +  G I L++ LD E   +    V+  D GV    +  T+ + + DIND  P   +      I EN   GT V ++  +  D + VN  I  +   G N    F          +S   ++    T D E     FL  + I      L        +NNA + I+      I D+NDN P F +++Y I   E+  + + I  V ATD+D   N  +TY+I   ++   F ID  +G I+  +  DRE + HY + I+A D G+P    +V +NI I D NDN P + SSS++SV  +ENR +    + +  +  D+        FD+   ++ G F +  +G++     F+   +D + +++R+ DNG      +   + +KI++      +   PP +              TP+E++I     +  G  +  + A   D DK  ++++SL   +  P       + F I  + G+I     +S  DIG Y+++V  SD      S +K+
Sbjct: 3058 KDINDNTP-YCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDF---SIGKESG--ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIIT--VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD------FGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSG-NEQGKFKM--------DSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL--------SNNAYVNIS------ILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIE------ESQYPPIV--------------TPLEVTINSFEDDFSGAFIGKVHA--SDQDKYDELNFSL---VSGPDDMYQSSKLFNISNNTGKI---YAISNLDIGLYKLNVSVSDGKFHVFSIVKI 3678          

HSP 6 Score: 140.584 bits (353), Expect = 6.627e-33
Identity = 188/758 (24.80%), Postives = 332/758 (43.80%), Query Frame = 3
Query:  435 YFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE--DENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV----IKFEVLDFNDNEPFFNQSTY--VITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-----SDIKVLLINLADIPPGLNNQK 2639
            YF +  K+G I TT+  +D E            +Q      V + D  S +   T+  +    D NDN P F    +K +    + +N    + I+   AID+D  E N +I Y +   + +  +  IDS+ G   + + K LD++++    + ++A + G+  KKSQ      +   V   + N P   + T   V+ + EN      + +I A+D D   +L Y + N         ++ Q+ G I+L++ LDYE  Q +   + V DG + A T + ++V DIND  P    +   + I EN+   + + Q+  +DRD      K   Y      +          SI+   N+  +  R+ F++           I    +      G  N    I     V + D ND+ P FT  I      E+  I + + +V A D+D G N+ I Y I+  N    F+ID   G I      +  ++  Y++ +KA D GNP L++ + V+I +    ++PP+   +++ ++E   N+ +G  +  + A+      +  I F+++  +    F I P+ G I    + D E    + + ++ ++   E+  +   ++ I ILD NDN P F++  Y+      A P +A      L +++     L T++  D D   NG + Y +   L    +F+ID   G I++ + L       Y   V  SD G P L     + + + +IN+ D PP  N ++
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE------------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN----QSIFQVHAIDSDSGE-NGRITYSIKSGKGKN-KFRIDSQRGH--IHIAKPLDSDNE--FEIHIKAEDNGIP-KKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD-DDNDQLWYNISNGND--DNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLHATQDPSSLALFRIDSIS--GNVI-VTQRLDFEKTA-------QHILIVFVKDQGAPGKRNYAKII-----VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKF-PTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQ---NIIIHILDANDNIPYFVQNEYVG-----ALPESAAIGSYVLKVHDSSKDHL-TLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERE 1936          

HSP 7 Score: 132.88 bits (333), Expect = 1.355e-30
Identity = 151/605 (24.96%), Postives = 253/605 (41.82%), Query Frame = 3
Query:  825 VVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            +++ + LD E Q +H +I+ A    +    +   +  +V D NDN P F+ + Y  ++ EN+    ++ K+ A D D      + Y L++  +  I+ +F +    GWI L   LD E+   + F V   D  +    A   + IK+ D ND  P   +    L++ EN + GT +  + + D D  +          D     Q         I +   +F  K     DRE+ +            +I +DG  T  A + I       ++D+NDN P   +  Y+I   E+  I   + +V A D D     R       ++DF I   SG +      DRE    Y +    QD  + +     ++ IT+ D NDN P + S + + V    +  L   I  + A D D   N +I++ LM  +  YF I+ + G I    S DRE    + + ++  D G   K  +   + + ILD+NDN P+F    Y  S   +   T+              G  +  + A  +D   N  I Y + +       F++D   G++ ++ TL       Y + + A D G PPLS+   + I++ DI
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE-NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQ---------IGKSGELFIAKP---LDREQLM-------FYNLSIIATDGKFTAKANVEID------VKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMP-IFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSMRQY--SCKILENATH--------------GTEVCKVYATSIDIGVNADIHYFI-MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          

HSP 8 Score: 127.102 bits (318), Expect = 7.163e-29
Identity = 190/773 (24.58%), Postives = 320/773 (41.40%), Query Frame = 3
Query:  399 TQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ--NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNE--PFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT---ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNI--------FEIKSRI----TFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVK---VNITIGDRNDNPPQLI-SSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKI---PLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             Q+ Y  S E   F++   +G +     +D E          K D   +  T          +      L +D NDN PVF  +    +  E +L R   + + +A+D D+   N +I + L +   +EE FR  ID  TG   +     LD E++  H +I+ A + G     S + I   ++D N+N   P F+   Y   + EN P  T +  + A D D     ++++Y +     L I   F V ++G I     LD E    +   +   D      +    + I+V + ND  P                         ++D+    VN      E   +  L+ F    DP+ T   NI        FEI S+     T +R+    N+  H +  A+   SD +G+     T    +SVL  D+NDN P F + +Y +    +  ++  I QV A D D G+N RITY I      N F+IDS  G I+  K  D +  + + + IKA+D+G P  + T +   V + +   + N P ++  +S+  V+   N   G  +  + A DDD   N ++ +++   +    ++    NG I      D E +  Y + + ++D         + +L ++++D+NDN PQF +  Y ++              I  +I E    +++ + A D D DK  K+ Y L     P  +   F ID   G + V+Q L       + + V   D G P   +   +++N+ D
Sbjct:  910 AQVTYALSVECSDFTVNATTGCLRLNKPLDRE----------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVRE-DLPRGTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFR--IDKHTGA--IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI---FAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIP-------------------------LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI---SD-NGSPVLSSTSRIVVSVL--DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD----GTFTAFTNLLVQVIDINDNPPQFAKDVYHVN--------------ISENIEE--ESVIMQLHATDRDEDK--KLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 9 Score: 115.931 bits (289), Expect = 1.785e-25
Identity = 152/569 (26.71%), Postives = 248/569 (43.59%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDY-EIDQMHLFVVEVFDGVY-------AASTTICIKVTDINDETPNIHINP-SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYE-----PDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGN--PSLNTTVKVNITIGDRNDNPPQLISSSD-FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDR-YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASD 2558
            I  +VLD ND  P F  + Y + IPE+TP   +I K+ A D D      + Y L     L     F +    G I L + L Y E     L VV    G +       A+ T + I V  +N   P I     S +T   N +     G ++++D+D+  +NG I   E     PDG       TF    + T++    E+      +++ F+ N         L + ++  GT   +     ++ + I+  + N P+FT+ IY +   E   I+  + ++  +D D G+N+ +  +I+   E ++F+I+  SG +   K  D E+   Y +T+ A D  N      ++ KV I++ D NDN P   + +   S+ EN N++   +  L AKD D  EN  I + +   +   F+I   +G +      D E   R Y + +R SD G   +++T + L I + D+NDN PQF        R N  G     + P+        G  +    AID DA     ISY L         F +D   G + +S  L ++ + +  + V A+D
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL-----LMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPL---IYGIVRVNDKDT-GINGNIGRLEIVDGNPDG-------TFLLKAAETKDEYYIELNQFAHLNQQHFIYN---------LTLLAEDLGT--PRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINEN-NLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF-------ERVNCYGKV-TKSAPM--------GTEVFVTSAIDFDA--GDIISYRLS-DGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 114.005 bits (284), Expect = 8.641e-25
Identity = 177/683 (25.92%), Postives = 291/683 (42.61%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLD-NSVKLAIRRLFLVQ-EEGWIILNRGLDYE-IDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPD-GMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINA--MKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGY-FDITPNGTIYAKVSFDREKEDRYCM----RLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            D ND+ P F  K    +  E   +   K+   +AID D +  N +I Y +   N    F   ID   G   + +  NL+      + + ++A + G     SQI +   V    ++ P F  +   I I EN P+ T + ++       TAR S  +  N +   I   F +    G I++N  +DYE I   +L V        ++   I I + D ND  P    N     + E+   G++V ++  S +D + +  K    + D G+N +  +    D +     N F+I S  T    E L   +   +   T  +  SD  G      T T  +++ + +VND  PVF E   N+        +  + QV A D D   N  + +DI++ N    F+I+  +G I     +I + E    Y + ++A D G  S    VK+ + +   + N      S  FS  EN N  +  IG +    + + EN E R  ++ P + +   I+        V FDRE +D Y +    +  + D    N +     + I +LDVNDN P F+  PY  +                +SI +  G I++ +KAIDLD+ +NG++ Y LK   G    F++DR  GE+ + Q +   +  +Y + V A D  + P S    L + + D
Sbjct: 1604 DHNDHHPEFTAKIIQSKVPESAAI-GSKLAEVRAIDRD-SGHNAEIQYSIITGNVGSVFE--IDPTFG--IITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQV-------TARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK----DADVGVNGMVEYHIVDDLA----KNFFKIDS--TTGAIELLRQLDYETNAGYTFDVTVSD-MGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD-GIFSAILIVKIKV-LSAIDSNFAFQRESYRFSAFEN-NTKVATIGLVNVIGNTLDENVEYR--ILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYAT----------------VSIDDPKGTIIMQVKAIDLDSAENGEVRYELK--KGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVID 2235          

HSP 11 Score: 113.62 bits (283), Expect = 8.715e-25
Identity = 125/442 (28.28%), Postives = 201/442 (45.48%), Query Frame = 3
Query: 1287 PSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEEN--RNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG--YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDN--SPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLD-ADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD 2582
            P +L+I E++  G  V  I+  DRD +  NGK+     DG  +   F   PD          E++     DRE    NE +  I          +   N   + +  L + I DVNDNRPV  +++      E+  I   +H + ATD D G N+++TY + +E +DF +++ +G +   K  DRE+ D+Y + I A+D G+P L++   V + + D NDN P   +    F V E+  R   L  I   +A D+DI  N EI+F L    +    F I  + G I  +   D E +  + + +   D G +    + + + I I+DVN+N  +P+F +  Y           N P            G  ++ + A D+D  D N KI+YS+    G+   F ++  G    +SQ L       Y + + A D  + PLS+
Sbjct:  776 PQELSINESVQLGETVAWIEAKDRD-LGYNGKLVFAISDGDYD-SVFRIDPDRG--------ELQIIGYLDRER--QNEYVLNITV--------YDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVI---EAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVY-----EGKVKENKPK-----------GTFVMNVTARDMDTVDLNSKITYSITGGDGLG-IFAVNDQGSITSLSQ-LDAETKNFYWLTLCAQDCAIVPLSN 1175          

HSP 12 Score: 110.538 bits (275), Expect = 8.210e-24
Identity = 164/671 (24.44%), Postives = 296/671 (44.11%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNI-YKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY--EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLAT----DKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL---KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            D NDN P+F      +    I+  +   I   +AID D  E N ++ YEL +   E F+L  D K+G+  + + ++++  ++ N+ + + A++  +    S+  ++ +V+D   + P F +  Y +++ E+  + + +   IEA  P     L   L  ++    +   +    G I +   LDYE    H   +   D   GVYA    + + + D+ND  P I  +   LTI EN   GT + +I  +D DS   N K+  Y    +G NN + F          + N++ +K+ + +++ ++ +          +++    HG+    L+    + + ++D+NDN P F E  Y         + A   Q +A     DKD      + Y I+  N+   + ID ++G I+   + +  +    V+ I   D  + +     ++ I++   N   P L   S +  +   N+  G  I  +KA D D      + ++++    K  F I    G I +KV+FDREK+D Y + L++SD G    +  +  L + ++DVNDN P F+   Y +            +T +E +      Q ++T+KA D D   NG + + +        V    EI+   G+I          + SY+  V ASD G P
Sbjct: 2132 DVNDNCPLF-VNMPYYATVSIDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNGELFKL--DRKSGE--LSIKQHVEGHNR-NYELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESP-----LGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYA-EVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDS-GANAKLSYYIESINGQNNSELFYID-----VTDGNLY-LKTPLDYEQIKYHH----------IVVNVKDHGS--PSLSSRSNVFITVKDLNDNAPCFVEPSY----FTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSP-LFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG---GKFGFASLKVIVVDVNDNVPYFLLKEYKM----------VVSTTVEAN------QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEP 2741          

HSP 13 Score: 110.153 bits (274), Expect = 1.150e-23
Identity = 177/719 (24.62%), Postives = 318/719 (44.23%), Query Frame = 3
Query:  555 VNVWDENS-FLAIITTVFL-FEDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLV-QEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT------------LSVLIEDVNDNRPVFTESIYNIFFMEN---NHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH---KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPP 2621
            VNV D  S  L+  + VF+  +D NDN P F  P  F    +  +  +R + + LP+A D D+++ +      ++ NE + +  +ID  TG   V+ L+N+   +  + TV+  + ++G+    +++  K  +L  N   P F+QSTY   +PEN     NI  ++A D D    A L Y +   V   ++++FL+ Q  G I      D E    ++ +++V DG       ++ + V D+ND  P   +   K+ +   + +   +  +K  D D V+ NG +         + Q         I Q+SN   +K  I         NE+   I       ++ +G N+ Q  +  +            +S+ I + + N P F +S   +  +E+     +   +H +         N    + I    D  + S SG +   +  DRE+ + + + + A+    P       V I + D NDN P+  ++    SV EN    +  +  + A D D   NG+IR+ L       +  FDI   +G I    S DRE +  Y  ++  +DNG   K +  V + IKI+D NDN+P F  P        I G          LS++E  +PG +L+ +  ID D +K  ++ + + +       F+I +  GE+ +++ L R  +  Y + +IA+D      +++++ + ++ D  P
Sbjct: 2419 VNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFT---KVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY--SIDKLTG---VISLQNMLNFTDKSSTVLNISVSDGVHTAYARL--KISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVD-NGSV---------HFQ---------IVQKSNDKAVKDVIEI-------NEKTGDI--VFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI--------GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVK-VSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHP-KHDAKVPVTIKIVDYNDNAPVFKLP--------IEG----------LSVFENALPGTVLINLLLIDPDIEKQ-EMDFFI-VSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP 3065          

HSP 14 Score: 103.219 bits (256), Expect = 1.502e-21
Identity = 159/661 (24.05%), Postives = 271/661 (41.00%), Query Frame = 3
Query:  639 FPFKFKTHRESEI-NLLRDRKIYLPQAIDNDVTEK-NRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWN---EGMKE--KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEI--KSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            F F+ +++R S   N  +   I L   I N + E    +IL     N  + F + I S   K   V+    D E +  + + +EA +   +GM    +++   I   VLD NDN P F    Y  T+  + P  T I +++AID D       R +  +K     LF L ++ G + + + ++   ++ +   V  +DG +   S+   ++V  I+   P        +++KE+         +++    SV +  +     P G + +         +I+ ES  FEI   +   F   E L+ E+I     ++       G     +     LSV I DVND  P     IYN+   EN      I ++ ATD D G N++++Y I   N       F ID   G +      D E++ ++ + +  +DHG+PSL++   V IT+ D NDN P  +  S F+      V    +   KA D DI++   + + +++ +  + Y      G I  +   +   +    + + +SD         Y  L I +L  N  SP F +  Y                P  L    + G  ++T+KA D D      + Y + +   + + F ID+  G I    T  R     Y + +  SD G
Sbjct: 2031 FAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRIL-----NPTQLFDIGISSGALKTTGVIF---DREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYE--LKKGNGELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKED---------VEMYSALSVSIEAE----SPLGRSLIY--------TISSESQSFEIDYNTGSIFVVNE-LDYEKISSHDVSIRATDSLSG-----VYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD----GVHTAYARLKISLLPENVYSPLFDQSTY------------EAQVPENL----LHGHNIITVKASDGDFGTYANLYYEI-VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG 2632          

HSP 15 Score: 101.293 bits (251), Expect = 5.056e-21
Identity = 167/670 (24.93%), Postives = 266/670 (39.70%), Query Frame = 3
Query:  402 QLRYKFSKEN--KYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELH--QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVN---GKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE----------GQNSRITYDI---LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIG--DRNDNPPQLISSSDFSVEENRNVSLGP-------IGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFD---REKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS 2294
            QL Y  S  N    F + + +G I     +D E             Q +   T++V D  +F A    +    D NDN P F  K   H     N+  +  I    A D D   +++K+ Y LH  Q+        IDS +G   V+V + LD E  + H +I+   ++G   K++   I   V D ND+ P F        +PE+  + + + ++ AID D    A + Y +   +   +  +F +    G I L   L+    Q ++  V+  D      ++   + I VT   ++ P    N   + I ENL  GTFV Q+      S+  N   G I              +F  +PS    + +  I   I ++  +  N          L +     GTN A  +    + + I D NDN P F ++ Y     E+  I +++ +V  + KD           G N  + Y I   L  N FKIDS +G I  ++  D E    Y   +   D G P L++T   ++TI   + ND PP          E   NV+L         +  + AKD   A+N  +RFD++  +    F I     I    +F+    E +  Y + +R SD          + + IK+L   D++  F    Y  S
Sbjct: 1438 QLWYNISNGNDDNTFYIGQDNGNILLSKYLDYET------------QQSYNLTISVTD-GTFTAFTNLLVQVIDINDNPPQFA-KDVYHVNISENIEEESVIMQLHATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGN--VIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNI------------NESFRINPS----TGVIVINGNIDYESIKVFN----------LTV----KGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-------NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD----GIFSAILIVKIKVLSAIDSNFAFQRESYRFS 2041          

HSP 16 Score: 100.138 bits (248), Expect = 1.278e-20
Identity = 87/334 (26.05%), Postives = 146/334 (43.71%), Query Frame = 3
Query: 1632 NDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            N +RP F      +   E+  +   +  + A D+D G N ++ + I + +    F+ID   G +  +   DRE  + YV+ I   D GNP+ +T+  + ITI D NDN P +I  +  +     +  +G + + L A D D   N ++ + L      +      G +      DREK+D Y + +   D G      E  V++ +   DVNDN+P F    Y+   R+++                   G +L  I+A+D D   N +I +SLK        F ID+  G I+    L   +   + + V A D G P L+    ++I + D+
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRP-VIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVD--DVNDNAPVFGVQEYIFKVREDLP-----------------RGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 17 Score: 94.3597 bits (233), Expect = 6.816e-19
Identity = 134/549 (24.41%), Postives = 242/549 (44.08%), Query Frame = 3
Query:  612 EDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVK--LAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTI-----CIKVTDINDETPNIHINPSK--LTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNG 2195
            E+ENDN+P+   P  +    E+ +    + +I   +A D D+ +  + I Y +   N   +F   IDSKTG       + LD E+Q+ H + +   + G     S   I   VLD NDN P F+Q  Y + +P +  ++ +I+++ AI  D  +  + R+  S+K      +  +  + G I + + LD + ++  + +    +G+   S T       + V   +   P I    S+  + + EN   G  V QI   D D+ ++   I     D        TF+    I Q++    +   + ++ ++  N           L  S   GT  A     FT L V + D+NDN P F + +Y++   EN    + I Q+ ATD+DE  + ++ Y +  + D      F+IDS+SG +   +  D E+   +++ +  +D G P      K+ + + D ND+ P+  +    S           +  ++A D D   N EI++ ++  + G  F+I P  G I    + +  K   Y ++++  D G
Sbjct: 1184 ENENDNIPLTDKPVYYVNVTEASV---ENVEIITLKAFDPDI-DPTQTITYNIVSGNLVGYFE--IDSKTG-VIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAI--DSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD-NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDN-------TFY----IGQDNGNILLSKYLDYETQQSYN-----------LTISVTDGTFTA-----FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLG 1693          

HSP 18 Score: 74.3294 bits (181), Expect = 7.693e-13
Identity = 137/581 (23.58%), Postives = 246/581 (42.34%), Query Frame = 3
Query:  969 FNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAI-----RRLFLVQEE--------------GWIILNRGL--DYEID-QMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPS-IT-------QESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRP-VFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRIT-YDILESN---DFKIDSVSG---WINAMKIFDREEMDHYV--VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGK-ENKQETYVHLCIKILDVNDNSPQFMEPPYLLS--RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIG-SYRIHVIASDNGVP 2570
            F+ S Y +TIPEN+   T     + +  ++ A L   L+  VK  I      +LF  +E+                ++LNR    +Y I  + H+ + +     Y     I IKV D ND +P  +     + I E+      + ++   D D + +NG+I  Y    M++ + F  HP    IT        E++ FE+ + + +DR  ++N++     +T                     +S+ ++ VN   P +FT++  ++    N  I+  +      DKD G N  I   +I++ N    F + +      +   +  F      H++  +T+ A+D G P       V I I   + N P       + S+ E   +++ P+  LK  D D+ +N  +  +++  ++G  F I P+ G +Y     D EK+  Y + +   D     +++++   + I + D+NDN P F     ++S   +N+A                  G  +V + A D D+ +N  ISYS+     VP  FEID   G +K +  L    +  +Y + + ASD G+P
Sbjct:   62 FSHSVYNVTIPENSLGKT---YAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDAD-LGINGEI--YYSLLMDS-EYFAIHPTTGEITLLQQLQYAENSHFEL-TVVAYDRGSWVNHQNHQASKTK--------------------VSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVR---VNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINM-PVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA------------------GSFVVKLTAKDRDSGENSYISYSIANLNAVP--FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLP 590          
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 182.956 bits (463), Expect = 7.373e-46
Identity = 197/745 (26.44%), Postives = 334/745 (44.83%), Query Frame = 3
Query:  405 LRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD-KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY-EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             ++  + +  +F +++ SG +  + T+D E+       N      T T  V       F A    +    DENDN P F   F +   +E N  +   +    A D D T  N  I Y L  + E    + +ID  +G  ++ +L +LD E QS +   + A + G  +  +++ +  +++D+NDN P F      +++ EN    T +  +  IDPD +   + + + +  K A    F + + G + + + LD E    +   +   DG + A   + I V DIND TP        ++  E++  GT + ++K  D D      K+  Y    G +         D SI +ES I ++ S    DRE         P    +    DG        +    + + + D+NDN P+F+ + Y +   E+  ++  I +V A DKD G N +I Y ++  N   FKI   +G I   K  DRE +  + +T+KA+D G P L++   V + I D NDNPP+  S   +S +   N + G  +  + A   DI  N +I + +M  + +G F + +  G +    + D E    Y + ++  D G        YV+  I ILD+NDNSP F++  Y ++              +   I+   G  ++ +KA D D+D NG ++Y+++    + + F ID   G I VS+ L R  I  Y + + A D G P   +   + IN+ D
Sbjct: 2793 FKFSIAADQDHFMISD-SGELILQQTLDREQ---QESHNLIVVAETSTVPV-------FFAYADVLIDVRDENDNYPKFDNTFYSASVAE-NSEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSG--WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQA---QFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGAD---------DFSIGKESGILKVAS--ALDRE-------TTPKYKLVAHVQDGKDFTQECFS---EIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF-SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVN--ISILDINDNSPTFLQNLYRIN--------------VNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 154.451 bits (389), Expect = 3.944e-37
Identity = 168/636 (26.42%), Postives = 291/636 (45.75%), Query Frame = 3
Query:  741 NRKILYELHQNE-EEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE-FLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNR--PVFTESIYNIFFMENNHIHAHIHQVLATDKDE-GQNSRITYDILESNDFKIDSVS--GWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDN------PPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTI-YAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS 2579
            N K+++ +   + +  FR  ID   G+  + ++  LD E Q+ + + +  ++ G   K +  ++   +LD NDN P   ++     + E+  + T ++ + A D D    A+++Y L     +      +    G + LN+ LD E    +   +   DG   V ++   + + V D+ND  P   +      ++E+L  GT +  I+  D D              G N    F+   +   TQ+  +F I       R + +L+  N+++H +  + +   DG    +  LT   ++ ++I DVN+NR  P F + +Y     EN      +  V A D D    NS+ITY I   +   I +V+  G I ++   D E  + Y +T+ AQD     L+  V+V I + + NDN      P   ++ ++ SVE   NV    I  LKA D DI     I ++++  +  GYF+I +  G I   +   DRE +  + + + ISDNG      T   + + +LD+NDNSP+F +  Y      +  P++A              Q +  + AID D+ +NG+I+YS+K   G  + F ID   G I +++ L   +   + IH+ A DNG+P  S
Sbjct:  804 NGKLVFAISDGDYDSVFR--IDPDRGE--LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDI-------------GPNAEIQFSLKEE---TQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI---DG---GDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVE---NVE---IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVY-----KVQVPSSATVN-----------QSIFQVHAIDSDSGENGRITYSIKSGKGKNK-FRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKS 1383          

HSP 3 Score: 150.984 bits (380), Expect = 3.902e-36
Identity = 187/683 (27.38%), Postives = 302/683 (44.22%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEF-LNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDL-MWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLG-VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-SD--IKVLLINLADIPP 2621
            D NDN PVF    +     E N L    +     ID D+ EK     + +  +++  F++    K+G+ F+   K LD E    + + + A +     K +   ++ +V D NDN P+  +  Y I+  E+  + T + +++AID D  ++L + L            + +E G + +   LD E    +  V  V DG        + I I V DIND  P   +   ++++ E+    T + ++   D+D   VN +I  Y   G N       H    I++ + I  I+   + DRE   L N         L + ++  G    +L    T++V I D+NDN P F+   Y+   +EN      + +V AT  D G N+ I Y I+  N+   FK+DS +G +      D E    Y +TI+A D G P L+    VNI+I D NDN P  + +  + +  N ++ +G  I  +KA D+D   NG + +++    + G F I P NGTI      DRE    Y + ++  D G   +  + V + I ILD NDN+P F    Y                 + L    + G + +T K  D D   N    Y+  I  G     F +++DG  ++ +   + +    + I V   DNG PPL SD  + V +I  +  PP
Sbjct: 2959 DYNDNAPVFKLPIEGLSVFE-NALPGTVLINLLLIDPDI-EKQEMDFFIVSGDKQAQFQI---GKSGELFIA--KPLDREQLMFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGK---GADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD-FGVNRQIK-YSLMGEN-------HDYFKISKSTGI--IRLHKSLDRETISLFN---------LTVKAEDCGV--PKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNL-YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNS-VPININILDTNDNAPIFSSSNY----------------SVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGS-LRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPP 3586          

HSP 4 Score: 144.436 bits (363), Expect = 3.844e-34
Identity = 205/774 (26.49%), Postives = 329/774 (42.51%), Query Frame = 3
Query:  402 QLRYKFSKEN-KYFSLTEKSGTITTKSTIDLE--------EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDV-TEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLT-IKENLISGTFVGQIK-----ISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITF-DREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAH-IHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF----SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDIT----PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            ++RY+  K N + F L  KSG ++ K  ++             D     C ++ P     V V D +                  +PVF  +F T     +++  D ++Y   ++  +  +   R ++Y +    + F    ID  TG  FVV    LD E  S+H V + A  + +    +++V+   ++D ND  P      Y +TIPEN    T I KI A D D    A+LSY +++        LF +   +G + L   LDYE  + H  VV V D      ++ + + I V D+ND  P   + PS  T +    + G FV   K     ISD DS+E       Y+    N LQ +      SI + + +  +++ + F D+   + N          +  SDG  T  A+L I    S+L E+V    P+F +S Y     EN  +H H I  V A+D D G  + + Y+I+       F ID  +G I +   FDRE+ D YVV +K  D G      ++KV +     ++ P  L+         +VE N+ +       +KAKDDDI +NG + F ++     K   D+       G I  K   +    + Y   +R SD G E +  + V + I+I++ + N P F +   LL            +TP        PG +L  +  I          +Y+ K  +   +   +  D GE+ + QTL R    S+ + V+A  + VP       +LI++ D
Sbjct: 2174 EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQ---VKVIDRS------------------MPVFEKQFYT-----VSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSF---EIDYNTGSIFVV--NELDYEKISSHDVSIRA-TDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAP-CFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLE-------YKIVYGNELQTY------SIDKLTGVISLQNMLNFTDKSSTVLN----------ISVSDGVHTAYARLKI----SLLPENVY--SPLFDQSTYEAQVPEN-LLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVD-VNDNVPYFLLKEYKMVVSTTVEANQTILT-----VKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRG-EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKI--------IESTP--------PGTVLTKLHMIG---------NYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRD 2852          

HSP 5 Score: 141.354 bits (355), Expect = 3.316e-33
Identity = 178/691 (25.76%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVI--LEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRR-----LFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREE----FLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSV--EENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIY----EIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-------RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKV 2591
            +D NDN P +  K + H  +  ++     +   +AID D   K R   Y   +  ++F   +I  ++G   + V   LD E+   + ++  ++   +  +E  S+I+I   V D NDN P F+ + Y +++PE+  L+T I K+ A+D D      + ++  +K ++         + +  G I L++ LD E   +    V+  D GV    +  T+ + + DIND  P   +      I EN   GT V ++  +  D + VN  I  +   G N    F          +S   ++    T D E     FL  + I      L        +NNA + I+      I D+NDN P F +++Y I   E+  + + I  V ATD+D   N  +TY+I   ++   F ID  +G I+  +  DRE + HY + I+A D G+P    +V +NI I D NDN P + SSS++SV  +ENR +    + +  +  D+        FD+   ++ G F +  +G++     F+   +D + +++R+ DNG      +   + +KI++      +   PP +              TP+E++I     +  G  +  + A   D DK  ++++SL   +  P       + F I  + G+I     +S  DIG Y+++V  SD      S +K+
Sbjct: 3058 KDINDNTP-YCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDF---SIGKESG--ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIIT--VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD------FGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSG-NEQGKFKM--------DSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL--------SNNAYVNIS------ILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIE------ESQYPPIV--------------TPLEVTINSFEDDFSGAFIGKVHA--SDQDKYDELNFSL---VSGPDDMYQSSKLFNISNNTGKI---YAISNLDIGLYKLNVSVSDGKFHVFSIVKI 3678          

HSP 6 Score: 140.198 bits (352), Expect = 7.718e-33
Identity = 188/758 (24.80%), Postives = 332/758 (43.80%), Query Frame = 3
Query:  435 YFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE--DENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV----IKFEVLDFNDNEPFFNQSTY--VITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-----SDIKVLLINLADIPPGLNNQK 2639
            YF +  K+G I TT+  +D E            +Q      V + D  S +   T+  +    D NDN P F    +K +    + +N    + I+   AID+D  E N +I Y +   + +  +  IDS+ G   + + K LD++++    + ++A + G+  KKSQ      +   V   + N P   + T   V+ + EN      + +I A+D D   +L Y + N         ++ Q+ G I+L++ LDYE  Q +   + V DG + A T + ++V DIND  P    +   + I EN+   + + Q+  +DRD      K   Y      +          SI+   N+  +  R+ F++           I    +      G  N    I     V + D ND+ P FT  I      E+  I + + +V A D+D G N+ I Y I+  N    F+ID   G I      +  ++  Y++ +KA D GNP L++ + V+I +    ++PP+   +++ ++E   N+ +G  +  + A+      +  I F+++  +    F I P+ G I    + D E    + + ++ ++   E+  +   ++ I ILD NDN P F++  Y+      A P +A      L +++     L T++  D D   NG + Y +   L    +F+ID   G I++ + L       Y   V  SD G P L     + + + +IN+ D PP  N ++
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE------------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN----QSIFQVHAIDSDSGE-NGRITYSIKSGKGKN-KFRIDSQRGH--IHIAKPLDSDNE--FEIHIKAEDNGIP-KKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD-DDNDQLWYNISNGND--DNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE----DKKLFYHLHATQDPSSLALFRIDSIS--GNVI-VTQRLDFEKTA-------QHILIVFVKDQGAPGKRNYAKII-----VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKF-PTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQ---NIIIHILDANDNIPYFVQNEYVG-----ALPESAAIGSYVLKVHDSSKDHL-TLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERE 1936          

HSP 7 Score: 132.88 bits (333), Expect = 1.463e-30
Identity = 151/605 (24.96%), Postives = 253/605 (41.82%), Query Frame = 3
Query:  825 VVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            +++ + LD E Q +H +I+ A    +    +   +  +V D NDN P F+ + Y  ++ EN+    ++ K+ A D D      + Y L++  +  I+ +F +    GWI L   LD E+   + F V   D  +    A   + IK+ D ND  P   +    L++ EN + GT +  + + D D  +          D     Q         I +   +F  K     DRE+ +            +I +DG  T  A + I       ++D+NDN P   +  Y+I   E+  I   + +V A D D     R       ++DF I   SG +      DRE    Y +    QD  + +     ++ IT+ D NDN P + S + + V    +  L   I  + A D D   N +I++ LM  +  YF I+ + G I    S DRE    + + ++  D G   K  +   + + ILD+NDN P+F    Y  S   +   T+              G  +  + A  +D   N  I Y + +       F++D   G++ ++ TL       Y + + A D G PPLS+   + I++ DI
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE-NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQ---------IGKSGELFIAKP---LDREQLM-------FYNLSIIATDGKFTAKANVEID------VKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMP-IFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSMRQY--SCKILENATH--------------GTEVCKVYATSIDIGVNADIHYFI-MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          

HSP 8 Score: 127.102 bits (318), Expect = 8.341e-29
Identity = 190/773 (24.58%), Postives = 320/773 (41.40%), Query Frame = 3
Query:  399 TQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ--NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNE--PFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT---ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNI--------FEIKSRI----TFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILES---NDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVK---VNITIGDRNDNPPQLI-SSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKI---PLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             Q+ Y  S E   F++   +G +     +D E          K D   +  T          +      L +D NDN PVF  +    +  E +L R   + + +A+D D+   N +I + L +   +EE FR  ID  TG   +     LD E++  H +I+ A + G     S + I   ++D N+N   P F+   Y   + EN P  T +  + A D D     ++++Y +     L I   F V ++G I     LD E    +   +   D      +    + I+V + ND  P                         ++D+    VN      E   +  L+ F    DP+ T   NI        FEI S+     T +R+    N+  H +  A+   SD +G+     T    +SVL  D+NDN P F + +Y +    +  ++  I QV A D D G+N RITY I      N F+IDS  G I+  K  D +  + + + IKA+D+G P  + T +   V + +   + N P ++  +S+  V+   N   G  +  + A DDD   N ++ +++   +    ++    NG I      D E +  Y + + ++D         + +L ++++D+NDN PQF +  Y ++              I  +I E    +++ + A D D DK  K+ Y L     P  +   F ID   G + V+Q L       + + V   D G P   +   +++N+ D
Sbjct:  910 AQVTYALSVECSDFTVNATTGCLRLNKPLDRE----------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVRE-DLPRGTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFR--IDKHTGA--IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI---FAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIP-------------------------LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI---SD-NGSPVLSSTSRIVVSVL--DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD----GTFTAFTNLLVQVIDINDNPPQFAKDVYHVN--------------ISENIEE--ESVIMQLHATDRDEDK--KLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 9 Score: 115.931 bits (289), Expect = 1.726e-25
Identity = 152/569 (26.71%), Postives = 248/569 (43.59%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDY-EIDQMHLFVVEVFDGVY-------AASTTICIKVTDINDETPNIHINP-SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYE-----PDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGN--PSLNTTVKVNITIGDRNDNPPQLISSSD-FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDR-YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASD 2558
            I  +VLD ND  P F  + Y + IPE+TP   +I K+ A D D      + Y L     L     F +    G I L + L Y E     L VV    G +       A+ T + I V  +N   P I     S +T   N +     G ++++D+D+  +NG I   E     PDG       TF    + T++    E+      +++ F+ N         L + ++  GT   +     ++ + I+  + N P+FT+ IY +   E   I+  + ++  +D D G+N+ +  +I+   E ++F+I+  SG +   K  D E+   Y +T+ A D  N      ++ KV I++ D NDN P   + +   S+ EN N++   +  L AKD D  EN  I + +   +   F+I   +G +      D E   R Y + +R SD G   +++T + L I + D+NDN PQF        R N  G     + P+        G  +    AID DA     ISY L         F +D   G + +S  L ++ + +  + V A+D
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL-----LMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPL---IYGIVRVNDKDT-GINGNIGRLEIVDGNPDG-------TFLLKAAETKDEYYIELNQFAHLNQQHFIYN---------LTLLAEDLGT--PRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINEN-NLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF-------ERVNCYGKV-TKSAPM--------GTEVFVTSAIDFDA--GDIISYRLS-DGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 113.62 bits (283), Expect = 8.717e-25
Identity = 177/683 (25.92%), Postives = 291/683 (42.61%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLD-NSVKLAIRRLFLVQ-EEGWIILNRGLDYE-IDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPD-GMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLN--NERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINA--MKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGY-FDITPNGTIYAKVSFDREKEDRYCM----RLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            D ND+ P F  K    +  E   +   K+   +AID D +  N +I Y +   N    F   ID   G   + +  NL+      + + ++A + G     SQI +   V    ++ P F  +   I I EN P+ T + ++       TAR S  +  N +   I   F +    G I++N  +DYE I   +L V        ++   I I + D ND  P    N     + E+   G++V ++  S +D + +  K    + D G+N +  +    D +     N F+I S  T    E L   +   +   T  +  SD  G      T T  +++ + +VND  PVF E   N+        +  + QV A D D   N  + +DI++ N    F+I+  +G I     +I + E    Y + ++A D G  S    VK+ + +   + N      S  FS  EN N  +  IG +    + + EN E R  ++ P + +   I+        V FDRE +D Y +    +  + D    N +     + I +LDVNDN P F+  PY  +                +SI +  G I++ +KAIDLD+ +NG++ Y LK   G    F++DR  GE+ + Q +   +  +Y + V A D  + P S    L + + D
Sbjct: 1604 DHNDHHPEFTAKIIQSKVPESAAI-GSKLAEVRAIDRD-SGHNAEIQYSIITGNVGSVFE--IDPTFG--IITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQV-------TARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVK----DADVGVNGMVEYHIVDDLA----KNFFKIDS--TTGAIELLRQLDYETNAGYTFDVTVSD-MGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD-GIFSAILIVKIKV-LSAIDSNFAFQRESYRFSAFEN-NTKVATIGLVNVIGNTLDENVEYR--ILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYAT----------------VSIDDPKGTIIMQVKAIDLDSAENGEVRYELK--KGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVID 2235          

HSP 11 Score: 113.62 bits (283), Expect = 9.564e-25
Identity = 125/442 (28.28%), Postives = 201/442 (45.48%), Query Frame = 3
Query: 1287 PSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEEN--RNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG--YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDN--SPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLD-ADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD 2582
            P +L+I E++  G  V  I+  DRD +  NGK+     DG  +   F   PD          E++     DRE    NE +  I          +   N   + +  L + I DVNDNRPV  +++      E+  I   +H + ATD D G N+++TY + +E +DF +++ +G +   K  DRE+ D+Y + I A+D G+P L++   V + + D NDN P   +    F V E+  R   L  I   +A D+DI  N EI+F L    +    F I  + G I  +   D E +  + + +   D G +    + + + I I+DVN+N  +P+F +  Y           N P            G  ++ + A D+D  D N KI+YS+    G+   F ++  G    +SQ L       Y + + A D  + PLS+
Sbjct:  776 PQELSINESVQLGETVAWIEAKDRD-LGYNGKLVFAISDGDYD-SVFRIDPDRG--------ELQIIGYLDRER--QNEYVLNITV--------YDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVI---EAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVY-----EGKVKENKPK-----------GTFVMNVTARDMDTVDLNSKITYSITGGDGLG-IFAVNDQGSITSLSQ-LDAETKNFYWLTLCAQDCAIVPLSN 1175          

HSP 12 Score: 110.538 bits (275), Expect = 7.807e-24
Identity = 164/671 (24.44%), Postives = 296/671 (44.11%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNI-YKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY--EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLAT----DKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL---KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            D NDN P+F      +    I+  +   I   +AID D  E N ++ YEL +   E F+L  D K+G+  + + ++++  ++ N+ + + A++  +    S+  ++ +V+D   + P F +  Y +++ E+  + + +   IEA  P     L   L  ++    +   +    G I +   LDYE    H   +   D   GVYA    + + + D+ND  P I  +   LTI EN   GT + +I  +D DS   N K+  Y    +G NN + F          + N++ +K+ + +++ ++ +          +++    HG+    L+    + + ++D+NDN P F E  Y         + A   Q +A     DKD      + Y I+  N+   + ID ++G I+   + +  +    V+ I   D  + +     ++ I++   N   P L   S +  +   N+  G  I  +KA D D      + ++++    K  F I    G I +KV+FDREK+D Y + L++SD G    +  +  L + ++DVNDN P F+   Y +            +T +E +      Q ++T+KA D D   NG + + +        V    EI+   G+I          + SY+  V ASD G P
Sbjct: 2132 DVNDNCPLF-VNMPYYATVSIDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNGELFKL--DRKSGE--LSIKQHVEGHNR-NYELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESP-----LGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYA-EVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDS-GANAKLSYYIESINGQNNSELFYID-----VTDGNLY-LKTPLDYEQIKYHH----------IVVNVKDHGS--PSLSSRSNVFITVKDLNDNAPCFVEPSY----FTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAY---ARLKISLLPENVYSP-LFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG---GKFGFASLKVIVVDVNDNVPYFLLKEYKM----------VVSTTVEAN------QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEP 2741          

HSP 13 Score: 110.153 bits (274), Expect = 1.284e-23
Identity = 177/719 (24.62%), Postives = 318/719 (44.23%), Query Frame = 3
Query:  555 VNVWDENS-FLAIITTVFL-FEDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLV-QEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT------------LSVLIEDVNDNRPVFTESIYNIFFMEN---NHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH---KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPP 2621
            VNV D  S  L+  + VF+  +D NDN P F  P  F    +  +  +R + + LP+A D D+++ +      ++ NE + +  +ID  TG   V+ L+N+   +  + TV+  + ++G+    +++  K  +L  N   P F+QSTY   +PEN     NI  ++A D D    A L Y +   V   ++++FL+ Q  G I      D E    ++ +++V DG       ++ + V D+ND  P   +   K+ +   + +   +  +K  D D V+ NG +         + Q         I Q+SN   +K  I         NE+   I       ++ +G N+ Q  +  +            +S+ I + + N P F +S   +  +E+     +   +H +         N    + I    D  + S SG +   +  DRE+ + + + + A+    P       V I + D NDN P+  ++    SV EN    +  +  + A D D   NG+IR+ L       +  FDI   +G I    S DRE +  Y  ++  +DNG   K +  V + IKI+D NDN+P F  P        I G          LS++E  +PG +L+ +  ID D +K  ++ + + +       F+I +  GE+ +++ L R  +  Y + +IA+D      +++++ + ++ D  P
Sbjct: 2419 VNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFT---KVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY--SIDKLTG---VISLQNMLNFTDKSSTVLNISVSDGVHTAYARL--KISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVD-NGSV---------HFQ---------IVQKSNDKAVKDVIEI-------NEKTGDI--VFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI--------GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVK-VSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHP-KHDAKVPVTIKIVDYNDNAPVFKLP--------IEG----------LSVFENALPGTVLINLLLIDPDIEKQ-EMDFFI-VSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP 3065          

HSP 14 Score: 103.219 bits (256), Expect = 1.453e-21
Identity = 159/661 (24.05%), Postives = 271/661 (41.00%), Query Frame = 3
Query:  639 FPFKFKTHRESEI-NLLRDRKIYLPQAIDNDVTEK-NRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWN---EGMKE--KKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEI--KSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG 2564
            F F+ +++R S   N  +   I L   I N + E    +IL     N  + F + I S   K   V+    D E +  + + +EA +   +GM    +++   I   VLD NDN P F    Y  T+  + P  T I +++AID D       R +  +K     LF L ++ G + + + ++   ++ +   V  +DG +   S+   ++V  I+   P        +++KE+         +++    SV +  +     P G + +         +I+ ES  FEI   +   F   E L+ E+I     ++       G     +     LSV I DVND  P     IYN+   EN      I ++ ATD D G N++++Y I   N       F ID   G +      D E++ ++ + +  +DHG+PSL++   V IT+ D NDN P  +  S F+      V    +   KA D DI++   + + +++ +  + Y      G I  +   +   +    + + +SD         Y  L I +L  N  SP F +  Y                P  L    + G  ++T+KA D D      + Y + +   + + F ID+  G I    T  R     Y + +  SD G
Sbjct: 2031 FAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRIL-----NPTQLFDIGISSGALKTTGVIF---DREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYE--LKKGNGELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKED---------VEMYSALSVSIEAE----SPLGRSLIY--------TISSESQSFEIDYNTGSIFVVNE-LDYEKISSHDVSIRATDSLSG-----VYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD----GVHTAYARLKISLLPENVYSPLFDQSTY------------EAQVPENL----LHGHNIITVKASDGDFGTYANLYYEI-VSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG 2632          

HSP 15 Score: 101.293 bits (251), Expect = 5.691e-21
Identity = 160/635 (25.20%), Postives = 254/635 (40.00%), Query Frame = 3
Query:  402 QLRYKFSKEN--KYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELH--QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVN---GKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE----------GQNSRITYDI---LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIG--DRNDNPPQLISSSDFSVEENRNVSLGP-------IGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFD---REKEDRYCMRLRISD 2189
            QL Y  S  N    F + + +G I     +D E             Q +   T++V D  +F A    +    D NDN P F  K   H     N+  +  I    A D D   +++K+ Y LH  Q+        IDS +G   V+V + LD E  + H +I+   ++G   K++   I   V D ND+ P F        +PE+  + + + ++ AID D    A + Y +   +   +  +F +    G I L   L+    Q ++  V+  D      ++   + I VT   ++ P    N   + I ENL  GTFV Q+      S+  N   G I              +F  +PS    + +  I   I ++  +  N          L +     GTN A  +    + + I D NDN P F ++ Y     E+  I +++ +V  + KD           G N  + Y I   L  N FKIDS +G I  ++  D E    Y   +   D G P L++T   ++TI   + ND PP          E   NV+L         +  + AKD   A+N  +RFD++  +    F I     I    +F+    E +  Y + +R SD
Sbjct: 1438 QLWYNISNGNDDNTFYIGQDNGNILLSKYLDYET------------QQSYNLTISVTD-GTFTAFTNLLVQVIDINDNPPQFA-KDVYHVNISENIEEESVIMQLHATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGN--VIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNI------------NESFRINPS----TGVIVINGNIDYESIKVFN----------LTV----KGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-------NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD 2010          

HSP 16 Score: 100.138 bits (248), Expect = 1.267e-20
Identity = 87/334 (26.05%), Postives = 146/334 (43.71%), Query Frame = 3
Query: 1632 NDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKEN-KQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            N +RP F      +   E+  +   +  + A D+D G N ++ + I + +    F+ID   G +  +   DRE  + YV+ I   D GNP+ +T+  + ITI D NDN P +I  +  +     +  +G + + L A D D   N ++ + L      +      G +      DREK+D Y + +   D G      E  V++ +   DVNDN+P F    Y+   R+++                   G +L  I+A+D D   N +I +SLK        F ID+  G I+    L   +   + + V A D G P L+    ++I + D+
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRP-VIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVD--DVNDNAPVFGVQEYIFKVREDLP-----------------RGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 17 Score: 94.3597 bits (233), Expect = 7.417e-19
Identity = 134/549 (24.41%), Postives = 242/549 (44.08%), Query Frame = 3
Query:  612 EDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVK--LAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTI-----CIKVTDINDETPNIHINPSK--LTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNG 2195
            E+ENDN+P+   P  +    E+ +    + +I   +A D D+ +  + I Y +   N   +F   IDSKTG       + LD E+Q+ H + +   + G     S   I   VLD NDN P F+Q  Y + +P +  ++ +I+++ AI  D  +  + R+  S+K      +  +  + G I + + LD + ++  + +    +G+   S T       + V   +   P I    S+  + + EN   G  V QI   D D+ ++   I     D        TF+    I Q++    +   + ++ ++  N           L  S   GT  A     FT L V + D+NDN P F + +Y++   EN    + I Q+ ATD+DE  + ++ Y +  + D      F+IDS+SG +   +  D E+   +++ +  +D G P      K+ + + D ND+ P+  +    S           +  ++A D D   N EI++ ++  + G  F+I P  G I    + +  K   Y ++++  D G
Sbjct: 1184 ENENDNIPLTDKPVYYVNVTEASV---ENVEIITLKAFDPDI-DPTQTITYNIVSGNLVGYFE--IDSKTG-VIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAI--DSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD-NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDN-------TFY----IGQDNGNILLSKYLDYETQQSYN-----------LTISVTDGTFTA-----FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLG 1693          

HSP 18 Score: 74.3294 bits (181), Expect = 8.093e-13
Identity = 137/581 (23.58%), Postives = 246/581 (42.34%), Query Frame = 3
Query:  969 FNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAI-----RRLFLVQEE--------------GWIILNR--GLDYEID-QMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPS-IT-------QESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRP-VFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRIT-YDILESN---DFKIDSVSG---WINAMKIFDREEMDHYV--VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGK-ENKQETYVHLCIKILDVNDNSPQFMEPPYLLS--RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIG-SYRIHVIASDNGVP 2570
            F+ S Y +TIPEN+   T     + +  ++ A L   L+  VK  I      +LF  +E+                ++LNR    +Y I  + H+ + +     Y     I IKV D ND +P  +     + I E+      + ++   D D + +NG+I  Y    M++ + F  HP    IT        E++ FE+ + + +DR  ++N++     +T                     +S+ ++ VN   P +FT++  ++    N  I+  +      DKD G N  I   +I++ N    F + +      +   +  F      H++  +T+ A+D G P       V I I   + N P       + S+ E   +++ P+  LK  D D+ +N  +  +++  ++G  F I P+ G +Y     D EK+  Y + +   D     +++++   + I + D+NDN P F     ++S   +N+A                  G  +V + A D D+ +N  ISYS+     VP  FEID   G +K +  L    +  +Y + + ASD G+P
Sbjct:   62 FSHSVYNVTIPENSLGKT---YAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDAD-LGINGEI--YYSLLMDS-EYFAIHPTTGEITLLQQLQYAENSHFEL-TVVAYDRGSWVNHQNHQASKTK--------------------VSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVR---VNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINM-PVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA------------------GSFVVKLTAKDRDSGENSYISYSIANLNAVP--FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLP 590          
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 265.003 bits (676), Expect = 7.440e-73
Identity = 221/766 (28.85%), Postives = 364/766 (47.52%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTI-TTKSTIDLEEICDN---NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IG+   DL+     S     ++ L Y+    + +     +   +G I TT + ID E++C      ++ C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN P F +S   + IPEN+P+ T++ +++A D D    A + Y     V  A RRLF L    G I + R LD E   +H   V   DG  + A  TI I VTD+ND  PNI     I+P+  T+   E     T +  I +SD+D+ +VNGK+ C+    +    PF      ++     + E  + + ++  +    E I  I     + SD   +    L  T  + V +ED NDN P+FT+ +  +  MENN     +  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDREE + ++ T+ A+D+G  +L +   V +TI D NDN P+   +   F V EN       +G +   D D  EN  +R  ++  ++ +     +G I + VSFDRE++  Y   +R  DNG      +   + I ++DVNDN+P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +   V   F ID   G I + +  + +DIG +R+ V  SD G P
Sbjct:   40 IGNIPKDLNISHMNSAT-GATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVIL------PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDT-DVNGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTK----EYIFKI-----VASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSP-PCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTI-VSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 265.388 bits (677), Expect = 1.035e-72
Identity = 221/766 (28.85%), Postives = 364/766 (47.52%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTI-TTKSTIDLEEICDN---NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IG+   DL+     S     ++ L Y+    + +     +   +G I TT + ID E++C      ++ C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN P F +S   + IPEN+P+ T++ +++A D D    A + Y     V  A RRLF L    G I + R LD E   +H   V   DG  + A  TI I VTD+ND  PNI     I+P+  T+   E     T +  I +SD+D+ +VNGK+ C+    +    PF      ++     + E  + + ++  +    E I  I     + SD   +    L  T  + V +ED NDN P+FT+ +  +  MENN     +  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDREE + ++ T+ A+D+G  +L +   V +TI D NDN P+   +   F V EN       +G +   D D  EN  +R  ++  ++ +     +G I + VSFDRE++  Y   +R  DNG      +   + I ++DVNDN+P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +   V   F ID   G I + +  + +DIG +R+ V  SD G P
Sbjct:   40 IGNIPKDLNISHMNSAT-GATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVIL------PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDT-DVNGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTK----EYIFKI-----VASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSP-PCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTI-VSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 265.388 bits (677), Expect = 1.035e-72
Identity = 221/766 (28.85%), Postives = 364/766 (47.52%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTI-TTKSTIDLEEICDN---NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IG+   DL+     S     ++ L Y+    + +     +   +G I TT + ID E++C      ++ C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN P F +S   + IPEN+P+ T++ +++A D D    A + Y     V  A RRLF L    G I + R LD E   +H   V   DG  + A  TI I VTD+ND  PNI     I+P+  T+   E     T +  I +SD+D+ +VNGK+ C+    +    PF      ++     + E  + + ++  +    E I  I     + SD   +    L  T  + V +ED NDN P+FT+ +  +  MENN     +  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDREE + ++ T+ A+D+G  +L +   V +TI D NDN P+   +   F V EN       +G +   D D  EN  +R  ++  ++ +     +G I + VSFDRE++  Y   +R  DNG      +   + I ++DVNDN+P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +   V   F ID   G I + +  + +DIG +R+ V  SD G P
Sbjct:   40 IGNIPKDLNISHMNSAT-GATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVIL------PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDT-DVNGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTK----EYIFKI-----VASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSP-PCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTI-VSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 265.003 bits (676), Expect = 1.845e-72
Identity = 221/766 (28.85%), Postives = 364/766 (47.52%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTI-TTKSTIDLEEICDN---NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IG+   DL+     S     ++ L Y+    + +     +   +G I TT + ID E++C      ++ C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN P F +S   + IPEN+P+ T++ +++A D D    A + Y     V  A RRLF L    G I + R LD E   +H   V   DG  + A  TI I VTD+ND  PNI     I+P+  T+   E     T +  I +SD+D+ +VNGK+ C+    +    PF      ++     + E  + + ++  +    E I  I     + SD   +    L  T  + V +ED NDN P+FT+ +  +  MENN     +  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDREE + ++ T+ A+D+G  +L +   V +TI D NDN P+   +   F V EN       +G +   D D  EN  +R  ++  ++ +     +G I + VSFDRE++  Y   +R  DNG      +   + I ++DVNDN+P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +   V   F ID   G I + +  + +DIG +R+ V  SD G P
Sbjct:   40 IGNIPKDLNISHMNSAT-GATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVIL------PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDT-DVNGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTK----EYIFKI-----VASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSP-PCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTI-VSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 263.462 bits (672), Expect = 3.192e-72
Identity = 234/793 (29.51%), Postives = 361/793 (45.52%), Query Frame = 3
Query:  315 ETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEI--CDNNEANCKADQPTMTCTVNVWD--ENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEE--FFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHLFVVEVFDGVYAAS--TTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHP--DPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLI 2600
            E    T IGS + D         +    T   YK      Y  +  K+G I TT+  ID E +  C N    C      +   V+V D  +N    +I      +D NDN P FP    T    E N        +P A D D TE+N    Y L    E    F L +    G+  P ++VL +LD E + ++ + ++A + G   + S  +++  + D NDN P F +S+Y   + EN+P+  ++ +++A D D      + Y L  ++    + L + +  G I +   LD  EI+ +  +VV    G    S  T + I VTD ND  P + I    L         I E++  GT V  +++SD+D  E N  + C     +    PF   P  D S+  +   F             L+ ER+   R  ++    G    N  L+ T +L V + D NDN P+F+ +++ + F E N     + +V+A+D D G N+ + Y I+  +     F+ID  SG + A    DRE  D Y   + A D G PS   T  V I + DRNDN P+ ++S   FSV EN    L P+G +  +D D  EN +++  +  P  G F I    GTI + +SFDREKE  Y  RL+  D G +  + +YV + I +LD NDN+P   +P              + ++ I LS    P  ++  ++A D+D+  N ++ YS  I  G P   F I    GEI +++ L+R   G +R+ +  SD G P    I ++ I
Sbjct:   32 EQPPSTLIGSLAAD---------QGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPC-----FLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPE-NTHMGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGE-NAVVTCV----VAGDVPFQLRPASDSSVDNKRKYF-------LQTTTPLDYERVRDYRVEIVAVDSG----NPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMP-PLSPVGMVTVQDMDEGENAQVQLSV-EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVVTKP--------------SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYS--IAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHI 773          
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 262.692 bits (670), Expect = 7.822e-72
Identity = 222/775 (28.65%), Postives = 371/775 (47.87%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTITTKST-IDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDR-EEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-PLSDIKVLLI 2600
            IG+   DL+     +     ST L Y+    + ++    ++  +G I T ST ID E++C  + +N   ++      V +   N F  +I    + +D NDN P+FP         E N L + +  +P A+D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN+P F +S   + IPEN P+ T++ ++ A D D    A + Y     V  A +RLF L    G I + R LD E   +H   V   DG    A  T+ I VTD+ND  PNI     I+P   T+   E     T +  I +SD+D+ +VN K+ C+    +    PF      ++     + E  S + ++  +EF          +  ++ +D   T    L  T  + V +ED NDN P+F++ +  +   ENN    ++  V A+D+D G+NS I Y +   ++ F +D  +G + A ++FDREE + ++ T+ A+D+G P L +   V +T+ D NDN P+   +   F V EN       +G + A D D  EN  +   ++  ++ +     +G I + VSFDRE++  Y   ++  D G+  +  T   + I I+D NDNSP  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +       F ID   G I + +  S +D+G +R+ V  SD G P PL  + ++ +
Sbjct:   40 IGNIPKDLNISHINAAT-GSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGS-SNSDENECFFELEVVIL-PNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPE-NTLINSRFPIPSAVDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDT-DVNSKVICF----IEREVPFHLK---AVYDNQYLLETSSLLDYEGIKEF----------SFKIVAAD---TGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSST-AKVTINIMDANDNSPVVISP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDTDTGMNAELKYTI-VSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFL 772          
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 243.817 bits (621), Expect = 1.718e-65
Identity = 225/780 (28.85%), Postives = 351/780 (45.00%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTV-------FLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYE-IDQMHLFVVEVFDGV--YAASTTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IGS ++D  Y +  SK L       YK    + Y  +  K+G I TT+++ID E + +     C+  +P   C +    E S   +++ V           D NDN P F            + I +L      +P A D D +  N    YEL      ++ F L +  D    +P ++V+  LD E + ++ + ++  + G   + S  +++  +LD NDN P F +  Y   +PEN+P+  ++ +++A D D+   A + Y    +     R L L +  G I +   +D E +  +   VV    G     A T + I + D ND  P I I    L         I E++   T V  +++SD D   VN  + C     +    PF          +S     K +        L+ E +      ++    G    N  L+ T +L V + DVNDN PVF++S+  + F ENN I+  + +V ATD D G NS++ Y IL        F I+  SG I    + DRE+ +HY   + A D G PSL  T  V IT+ DRNDN P+ +++  +FSV EN    L P+G +   D D  EN  I   +  P  G F I    GTI + +SFDRE +  Y  RL+  D G +  + +YV + I +LD NDN+P  + P  +  +     P   P TP+              ++A D+D   N ++ YS  I  G P   F+I  + GE+ + + + R   G +R+ V  +D G P
Sbjct:   83 IGSLASD--YGYPDSKHL-------YKLELGHPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEF--EVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGML----FPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDV----PFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSG----NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMP-RLSPVGMVTVIDADKGENAHIHLSV-EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPGTPVNW------------VRAEDMDTGINAELDYS--IASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 243.432 bits (620), Expect = 2.325e-65
Identity = 225/778 (28.92%), Postives = 352/778 (45.24%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTC----TVNVWDENSFLA-IITTVFLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYE-IDQMHLFVVEVFDGV--YAASTTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IGS ++D  Y +  SK L       YK    + Y  +  K+G I TT+++ID E + +     C+  +P   C     V++ D  S +  ++       D NDN P F            + I +L      +P A D D +  N    YEL      ++ F L +  D    +P ++V+  LD E + ++ + ++  + G   + S  +++  +LD NDN P F +  Y   +PEN+P+  ++ +++A D D+   A + Y    +     R L L +  G I +   +D E +  +   VV    G     A T + I + D ND  P I I    L         I E++   T V  +++SD D   VN  + C     +    PF          +S     K +        L+ E +      ++    G    N  L+ T +L V + DVNDN PVF++S+  + F ENN I+  + +V ATD D G NS++ Y IL        F I+  SG I    + DRE+ +HY   + A D G PSL  T  V IT+ DRNDN P+ +++  +FSV EN    L P+G +   D D  EN  I   +  P  G F I    GTI + +SFDRE +  Y  RL+  D G +  + +YV + I +LD NDN+P  + P  +  +     P   P TP+              ++A D+D   N ++ YS  I  G P   F+I  + GE+ + + + R   G +R+ V  +D G P
Sbjct:   83 IGSLASD--YGYPDSKHL-------YKLELGHPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGML----FPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDV----PFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSG----NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMP-RLSPVGMVTVIDADKGENAHIHLSV-EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPGTPVNW------------VRAEDMDTGINAELDYS--IASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 242.662 bits (618), Expect = 6.460e-65
Identity = 225/780 (28.85%), Postives = 351/780 (45.00%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDE-------NDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYE-IDQMHLFVVEVFDGV--YAASTTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IGS ++D  Y +  SK L       YK    + Y  +  K+G I TT+++ID E + +     C+  +P   C +    E S   +++ V    D        NDN P F            + I +L      +P A D D +  N    YEL      ++ F L +  D    +P ++V+  LD E + ++ + ++  + G   + S  +++  +LD NDN P F +  Y   +PEN+P+  ++ +++A D D+   A + Y    +     R L L +  G I +   +D E +  +   VV    G     A T + I + D ND  P I I    L         I E++   T V  +++SD D   VN  + C     +    PF          +S     K +        L+ E +      ++    G    N  L+ T +L V + DVNDN PVF++S+  + F ENN I+  + +V ATD D G NS++ Y IL        F I+  SG I    + DRE+ +HY   + A D G PSL  T  V IT+ DRNDN P+ +++  +FSV EN    L P+G +   D D  EN  I   +  P  G F I    GTI + +SFDRE +  Y  RL+  D G +  + +YV + I +LD NDN+P  + P  +  +     P   P TP+              ++A D+D   N ++ YS  I  G P   F+I  + GE+ + + + R   G +R+ V  +D G P
Sbjct:   83 IGSLASD--YGYPDSKHL-------YKLELGHPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEF--EVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGML----FPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCV----VAGDVPFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSG----NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMP-RLSPVGMVTVIDADKGENAHIHLSV-EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPGTPVNW------------VRAEDMDTGINAELDYS--IASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 243.432 bits (620), Expect = 6.490e-65
Identity = 225/780 (28.85%), Postives = 351/780 (45.00%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDE-------NDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYE-IDQMHLFVVEVFDGV--YAASTTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IGS ++D  Y +  SK L       YK    + Y  +  K+G I TT+++ID E + +     C+  +P   C +    E S   +++ V    D        NDN P F            + I +L      +P A D D +  N    YEL      ++ F L +  D    +P ++V+  LD E + ++ + ++  + G   + S  +++  +LD NDN P F +  Y   +PEN+P+  ++ +++A D D+   A + Y    +     R L L +  G I +   +D E +  +   VV    G     A T + I + D ND  P I I    L         I E++   T V  +++SD D   VN  + C     +    PF          +S     K +        L+ E +      ++    G    N  L+ T +L V + DVNDN PVF++S+  + F ENN I+  + +V ATD D G NS++ Y IL        F I+  SG I    + DRE+ +HY   + A D G PSL  T  V IT+ DRNDN P+ +++  +FSV EN    L P+G +   D D  EN  I   +  P  G F I    GTI + +SFDRE +  Y  RL+  D G +  + +YV + I +LD NDN+P  + P  +  +     P   P TP+              ++A D+D   N ++ YS  I  G P   F+I  + GE+ + + + R   G +R+ V  +D G P
Sbjct:   75 IGSLASD--YGYPDSKHL-------YKLELGHPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEF--EVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGML----FPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDV----PFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSG----NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENM-PRLSPVGMVTVIDADKGENAHIHLSV-EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPGTPVNW------------VRAEDMDTGINAELDYS--IASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 800          
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 271.166 bits (692), Expect = 2.191e-74
Identity = 240/854 (28.10%), Postives = 394/854 (46.14%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMH-LFVVEVFDGVYAASTTICIKVTDINDETPNIHI----NPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-----------------PLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+      K L    Q +  + + +     + E +G I TT + ID E++C     +A C  +       V V  +  F  ++   FL ED NDN P+FP           S IN     +  LP AID D+   N    Y+L +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F +    ++IPEN P+ +++ ++ A D D  + AR+ +   N V    +RLF L    G I +   LD E    H L V+    G   A  T+ + VTDIND  P+I I    NP+  T+   EN    T +  I + D+DS E NG++ C+     ++  PF   P         +F   ++   +   FL+ E        LL    G       L  +  L + ++D NDN PVFT+S  ++   ENN   A + ++ ATD D GQN+ I+Y +      +F +D  +G + A+K  DRE+ + Y  T+ AQD+G P L +   V +T+ D+NDN P    +  +F V E+     G +G +   D D  EN  +   ++  +   F I P +G I   +SFDRE+++ Y   ++  D G+ ++  T   + I ++DVNDN P F++PP   S + +   TN             PG ++  + AID D   N ++ YS+ +       F I++  G I + +    SD+G +R+ V A+D G P                 P + +   L+  +   P   N + +  +SP T  +      +++ +V   I+ +LV+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYE-----VEVAVLPDEIF-RLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN----SRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDS-EHNGRVTCF----TDHEVPFRLRP---------VF--SNQFLLETAAFLDFESTREYAIKLLAADAG----KPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGENSAVTLSILDVND-QFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSST-ARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN-------------PGTVVFKVVAIDDDIGMNAEVLYSI-VGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPP 840          
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 270.011 bits (689), Expect = 2.534e-74
Identity = 240/854 (28.10%), Postives = 394/854 (46.14%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMH-LFVVEVFDGVYAASTTICIKVTDINDETPNIHI----NPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-----------------PLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+      K L    Q +  + + +     + E +G I TT + ID E++C     +A C  +       V V  +  F  ++   FL ED NDN P+FP           S IN     +  LP AID D+   N    Y+L +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F +    ++IPEN P+ +++ ++ A D D  + AR+ +   N V    +RLF L    G I +   LD E    H L V+    G   A  T+ + VTDIND  P+I I    NP+  T+   EN    T +  I + D+DS E NG++ C+     ++  PF   P         +F   ++   +   FL+ E        LL    G       L  +  L + ++D NDN PVFT+S  ++   ENN   A + ++ ATD D GQN+ I+Y +      +F +D  +G + A+K  DRE+ + Y  T+ AQD+G P L +   V +T+ D+NDN P    +  +F V E+     G +G +   D D  EN  +   ++  +   F I P +G I   +SFDRE+++ Y   ++  D G+ ++  T   + I ++DVNDN P F++PP   S + +   TN             PG ++  + AID D   N ++ YS+ +       F I++  G I + +    SD+G +R+ V A+D G P                 P + +   L+  +   P   N + +  +SP T  +      +++ +V   I+ +LV+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYE-----VEVAVLPDEIF-RLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN----SRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDS-EHNGRVTCF----TDHEVPFRLRP---------VF--SNQFLLETAAFLDFESTREYAIKLLAADAGK----PPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGENSAVTLSILDVND-QFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSST-ARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN-------------PGTVVFKVVAIDDDIGMNAEVLYSI-VGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPP 840          
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 271.552 bits (693), Expect = 6.629e-74
Identity = 240/854 (28.10%), Postives = 394/854 (46.14%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMH-LFVVEVFDGVYAASTTICIKVTDINDETPNIHI----NPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-----------------PLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+      K L    Q +  + + +     + E +G I TT + ID E++C     +A C  +       V V  +  F  ++   FL ED NDN P+FP           S IN     +  LP AID D+   N    Y+L +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F +    ++IPEN P+ +++ ++ A D D  + AR+ +   N V    +RLF L    G I +   LD E    H L V+    G   A  T+ + VTDIND  P+I I    NP+  T+   EN    T +  I + D+DS E NG++ C+     ++  PF   P         +F   ++   +   FL+ E        LL    G       L  +  L + ++D NDN PVFT+S  ++   ENN   A + ++ ATD D GQN+ I+Y +      +F +D  +G + A+K  DRE+ + Y  T+ AQD+G P L +   V +T+ D+NDN P    +  +F V E+     G +G +   D D  EN  +   ++  +   F I P +G I   +SFDRE+++ Y   ++  D G+ ++  T   + I ++DVNDN P F++PP   S + +   TN             PG ++  + AID D   N ++ YS+ +       F I++  G I + +    SD+G +R+ V A+D G P                 P + +   L+  +   P   N + +  +SP T  +      +++ +V   I+ +LV+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYE-----VEVAVLPDEIF-RLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN----SRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDS-EHNGRVTCF----TDHEVPFRLRP---------VF--SNQFLLETAAFLDFESTREYAIKLLAADAG----KPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGENSAVTLSILDVND-QFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSST-ARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN-------------PGTVVFKVVAIDDDIGMNAEVLYSI-VGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPP 840          
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 271.166 bits (692), Expect = 9.984e-74
Identity = 240/854 (28.10%), Postives = 394/854 (46.14%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMH-LFVVEVFDGVYAASTTICIKVTDINDETPNIHI----NPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-----------------PLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+      K L    Q +  + + +     + E +G I TT + ID E++C     +A C  +       V V  +  F  ++   FL ED NDN P+FP           S IN     +  LP AID D+   N    Y+L +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F +    ++IPEN P+ +++ ++ A D D  + AR+ +   N V    +RLF L    G I +   LD E    H L V+    G   A  T+ + VTDIND  P+I I    NP+  T+   EN    T +  I + D+DS E NG++ C+     ++  PF   P         +F   ++   +   FL+ E        LL    G       L  +  L + ++D NDN PVFT+S  ++   ENN   A + ++ ATD D GQN+ I+Y +      +F +D  +G + A+K  DRE+ + Y  T+ AQD+G P L +   V +T+ D+NDN P    +  +F V E+     G +G +   D D  EN  +   ++  +   F I P +G I   +SFDRE+++ Y   ++  D G+ ++  T   + I ++DVNDN P F++PP   S + +   TN             PG ++  + AID D   N ++ YS+ +       F I++  G I + +    SD+G +R+ V A+D G P                 P + +   L+  +   P   N + +  +SP T  +      +++ +V   I+ +LV+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYE-----VEVAVLPDEIF-RLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN----SRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDS-EHNGRVTCF----TDHEVPFRLRP---------VF--SNQFLLETAAFLDFESTREYAIKLLAADAG----KPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGENSAVTLSILDVND-QFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSST-ARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN-------------PGTVVFKVVAIDDDIGMNAEVLYSI-VGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPP 840          
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 271.166 bits (692), Expect = 9.984e-74
Identity = 240/854 (28.10%), Postives = 394/854 (46.14%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMH-LFVVEVFDGVYAASTTICIKVTDINDETPNIHI----NPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-----------------PLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+      K L    Q +  + + +     + E +G I TT + ID E++C     +A C  +       V V  +  F  ++   FL ED NDN P+FP           S IN     +  LP AID D+   N    Y+L +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F +    ++IPEN P+ +++ ++ A D D  + AR+ +   N V    +RLF L    G I +   LD E    H L V+    G   A  T+ + VTDIND  P+I I    NP+  T+   EN    T +  I + D+DS E NG++ C+     ++  PF   P         +F   ++   +   FL+ E        LL    G       L  +  L + ++D NDN PVFT+S  ++   ENN   A + ++ ATD D GQN+ I+Y +      +F +D  +G + A+K  DRE+ + Y  T+ AQD+G P L +   V +T+ D+NDN P    +  +F V E+     G +G +   D D  EN  +   ++  +   F I P +G I   +SFDRE+++ Y   ++  D G+ ++  T   + I ++DVNDN P F++PP   S + +   TN             PG ++  + AID D   N ++ YS+ +       F I++  G I + +    SD+G +R+ V A+D G P                 P + +   L+  +   P   N + +  +SP T  +      +++ +V   I+ +LV+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYE-----VEVAVLPDEIF-RLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN----SRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDS-EHNGRVTCF----TDHEVPFRLRP---------VF--SNQFLLETAAFLDFESTREYAIKLLAADAG----KPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGENSAVTLSILDVND-QFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSST-ARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN-------------PGTVVFKVVAIDDDIGMNAEVLYSI-VGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPP 840          
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.877e-73
Identity = 234/855 (27.37%), Postives = 394/855 (46.08%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN--DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG+   DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +      +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +   F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PPY  S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   72 IGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLENAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 872          
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 4.847e-73
Identity = 232/852 (27.23%), Postives = 392/852 (46.01%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +      +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +  +F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PP   S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                  +   P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-TNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLETAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTN-------------PGTVVFQVMAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 840          
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 5.023e-73
Identity = 232/852 (27.23%), Postives = 392/852 (46.01%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +      +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +  +F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PP   S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                  +   P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-TNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLETAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTN-------------PGTVVFQVMAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 840          
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.559e-72
Identity = 231/852 (27.11%), Postives = 392/852 (46.01%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN--DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V A D D G N++I Y +      +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +  +F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PP   S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                  +   P   N + +D++SP +  +      +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLETAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYV-----KILVAAVAGTITVVVVIFITAVVRCRQAP 840          
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.883e-72
Identity = 236/859 (27.47%), Postives = 396/859 (46.10%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF-SKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHI----NP--SKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINL---------------------ADIPPGLNNQKGSDINSPKTWQMFGSTNN---VLIVVVLSGISAILVVVLITVISCMLNP 2777
            IG    DL+     +K L  + Q +  + + +     + E +G I TT + ID E++C    A    D+            +    ++   FL ED NDN P+FP           S IN     K  LP A+D DV   N    YEL +++  F    I++  G   P ++V K LD E +  + + ++  + G  ++ S  +++  V D NDN P F ++   ++IPEN P+ T++ ++ A D D  + A++ +   N V    RRLF L    G I +   LD E    H  +V   D G+  A   + + VTD+ND  P+I I    NP    + + EN+   T +  I ++D+D+ + NG++ C+     ++  PF   P         +F   ++   +   +L+ E        LL    G       L  +  L + ++D NDN PVFT+S   +   ENN     + +V ATD D G N+ I Y +L  +   +F +D  +G +  +K  DRE+ D Y+ TI A+D+G P L + V V ++I D+NDN P    +  +F V EN     G +G +   D D  +N  +   ++  +  +   +  G I   +SFDREK++ Y   ++  D G+ ++  +   + I ++DVNDN P F+ PP   S + +   TN             PG ++  + A+D D   N ++ YS+ +       F ID++ G I + +    +D+G +R+ V A+D G P  S   V+++NL                     A + P   N + +D++SP        TN+   +L+  V   I+ ++V+ +  V+ C   P
Sbjct:   40 IGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC----AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN----SKYTLPAAVDPDVG-INGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCF----TDHEIPFRLRP---------VF--SNQFLLETAAYLDYESTKEYAIKLLAADAG----KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSS-AKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTN-------------PGTVVFQVIAVDNDTGMNAEVRYSI-VGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP---NTEIADVSSP--------TNDYVKILVAAVAGTITVVVVIFITAVVRCRQAP 840          
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Match: A0A504YQG7 (Protocadherin gamma-B5 OS=Fasciola gigantica OX=46835 GN=FGIG_00003 PE=4 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 3.194e-126
Identity = 303/965 (31.40%), Postives = 484/965 (50.16%), Query Frame = 3
Query:  303 FIVYETS-VKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC----DNNEANCKADQPT-------------------MTCT----------VNVWDENSFLAIITTVFL-FEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDVTEKNRKILYELH-QNEEEF-------FRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNE--------------------------GMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLA-IRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTN--------NAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI------------------GYLKAKDDDIAENGEIRFDLM----WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-----------RD---------NIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISY---SLKIP------LGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-SDIKVLLINLADIPPGLNNQKGSD------INSP----KTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLN 2774
            F + ETS V T +GS +  L+      +     ++L Y+    +  F + E++G ++T++ ID EE+C    + + AN  +DQ +                   +TC+          VN    ++ L ++  V +   D NDN P F  + + HR   EI   + R++ LP+A D D+  ++R+ILY L   N  E        FRL ++   G+P +V+ ++LDAE+   H  +L A++                           G    ++++ I  EV D NDNEP F+ S+Y  ++PE+ PL T IY++ A DPD TA+L+YR+  +++   +   F+V  +G + L   L+YE+   +   VEV DG + A + + + V D+NDE P+  INP  L ++EN+  G  +G++++ D D   VNG++ C+EP  +   Q   F+PDP +   S+++++ +R+  DRE    +E         LIC DG+           N Q T T T ++++ D ND+ PVF ++ Y+    ENN I   I Q+ ATD+DEG N+ ITY +L+  +FK+DS++GWI A  +FDRE  D Y V + A D G P L+T+V +NITI D ND+ P L    + S+    ++S G +                  G + A D+D+  N E+ F+L+      +   F ++  G ++   S DRE++D Y + +R+SD  + N   T   + + + DVNDNSP+F+ P  LLS           RD         +     N+P   I LS+ E PG ++  +KA DLDA  NG + Y    L  P       G P   +ID + G + + + +S +D+G +  HV A DNG P   +D KVL + + D P G    K S       IN      + W  FG   N ++V +L+ IS +L  +LI  I+C+L+
Sbjct:   35 FNLDETSPVGTELGSVAAPLNPSKSMGREFVSISELHYRLGAPSSLFVVNEQTGVLSTRAAIDAEELCVKAREQDAANTNSDQDSEYSQTPSRVDSIEKSIFDRLTCSQDGHLIARVDVNALLPDASLLVVHRVAVHIHDLNDNGPKFD-QLRWHRRLKEILYRKGRRLELPKAQDADLLAEHRRILYRLQNMNNTELIDTGVVPFRLEVN-PNGQPILVLTEDLDAETTRRHRFVLVAYSPSPIRITSTAFAQKITSVSKMSKLAPIGSTVSEARLEIDIEVADMNDNEPRFDSSSYNTSVPEDAPLDTVIYQLVAHDPDSTAQLTYRMGMTMETGGLNSTFVVDSDGRVRLRSALNYELRHTYKLPVEVTDGEFGAQSVLHVHVLDVNDEAPSFEINPKVLQVEENVSPGKLIGRVRVYDTDGKSVNGEVRCFEPAYLKRQQAVIFNPDPGVNPSSDVYDLTTRLVLDREAI--DEPSPKQLFVYLICVDGYEMPGSLSSPRFNPQHTSTMTATLIVRDDNDHSPVFNQTTYHASMRENNLIGEKIIQIQATDEDEGDNAHITYALLDKANFKVDSLTGWITANVVFDRETRDSYEVVVVAMDQGKPRLSTSVLLNITILDVNDHAPVLPYEGEMSLFHREHISTGRVEQRNIFAVQENEPQGTYLGNVLASDNDLGLNSELVFELLDDSVTEYHKRFKLSDRGLLHTAASLDREEKDHYRLAIRVSDKAETNPLTTTGAIDVIVQDVNDNSPRFVFPTGLLSPAGRILPNTSARDETFTRAFLSDYVSKGNSPQPTIHLSMSEEPGHVVTKLKAEDLDAGVNGHVMYYMDELASPHIIGPHTGKP-LLKIDLEQGSVILQRFMSSNDLGMWFFHVRAVDNGQPTARADSKVLALLIVDQPVGEVYAKSSHSSNYYPINGTSYAFRLWS-FGGPRNTIMVSLLASISGLLAAILIIAIACVLH 993          
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Match: A0A4E0RUL6 (Protocadherin gamma-B5 OS=Fasciola hepatica OX=6192 GN=D915_003747 PE=4 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 1.556e-124
Identity = 300/966 (31.06%), Postives = 481/966 (49.79%), Query Frame = 3
Query:  303 FIVYETS-VKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC----DNNEANCKADQPT-------------------MTCT----------VNVWDENSFLAIITTVFL-FEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ-NEEEF-------FRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNE--------------------------GMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLA-IRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRT-ALLICSDGH--------GTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI------------------GYLKAKDDDIAENGEIRFDLM----WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGP--------------------TNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISY---SLKIP------LGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL-SDIKVLLINLADIPPGLNNQKGSD------INSP----KTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLN 2774
            F + ETS V T +GS +  L+      +     ++L Y+    +  F + E++G ++T++ ID EE+C    + + AN  +DQ +                   +TC+          VN    ++ L ++  V +   D NDN P F  + + HR   EI   + R++ LP+A D D+  ++R+ILY L   N  E        FRL ++   G+P +V+ ++LDAE+   H  +L A++                           G    ++++ I  EV D NDNEP F+ S+Y  ++PE+ PL T IY++ A DPD TA+L+YR+  + +   +   F+V  +G + L   L+YE+   +   VEV DG + A + + + V D+NDE P+  INP  L ++EN+  G  +G++++ D D   VNG++ C+EP  +   Q   F+PDP +   S+++++ +R+  DRE     +   P +    LIC DG+           N Q T T T ++++ D ND+ PVF ++ Y+    ENN I   I Q+ ATD+DEG N+ ITY +L+  +FK+DS++GWI A  +FDRE  D Y V + A D G P L+T+V +NITI D ND+ P L    +  +    ++S G +                  G + A D+D+  N E+ F+L+      +   F ++  G+++   S DRE++D Y + +R+SD  + N   T   + + + DVNDNSP+F+ P  LLS      P                     N+P   I LS+ E PG ++  +KA D DA  NG + Y    L  P       G P   +ID + G + + + +S +D+G +  HV A DNG P   +D KVL + + D P G    K S       IN      + W  FG   N ++V +L+ IS +L  +LI  I+C+L+
Sbjct:   35 FNLDETSPVGTELGSVAAPLNPSKSMGREFVSISELHYRLGAPSSLFVVNEQTGVLSTRAVIDAEELCVKAREQDAANTNSDQDSEYSQTPSRVDSIEKSIFDRLTCSQDGHLIARVDVNALLPDASLLVVHRVAVHIHDLNDNGPKFD-QLRWHRRLKEILYRKGRRLELPKAQDADLLAEHRRILYRLQNINNTELIDTGVVPFRLEVN-PNGQPILVLTEDLDAETTRRHRFVLVAYSPSPIRITSTAFAQKITSVSKMSKLAPIGSTVSEARLEIDIEVADMNDNEPRFDSSSYNTSVPEDAPLDTVIYQLVAHDPDSTAQLTYRMGMTTETGGLNSTFVVDSDGRVRLRSALNYELRHTYKLPVEVTDGEFGAQSVLHVHVLDVNDEAPSFEINPKVLQVEENVSPGKLIGRVRVYDTDGKSVNGEVRCFEPAHLKRQQAVNFNPDPGVNPSSDVYDLTTRLMLDREAI---DGPSPKQLFVYLICVDGYEMPGSLSSSRFNPQHTSTMTATLIVRDDNDHSPVFNQTTYHASMRENNLIGEKIIQIQATDEDEGDNAHITYALLDKANFKVDSLTGWITANVVFDRETRDSYEVVVVAMDQGKPRLSTSVLLNITILDVNDHAPVLPYGGEMRLFHREHISTGRVEQRNIFVVQENEPQGTYLGNVLASDNDLGLNSELVFELLDDSITEYHKRFKLSDKGSLHTAASLDREEKDHYRLTIRVSDKAETNPLTTTGAIDVIVQDVNDNSPRFVFPTGLLSPAGRISPNTSARDETFTRAFLSDYVSKGNSPQPTIHLSMSEEPGHVVTKLKAEDPDAGVNGHVMYYMDELASPHIIGPHTGKP-LLKIDLEQGSVILQRFMSSNDLGMWFFHVRAVDNGQPTARADSKVLALLIVDQPVGEVYAKSSHSSNYYPINGTSYAFRLWS-FGGPRNTIMVSLLASISGLLAAILIIAIACVLH 993          
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Match: A0A4S2K5U7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011201 PE=4 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.271e-122
Identity = 291/952 (30.57%), Postives = 473/952 (49.68%), Query Frame = 3
Query:  390 FKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICD---NNEANC-------KADQPTM-------------TCT----------VN-VWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDVTEKNRKILYELH---------QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEA------WNEGMKEKKS-----------------QIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRL-FLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNE--RIHPIRTALLICSDGHGTNN-----AQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSD--------------------FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLM----WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-----------------------RDNIAGP----TNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYF----------EIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-PLSDIKVLLINLADIP-----PGLNNQKGSDINSPKTWQM----FGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFS 2807
            +    L+Y+F   ++ F++ E SG +TT + ID E +C      EA         +AD   M             TC+          VN +  ++S  A+       +D NDN P F  + + HR   E+   + R++ LP+A D D+ ++  +I Y L             E  FRL + + +G+P +V+ ++LDAE+ + H  +L A      WN     K S                 ++ I+ EV D NDNEP F+  +Y ++I E+TP  T IYK+ A DPD TA+L Y + +S ++A+    F V+  G + L   L++E+   +   + V DG + A +++ + V D+NDE P   +NP +L   EN   G  +G+++I D DS  VNGK+ C+EP+ +   Q  +F PDP     ++++++ +R+  DRE F+  +  R+       LICSDG+G  N      + T T T ++++ DVND+ PVF++S+Y++   ENN +   I QV ATD DEG N++I+Y +L+  +FK+DS++GWI A  IFDRE  D Y VT+ A DHG   L+++V +N+TI D ND+ P L+                        F+++EN + +   IG L AKDDDI  N ++ F+L       +   F +  NG++Y     DRE+++ Y + +R++D    +   +   + I +LDVNDN+P F++P  LL                        ++ ++ P    ++ P   + LS+ E PG ++  + A D D   NG I Y+L         F           +  D G + + + L+ +D+G +   V A D+G P PL D K+L + + DIP     P  +       N+   ++     F   +N+ I+ VL+ +S +L  VL+T I C+  PC  + S I S
Sbjct:   75 YMGPPLKYRFGSPSRLFAVDETSGQLTTAAPIDAESLCSKARQQEAGASSQSSDKQADGHMMRRHVPESEFTDQVTCSQSGAVSVHLDVNAIMSDSSLRAVHRISVRVQDLNDNGPKFS-QVRWHRRLKEVLYRKGRRLDLPKASDADLLDEYSRIQYRLEPISNSTTKSSKLEIPFRLEV-TPSGQPGLVLTEDLDAETNARHEFVLVAYSSAPVWNPSTSGKWSGLERGKMASQVPIPTEDRLYIEIEVADMNDNEPRFDSPSYKVSIAEDTPPGTMIYKLVAHDPDSTAQLVYSMGSSAEVAVMSATFNVESSGVVRLRSFLNFELRHTYKVPIRVNDGEFTAQSSLFVHVLDVNDEPPEFEVNPKRLVADENASVGKLIGRVRIQDPDSEAVNGKVECWEPEDLRRHQVLSFLPDPMSNPSASVYDLTTRVVLDREAFIGPQLGRLF----VYLICSDGNGLPNENRPGVKHTATMTATLMVRDVNDHPPVFSQSVYHVAVRENNLLGEKIIQVKATDADEGDNAKISYSLLDRANFKVDSLTGWITANVIFDRETRDSYQVTVVANDHGKERLSSSVLLNLTILDVNDHRPHLLPCEGELPIIDRAHLQTGRIGDRNLFAIQENLSGNTF-IGELLAKDDDIGLNAKLHFELAKETPLHYLTQFRLLHNGSLYTNRELDREEKEYYRLSVRVTDLSPTDPLSSTGTISIIVLDVNDNAPNFVQPSGLLRVGFDRPVVEDDSSPNILYDQPQLQNEVSSPVPLTSSNPKPTVLLSVREKPGYLITKLHAKDPDTGPNGHIRYTLAEFSDASTDFGSGSKTNPICRVTHDSGNVVLQRHLTVTDLGMHYFKVAAIDDGYPTPLKDTKILAVLVKDIPAVGSEPTNSLSSSYYSNNRTRFEFELWGFEGKSNLFIITVLASVSGLLASVLVTAIVCVSGPCSKNRSGICS 1019          
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Match: A0A3R7GEZ6 (Protocadherin alpha-2 OS=Clonorchis sinensis OX=79923 GN=PCDHA2 PE=4 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 3.916e-119
Identity = 272/861 (31.59%), Postives = 441/861 (51.22%), Query Frame = 3
Query:  561 VWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRE-SEINLLRDRKIYLPQAIDNDVTEKNRKILYELH--------QNEEEF-FRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEA------WNEGMKEKKS-----------------QIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRL-FLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNE--RIHPIRTALLICSDGHGTNNA-----QLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSD--------------------FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLM----WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-----------------------RDNIAGP----TNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYF----------EIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-PLSDIKVLLINLADIPPGLNNQKGSDINSP-----------KTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHI 2801
            +  ++S  A+       +D NDN P F  + + HR   E+   + R++ LP+A D D+ ++  +I Y L          N+ E  FRL + + +G+P +V+ ++LDAE+ + H  +L A      WN     K S                 ++ I+ EV D NDNEP F+  +Y ++I E+TP  T IYK+ A DPD TA+L Y + +S ++A+    F V+  G + L   L++E+   +   + V DG + A +++ + V D+NDE P   +NP +L   EN   G  +G+++I D DS  VNGK+ C+EP+ +   Q  +F PDP     ++++++ +R+  DRE F   +  R+       L+CSDG+G  N      + T T T ++++ DVND+ PVF+ S+Y++   ENN +   I QV ATD DEG N++I+Y +L+  +FK+DS++GWI A  IFDRE  D Y VT+ A DHG   L+++V +N+TI D ND+ P L+                        F+++EN   +   IG L AKDDDI  N ++ F+L      P+   F +  NG++Y     DRE+++ Y + +R++D    +   +   + I +LDVNDN+P F++P  LL                        ++ ++ P    +N P   + LS+ E PG  +  + A D D   NG I Y+L         F           +  D G + + + L+ SD+G +   V A D+G P PL DIK+L + + DI P + ++  + ++S            + W   G + N+ I+ VL+ +S +L  VL+T I C+  PC  + S I
Sbjct:   31 IMSDSSLRAVHRISVRVQDLNDNGPKF-SQVRWHRRLKEVLYRKGRRLDLPKASDADLLDEYSRIQYRLEPISNSTTKSNKLEIPFRLEV-TPSGQPGLVLTEDLDAETNARHEFVLVASSSAPVWNPSSLGKWSGSERGKMASQVPIPTEDRLYIEIEVADMNDNEPRFDSPSYKVSIAEDTPPGTMIYKLVAHDPDSTAQLVYSMGSSAEVAVMSATFNVESSGVVRLRSFLNFELRHTYKVPIRVNDGEFTAQSSLFVHVLDVNDEPPEFEVNPKRLVADENASVGKLIGRVRIQDPDSEAVNGKVECWEPEDLRRHQVLSFLPDPMSNPSASVYDLTTRVVLDREAFTGPQLGRLF----VYLVCSDGNGLANENRPGLKHTATMTATLMVRDVNDHPPVFSHSVYHVAVRENNLLGEKIIQVKATDADEGDNAKISYSLLDRANFKVDSLTGWITANVIFDRETRDSYQVTVVANDHGKERLSSSVLLNLTILDVNDHRPHLLPCEGELPIIDRAHLQTGRIGDRNLFAIQENLPGNTY-IGDLLAKDDDIGLNAQLHFELAKETPLPYITQFRLLHNGSLYTNKELDREEKEYYRLAVRVTDLSPTDPLSSTGTISIIVLDVNDNAPNFVQPSGLLRVGFDRPVVEDDSGSNILYDQPQLQNEVSSPVALASNNPKPTVLLSVREKPGYSITKLHAKDPDTGPNGYIRYTLAEFSDASTDFGSGSKTNPICRVTHDSGNVVLQRHLTVSDLGMHYFKVAAIDDGYPTPLKDIKILAVLVKDI-PAVGSEPTNSLSSSYFSNNRTRFEFELWGFEGKS-NLFIITVLASVSGLLASVLVTAIVCVSGPCSKNRSGI 882          
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Match: A0A4E0RI73 (Protocadherin gamma-B5 OS=Fasciola hepatica OX=6192 GN=D915_000709 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 1.818e-117
Identity = 299/1016 (29.43%), Postives = 511/1016 (50.30%), Query Frame = 3
Query:  333 TIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC-------------------DNN-------EANCKAD-QPTMTCTVNVW-DENSFLAIITTVFLFEDENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEF------FRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWN----EGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNS-VKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDRE--EFLNNERIHPIRTALLICSDGHG-----TNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEE-----NRNVSL-----GP----IGYLKAKDDDIAENGEIRFDLMWPH----KGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNA-----------PTT-------------------------------------PIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFE-----------IDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGV-PPLSDIKVLLINLADIPPGLNNQKGS--DINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFSRGQRYESSFDNQSKNLDHLNDLELLSNLDKQYGDFHPNLSDEFENRT-LIIPSSIYEQTNYRI 2993
            T+ S  + +   +F + +L     ++Y+F   +  F++ E++G ++T + +D EE+C                   DNN          C  D   T+   +N    + S L+I  T     D NDN P F  P  +++ +E+     + R++ LP+A D+D++ +N +I Y L    E+       FRL + S  G+P +V++++LDAE  S + ++L A++    +G  + ++ + +  EV+D NDNEP F++  Y +++ E+T + + I+++ A DPDK+A L+Y +  S + L +   F V  +G + L   LDYE  + +   V+V DG + A   + ++V D NDE P   +NP  +   E+   G  +GQ++I D D  +VNG + C+EP G+   QP  F PDP     S+++++ +R+  DRE  ++  + R+       L+C DG+      T N Q T T T+++ I+D ND+ P+F +++Y+    ENN I   I QV ATD DEG N+++ Y +L+  +F++D VSGWI+A +I+DREE D Y VT+ A D G P ++++V +N+TI D+ND+ P+L+S+++    E     NR   L      P    IG L+A D+D AEN E+ F ++  +    K  F +  NG++Y  +  DRE+++ Y   + ++D    N   T   + I + D NDN P F+ P  LL+ D+I    +A           P T                                      I +S++E PG ++ T++A D D D+NG+I Y  +  + +   F             + D G I + + L +SD+G + I V ASD  V  PL   K+L++ + DIP    ++ GS   ++S    +   +   +   ++++ I+ I  VV+ T+++ ++   R HN        R +S F  Q K  + +  L+   + +K       N SD FE R  L++ S    Q + R+
Sbjct:   59 TVNSLVSSVQNGYFENPQL--QVGVKYQFGAPSSLFTVNEQTGLVSTMAVLDAEELCKKAREEEQSGKGTISEQRRDNNHLFDIVDRVTCSPDGNLTVHADINALRPDASLLSIFQTRIHIRDLNDNSPTFDPPRWYRSLKEALYQ--KGRRLDLPKARDDDISPRNNQINYRLEPYTEDVRNTFGPFRLEV-SPMGQPSLVLVEDLDAELHSEYHLVLFAYSPVPMDGAPDTEANLKLDIEVIDMNDNEPRFSKELYKVSVSEDTAVGSVIFQLIANDPDKSANLTYAIKTSEMDLILSSTFRVMPDGRVQLTGPLDYEGQRSYEIPVQVRDGEFTAYAVLTVQVMDTNDEPPRFELNPKHIIASEHASPGMLIGQLRIYDSDGEDVNGNVRCFEPTGLERSQPLAFLPDPRQQPYSSVYDLTTRLFLDRESDDYAKDGRLF----VYLVCVDGNDVHSGRTANRQHTSTMTITLTIQDENDHSPLFDQTVYHAQIPENNEIGEKIIQVQATDMDEGPNAQVVYSLLDRTNFEVDPVSGWISANRIYDREERDSYQVTVIASDQGVPQISSSVLLNLTILDQNDHAPRLVSTNEHGRGESDNRCNRCTLLYVYENSPANTLIGNLQALDEDSAENSEVHFRMLEDNEPLIKTQFRLLRNGSLYTAIELDREEKEGYIFTVLLTDQSIINALSTTGTVTIIVRDENDNPPVFVGPKVLLNADHIESLQSAHSENAHWLYDQPLTDSKEVKYSQEKEAILVEKSDPHISDVAYERNSSTEQNSIRVSVHEEPGYLIATLQATDPDKDENGQIVYRAEEVVRIRENFTTRDKTRRGMLWTNSDLGHIVLRRQLDKSDLGVHFIRVTASDRSVLKPLKVSKLLILLVEDIP---KSKLGSIYPLDSTVMQESQTAQGAIWGSLLITAITVISFVVIATILTTIILCSRRHN--------RGDSCF--QRKQNESVVKLKTEQHAEKSNPFTFQNPSDGFEKRADLLLDSKEMTQEDQRV 1052          
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 263.462 bits (672), Expect = 2.011e-72
Identity = 237/786 (30.15%), Postives = 356/786 (45.29%), Query Frame = 3
Query:  330 TTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWD--ENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEE--FFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHLFVVEVFDGVYAASTT--ICIKVTDINDETPNIHINPSKL--------TIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHP--DPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLI 2600
            T IGS + D        + L  S  L YK      Y  +  K+G I TT+  ID E + D      K     +   V+V D  +N    +I      +D NDN P FP    T    E N        +PQA D D TE+N  + Y+L    E    F L + +  G+  P ++VL NLD E + ++ + + A + G   + S  +++  + D NDN P F +S+Y   + EN+P+  ++ +++A D D      + Y +  +     + L + +  G I +   LD  EI      V+    G    S+T  + I+VTD ND  P + I    L         I E++  GT V  +++SD+D  E N  + C     +    PF   P  D S+  +   F             L+ ERI   R  ++    G    N  L+ T +L V + D NDN P+F+  ++ + F E N     +  V+A D D G N+ + Y I+  +     F+ID  SG + A    DRE  + Y   + A D G PS   T  V I + DRNDN P+ ++SS  FSV EN    L P+G +   D D  EN +++   + P  G F +    GTI + +SFDREKE  Y  RL+  D G E  + +YV + I +LD NDN+P   +P     R               LS    P  ++  ++A D+D   N ++ YS  I  G P   F I    GEIK+++ L+R   G +R+ V  SD G P    I ++ I
Sbjct:   37 TLIGSLAAD--------QGLPDSGHL-YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKD---CRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQE-NAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGE-NAVVTCV----VAGDVPFQLRPAGDSSVDNKKKYF-------LQTTTPLDYERIRDYRVEIVAVDSG----NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMP-PLSPVGMVTVLDMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR--------------RLSPLAAPDSVVEVVEAEDIDYGSNAELVYS--IAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 773          
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 264.233 bits (674), Expect = 6.397e-72
Identity = 237/786 (30.15%), Postives = 356/786 (45.29%), Query Frame = 3
Query:  330 TTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTCTVNVWD--ENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEE--FFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHLFVVEVFDGVYAASTT--ICIKVTDINDETPNIHINPSKL--------TIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHP--DPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLI 2600
            T IGS + D        + L  S  L YK      Y  +  K+G I TT+  ID E + D      K     +   V+V D  +N    +I      +D NDN P FP    T    E N        +PQA D D TE+N  + Y+L    E    F L + +  G+  P ++VL NLD E + ++ + + A + G   + S  +++  + D NDN P F +S+Y   + EN+P+  ++ +++A D D      + Y +  +     + L + +  G I +   LD  EI      V+    G    S+T  + I+VTD ND  P + I    L         I E++  GT V  +++SD+D  E N  + C     +    PF   P  D S+  +   F             L+ ERI   R  ++    G    N  L+ T +L V + D NDN P+F+  ++ + F E N     +  V+A D D G N+ + Y I+  +     F+ID  SG + A    DRE  + Y   + A D G PS   T  V I + DRNDN P+ ++SS  FSV EN    L P+G +   D D  EN +++   + P  G F +    GTI + +SFDREKE  Y  RL+  D G E  + +YV + I +LD NDN+P   +P     R               LS    P  ++  ++A D+D   N ++ YS  I  G P   F I    GEIK+++ L+R   G +R+ V  SD G P    I ++ I
Sbjct:   73 TLIGSLAAD--------QGLPDSGHL-YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKD---CRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQE-NAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGE-NAVVTCV----VAGDVPFQLRPAGDSSVDNKKKYF-------LQTTTPLDYERIRDYRVEIVAVDSG----NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMP-PLSPVGMVTVLDMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR--------------RLSPLAAPDSVVEVVEAEDIDYGSNAELVYS--IAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 809          
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 254.218 bits (648), Expect = 4.410e-69
Identity = 238/858 (27.74%), Postives = 399/858 (46.50%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKS-GTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDGVYAAS-TTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-PLSDIKVLLINLADIPPG---LNNQKGSDINSPKTWQMFGS----TNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSH-IFSRGQR 2819
            IG+  TDL      + +L  + Q +  +   +      E S G I TT + ID E +C    NE  C  +       V V  +  F  ++   FL ED NDN P+F          E   + +R   +P A D DV   N    YEL ++  EF    I++  G   P ++V +NLD E++    + ++  + G   K S  +++  V D NDN P F  S   + +PEN P+ T++ ++ A D D    A++ +   N +  A +R F +    G I + + LD E + +H  +V   DG    S  T+ + VTD+ND  P+I     +NP   T+   EN    T +  I ++DRD+ ++NGK+ CY     ++  PF   P   +  +  + E  + + ++        R + I+   ++ SD   +    L  +  + + I+D NDN PVF +    +   ENN     + ++ ATD D G N+ I Y +     + F ID  SG ++  K  DRE+ + Y  T+ A+D+G+  L + V V + + D+NDN P    +  +F V EN  +  G +G +   D D  +N  +   ++   K  F I P  G I   ++FDRE++  Y   ++  D+G   +  +Y  + I ++DVNDN P F+ P    S D +   TN             PG ++  + AID D   N ++ YS  I  G PR  F ID+  G I + + ++ +D G +R+ V   D G P  L  I ++ + + D       L  Q    + +P    +  S      N  ++VV++ I+  + V+L+  ++ ++  CR    H +  +G++
Sbjct:   80 IGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYE-----IEVAVLPDEIF-RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNR-YPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCY----TDHDVPFRLKP---VFNDQFLLETAAPLDYE------TTREYAIK---IVASD---SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPL-YGTVGLITVTDADAGDNAIVTLSIIN-GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLI-QTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTN-------------PGSVVTRVFAIDNDTGMNAELQYS--IIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALVR-CRQTPRHKVVQKGKQ 890          
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 254.218 bits (648), Expect = 1.502e-68
Identity = 238/858 (27.74%), Postives = 399/858 (46.50%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKS-GTI-TTKSTIDLEEICDN--NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDGVYAAS-TTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP-PLSDIKVLLINLADIPPG---LNNQKGSDINSPKTWQMFGS----TNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSH-IFSRGQR 2819
            IG+  TDL      + +L  + Q +  +   +      E S G I TT + ID E +C    NE  C  +       V V  +  F  ++   FL ED NDN P+F          E   + +R   +P A D DV   N    YEL ++  EF    I++  G   P ++V +NLD E++    + ++  + G   K S  +++  V D NDN P F  S   + +PEN P+ T++ ++ A D D    A++ +   N +  A +R F +    G I + + LD E + +H  +V   DG    S  T+ + VTD+ND  P+I     +NP   T+   EN    T +  I ++DRD+ ++NGK+ CY     ++  PF   P   +  +  + E  + + ++        R + I+   ++ SD   +    L  +  + + I+D NDN PVF +    +   ENN     + ++ ATD D G N+ I Y +     + F ID  SG ++  K  DRE+ + Y  T+ A+D+G+  L + V V + + D+NDN P    +  +F V EN  +  G +G +   D D  +N  +   ++   K  F I P  G I   ++FDRE++  Y   ++  D+G   +  +Y  + I ++DVNDN P F+ P    S D +   TN             PG ++  + AID D   N ++ YS  I  G PR  F ID+  G I + + ++ +D G +R+ V   D G P  L  I ++ + + D       L  Q    + +P    +  S      N  ++VV++ I+  + V+L+  ++ ++  CR    H +  +G++
Sbjct:   80 IGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYE-----IEVAVLPDEIF-RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNR-YPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCY----TDHDVPFRLKP---VFNDQFLLETAAPLDYE------TTREYAIK---IVASD---SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPL-YGTVGLITVTDADAGDNAIVTLSIIN-GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLI-QTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTN-------------PGSVVTRVFAIDNDTGMNAELQYS--IIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALVR-CRQTPRHKVVQKGKQ 890          
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 250.366 bits (638), Expect = 6.845e-68
Identity = 213/766 (27.81%), Postives = 359/766 (46.87%), Query Frame = 3
Query:  336 IGSFSTDLSYQFFRSKRLFKSTQLRYKF---SKENKYFSLTEKSGTI-TTKSTIDLEEICDN---NEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG-VYAASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            IG+   DL+     +     S  L Y+    + +N    +   +G I TT + ID E++C      ++ C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D+   N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN P F +S   + IPE++P+ T++ +++A D D    A + Y     V  A RRLF L    G I + R LD E    H   V   DG   +A  T+ I VTD+ND  PNI     I+P+  T+   E     T +  I +SD+D+ +VNGK+ C+    +    PF      ++     + E  + + ++  +    E I  I     + SD   +    L  T  + V +ED NDN P+FT+ +  +   ENN    ++  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDRE+ + ++ T+ A+D+G  +L +   V +TI D+NDN P+   +   F V EN       +G +   D D  EN  +   ++  ++ +      G I + VSFDRE++  Y   +R  D+G      +   + I ++DVNDN P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +       F ID   G I + +  + +D G +R+ V  SD G P
Sbjct:   40 IGNIPKDLNISHMNTAT-GASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVIL------PNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPDMG-PNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDT-DVNGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTK----EYIFKI-----VASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHP-PCSSAAKVTINVIDVNDNPPIVIYP-----------PSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTI-VNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 210.305 bits (534), Expect = 6.707e-56
Identity = 225/798 (28.20%), Postives = 357/798 (44.74%), Query Frame = 3
Query:  285 ENYQTSFIVYETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVW------DENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEE---EFFRLNI-DSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL-----DNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINP------SKLTIKENLISGTFVGQIKISDRDSVEVNGKICC--YEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWP-HKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGV 2567
            E  +    +   SV   +  ++ +L+Y+   SK    +  L     +  + F+   K                 + EA C    P   C V+V           F  +I      ED NDN P F     T    E N    ++  +  A D D +E N    YEL  ++      F L++ ++  G+  P++VV K+LD E +  + + L A + G        V++  V D NDN P F+Q+   + IPEN+P+ T++ ++ A D D    A + YRL             +RLF L Q  G + +N  L+ E   ++  ++   D       A+ T+ + VTD+ND +P I I          + I E       V  I +SD D +  NG + C  Y P+    L+  T+          N + +++R T D E    NE +  I+ A     D   T+   L+ T ++++ + D NDN PVFTE  Y +   ENN I  H+  V ATD+D  +N+ + Y +       F +D  +G I+  +  DRE+  +Y  TI A+D G P L     V + + D NDN P+  ++  DF V EN       +G +   D D  ENG +R  ++   ++  F I P +G I + V FDRE+   Y + ++ +D G+  +  T V + I ++D+NDNSP  + PP      N       P T        +PG I+  + A+D DA+ N ++ Y   I  G P   F ID   G I + + L+ +  G +R+ V  SD G+
Sbjct:   45 EELREGAFIGNPSVDLRLADYNLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKM----------------DREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPE-NAPAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPD-IGANGAVTCYIYNPEVPFQLKKLTY---------PNQYLLETRETLDYE--TKNEYVVQIKAA-----DAGATS---LSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVP-KHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSST-VKVVIHVMDINDNSPIVLMPP-----SNTTYKFVVPRT--------LPGTIVTEVSAVDNDAEINAELRY--HIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGI 787          
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 2.993e-53
Identity = 202/746 (27.08%), Postives = 316/746 (42.36%), Query Frame = 3
Query:  300 SFIVYETSV--KTTIGS-----FSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRD-----RKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILE--AWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTAR-----LSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV-----YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSR-ITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI---LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQET-YVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSL 2435
            S  +Y  SV    T+G+      +TDL    F         Q+ Y FS ++  FSL   SG I+  + +D E              P  T TV   D               D NDN PVF       R+S +   R+       +   +A D D +  N +I Y +          +I    G   V + + LD E     T+ L   A + G     S +    EV D NDN P F++++Y I IPEN      +  + A D D++       L Y L+ S +  I         G I     LD E    ++ +V   DG           T+ I + D+ND  P     P  +TI EN   GT +  +  +D D  E    +   +P            P+P     +   +I++  +  DRE+ LN      +R+ ++  +D  G+   + T + T++VL++DVNDN P F    Y +  +E    ++ + QV ATD DEG N  +TY +   L   DF++D+ +G I  +   DRE +  Y + + A D G P+L++T  +++ + D NDN P    + S  S+ E+       I  L   D D   N E+ F +   ++ G F +   +G +   VS DRE +  Y + +   DNG    + T    L + +LDVNDN P F+E  Y                  E+S+ E    G I++ ++A D+D   NG++ Y +
Sbjct:   31 SLPLYNVSVWENATLGTSVVQVLATDLDAGVF--------GQVSYHFSDDSDKFSLDPASGLISVAAALDFEA------------TPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVF------QRDSYVGTARENDNSLTPVVRVRATDED-SPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRIN-----ARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP------------PNPFYRINAASGKIRTTGLQLDRED-LNPISFASMRSIVVSGAD-RGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVIS-LNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSY------------------EVSVPENVTRGAIILQVQATDIDEGINGRVWYRI 711          

HSP 2 Score: 143.28 bits (360), Expect = 1.886e-34
Identity = 162/595 (27.23%), Postives = 258/595 (43.36%), Query Frame = 3
Query:  891 NEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL-DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE----GQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTT--VKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTI-YAKVSFDREKEDR---YCMR---LRISDNGKENKQETY-VHLCIKILDVNDNSPQFMEPPYLLSRDNIAG-PTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            NE   E      +   +++ NDN P F+   Y +++ EN  L T++ ++ A D D     ++SY   D+S K +     L    G I +   LD+E        V   D G    +  + I + D+ND TP    +    T +EN  S T V +++ +D DS               NN   ++  P  + +   +I              L+ E+I     +L I +   G+     T+T  + V   D NDN P+F  + Y+I   EN    A +  V ATD D+    GQ S I Y +  S  F+I++ SG I +  + DRE +  Y++ ++A D G+ +   T    VNIT+ D NDN P       ++V    N   G  I  + A D D+ ENG + + +  P+  Y     +G I    +  DRE  +      MR   +  +D G   ++ T    + + + DVNDN P F+  PY L    + G P N+                L  + A D D   NG ++YS+   L  P  F++D   G I     L R  + +Y++ ++A+D G P LS    L + + D+
Sbjct:    4 NETSGEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFS-----LDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPP-------------NNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVF--DENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAW-RDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQV--LEGLPANS---------------TLFQVTATDPDEGANGNVTYSMTAALPRPD-FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDV 558          

HSP 3 Score: 124.405 bits (311), Expect = 1.186e-28
Identity = 137/533 (25.70%), Postives = 233/533 (43.71%), Query Frame = 3
Query:  402 QLRYKFSKENK-YFSLTEKSGTITTKSTIDLEEI---------CDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAES------QSNHTVILEAWNEGMKEKKSQIVIKFEVL--DFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEID---QMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWIN-AMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKV 1916
            QL   +S E    F +  +SG IT+ + +D E +          D  + N   DQ T   TVN+                 D NDN P +   P+          N      I+   A D D+ E N  ++Y +      F+R+N  + +GK     L+ LD E        S  ++++   + G   +++       VL  D NDNEP F    Y + + E  P ++ ++++ A DPD+ A  +     +  L      L    G I     LD E     Q+ L   +      +++TT+ + V D+ND  P  H   S +++ E++   + V  +  +D DS  +N ++  +   G  + Q F+      +        +++ ++ DRE   +         +L+I +  +G   ++ T T TL VL+ DVNDNRP+F E  Y +   EN    A I QV ATD DEG N R+ Y I+  N   +F ++  SG I+      DRE +  + + ++A ++ +  L++ ++V
Sbjct:  276 QLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGN---DQKTGIATVNI--------------TLLDVNDNDPAWRDLPYAVTIVE----NTPGGTDIFTVSAADPDLNE-NGTLVYAIDP-PNPFYRIN--AASGKIRTTGLQ-LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADS-GLNAELSFFITGGNQDGQ-FSVGFRDGL--------VRTVVSLDRETKASY--------SLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVIRV 764          

HSP 4 Score: 114.39 bits (285), Expect = 1.158e-25
Identity = 164/719 (22.81%), Postives = 286/719 (39.78%), Query Frame = 3
Query:  405 LRYKF-SKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQP----TMTCTVNVWDENSF---LAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEK------KSQIVIKFEVLDFNDNEPFFNQ-STYVITIPENTPLSTNIYKIEAIDPDK----TARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRG-LDY--EIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPS--KLTIKENLISGTFVGQIKISDRDSVEVNGKICC-YEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI--LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLI---SSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG--------YFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIK-AIDLDADKNGKISY 2429
            +RY   S  N  F + E +G I T + ID E   +        DQ     T +C + V  +N     L+     +        VP         R +   +    K+ LP AI      ++++     H+ +E      I +  G+  +     LD E+  ++ + + + + G +E       K    +   V D NDN P F   S  ++ + E+    T +  + A D D     T           ++  + + ++Q E G  I++    D+  +  Q  LF +   DG     +T   + + V D+ND  P I ++P    +++ E    GT V  +  +D D+   NG++    E  G + L         SI     I  +      DRE           R A  +        N  L+ +  + VL++DVND RP F   +  +  +E+  + + +  V AT+  +G N++ TY I  +  N F + + SG + + ++    E   + +T  A DHG P L     + + + D ND+ P  +   + +  ++ E   V +  +  L A D D  +NG +R+  +  H G         F I   +G I    + DRE +  Y + L  SD G+    E+   L + + D++DN P F+  P             AP     +  +  PG  +  +  A+D D   N  + Y
Sbjct: 1648 VRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVP----GTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKR-----HKQQESDNAELIAALQGE--ITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVP-IFLSPGGYAVSVVELGAPGTLVASVWATDADAGP-NGQVTFRIESGGGDKL---------SIGPSDGIIRVAPGANIDRET----------RAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYE--RFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVL-AVDGDEGQNGAVRYSFL--HAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLP----------DGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYY 2319          

HSP 5 Score: 113.235 bits (282), Expect = 2.673e-25
Identity = 171/675 (25.33%), Postives = 271/675 (40.15%), Query Frame = 3
Query:  771 NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAW----NEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTP-------LSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGW---IILNRGLDYEI---DQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLIS-GTFVGQIKISDRDSVEVNGKICCYE-PDGMNNLQPFTFHPDPSITQESNIFEIKSRITFD-REEFL----NNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL-------------ESNDFK-IDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVN-------ITIGDRNDNPPQLISSSDFSVEENRNVSLGPI-GYLKAKDDDIAENGEIRFDLMWPHKG------YFDITPNGTIY-----AKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPP-YLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVS--QTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
             E  F+    DS+TG   V V + LD E  + + + L       N     K S I+I   +LD NDN P F+Q TY   IPEN+P       L+  IY  +A D    A L+Y L           FL+  +     + L +GLD E     ++ L ++    G   A+  + + V D+ND TP  ++      + EN  + GT V  +K  DRD    +     Y    G N+    TF     I + + +    + I ++ R E+L      ++  P  TA                 +  L V +++  D +  F+ + Y     E       + +V A          +   IL             ES++ + I ++ G I      DRE  D Y++T+ ++D G P     V  N       + + D NDN P+  + S   VE   + + G +   L A D D   NG +       H G      Y  I  N +       AK  F  +       R+   D G   +  T+ +L + +LDVNDN P F+ P  Y +S              +EL     PG ++ ++ A D DA  NG++++  +I  G      I    G I+V+    + R    +Y + V+A D G PPLS   ++ + + D+
Sbjct: 1436 GERAFYA---DSQTG--LVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI-VTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDA-DFGVNATLAYSLLGGSS----AYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGND----TF----GIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTA-----------------SCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRD-GGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSAR-AHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTF-NLSVIVLDVNDNVPIFLSPGGYAVSV-------------VELGA---PGTLVASVWATDADAGPNGQVTF--RIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDV 2053          

HSP 6 Score: 107.842 bits (268), Expect = 1.154e-23
Identity = 154/618 (24.92%), Postives = 245/618 (39.64%), Query Frame = 3
Query:  849 AESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPEN-TPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQ-MHLFVVEVFDGV------YAASTTICIKVTDINDETP-NIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPS----ITQESNIFEIKSRITFDRE--EFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN------DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDH-GNPSL---NTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI-----GYLKAKDDDIAENGEIRFDLMWPHKGYFDI---TPNGTIYAKVSFDREK--EDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPT-----NAPTTPIELSIYEIPGQILVTIKAIDLDAD--KNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            A S S   + L A        ++   +   + D NDN P F  +TY + + E  +     +  + A DPD+   AR+ Y + +    A     +    G +   + LD+E+   ++L VV   D          ++ T+ + V D+ND TP  +      + + E    G  +     SD+DS  +NG++     DG           DP     I+       ++  +  DRE   F N          L I +   GT    L  T T+ V + DV+DN PVF     N    E   + A + +V A+D +EG+N         ++       F  DS +G +   +  DRE +  Y +T+  +D+  NPS    ++ + + +TI D NDN P + S   +  E   N   G +     G + A D D   N  + + L+     YF I     N ++      DRE     R  + + + D G+ N     V L + +LDVNDN+P F          N+   T     N+P            G  ++ +KA+D D      G + YS  I  G    F ID   G I     +       Y + V+A+D   P
Sbjct: 1137 AASASTRGICLTA-----TPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAAT--FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQ-PGPRIATFMASDQDS-GLNGELEYSIIDG-----------DPRNEFVISPADGDLRVRRYVELDRETQAFYN----------LTIMAKDMGT--PPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI-VTILDENDNSP-VFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNAT---VRLGVTVLDVNDNTPTF----------NVTSQTAHVLENSPAV----------GTSVIVVKAMDRDLGVCDAGTVRYS--IASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPP 1695          

HSP 7 Score: 95.5153 bits (236), Expect = 6.584e-20
Identity = 171/785 (21.78%), Postives = 301/785 (38.34%), Query Frame = 3
Query:  414 KFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEIN---------LLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTP-LSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFV-----GQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTIT----FTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVL-ATDKDEGQNSRITYDILESNDFKI----------DSVSGWINAMKIFDREEMDHYVV-TIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAK----DDDIAENGEIRFDL---------MWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKIL--DVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
             F    + F    ++G +     +D E + +        D P          ++S + I+T +    DENDN PVF    +   E+EI           + +  IY   A D D    N  + Y L      +F   ID   G   + + + LD E      + L    +    + + + +   VLD NDN P FN ++    + EN+P + T++  ++A+D D     +  +  S+       F + E  G I+    +DYE    +L +V   D     + AS  + + + +  DE  +  +   +  + E  + GT V      Q+K   +  + +   +  +  D  +  Q      D +    +   EI ++   DRE   +          L + S   G   A   +T      + V + D NDN P F      +  +  +     +  VL ATD+D G N  ++         +I          +S    ++  K    E+   +++  I A D G+P  +TT  +++ + D NDN P  +S   ++V     V LG  G L A     D D   NG++ F +         + P  G   + P   I      DRE    Y + +   D G      + +   +++L  DVND  P F+ P   +S                LS+    G  + T+KA +     N K +Y +    G+ +  F +    G +  ++ L   +   + +  +A+D+G PPL     L + + D+
Sbjct: 1432 SFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYAR---KDSDIMIVTIL----DENDNSPVFS---QVTYEAEIPENSPNGTVLTVLNGPIY---ASDADF-GVNATLAYSLLGGSSAYFL--IDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQ----ESDNAELIAALQGEITTQAALDREATDSY--------MLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSV---VELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANI------DRETRAAYTLMVVAVDRGNPPLSGSAI---VRVLVDDVNDERPAFLAPVQTVSVLE------------SLSV----GSFVATVKATENYKGHNTKYTYKIA---GIGKNAFTVHATSGLVTSTRLLKSYE--RFNLTAVATDHGRPPLWGQAGLYVEVLDV 2155          

HSP 8 Score: 72.0182 bits (175), Expect = 8.788e-13
Identity = 162/714 (22.69%), Postives = 270/714 (37.82%), Query Frame = 3
Query:  585 AIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAE-SQSNHTVILEAWNE---GMKEKKSQIVIKFEVLDFNDNEPFFNQS-TYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNR--GLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVL-----ATDKDEGQNSRITYDILESND--FKIDSVSGWINAM--KIFDREEM--DHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIGYLKAKDDD--IAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGV--------PRYFEIDRDG--------GEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVL 2594
            A  + +    DENDN P F         +E        +    A D D  +  R +   +  N    F   ID+ TG   +  +K LD E S   + +++ A ++     +   S   +   V D ND  P+F +S    I + E  P    I    A D D      L Y +   +    R  F++   +G + + R   LD E    +   +   D G     ++ T+ ++V D++D  P     P+  ++ E       V +++ SD +       +  + P    N +   F+ D   +Q   ++  +          L+ ER+   R  L +  +    + A+      + V I D NDN PVF++  Y     EN+  +  +  VL     A+D D G N+ + Y +L  +   F ID   G ++    +  DRE +      +TI  QD G    N TV++ +T+ D NDN P   ++S    V EN       +  +KA D D  + + G +R+ +       F I    G I      D E    Y + +  +D        +   L + + +  D    F    Y  +                LS   +PG ++V + A  + A         L +PL +         R+ + + D         GEI     L R    SY + V++ D G  P   I VL
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATF--GIDNGTG--VLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSI---IDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGE-RAFYAD---SQTGLVYVNRP---------LDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI-VTILDENDNSPVFSQVTYEAEIPENSP-NGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTAS-CELRVSLQNELDEKLSFSLAAYQAA----------------LSEAAVPGTVVVRVAAPQMKAPPK------LPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGG--PREAIAVL 1817          

HSP 9 Score: 56.6102 bits (135), Expect = 5.229e-8
Identity = 105/517 (20.31%), Postives = 214/517 (41.39%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLP-QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG--VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTF-HPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVF-----TESIYNIFFM-ENNHIHAHIHQVL-ATDKDEGQNSRITYDILESNDFKIDSVSGW--INAMKIFDREEMDHYVVTIKAQDHGN------------PSLNTTVK-VNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLM 2078
            D NDNVP+F      +  S + L     +     A D D    N ++ + +     +  +L+I    G   V    N+D E+++ +T+++ A + G        +++  V D ND  P F      +++ E+  + + +  ++A +  K    + +Y++    K A    F V     ++ +  L    ++ +L  V    G         + ++V D+ND  P   + P+       +++ T V  + I   + + V+G       +G N    ++F H     +++   F I +           +     + + +L+ SD           T  L V+++D++DN PVF       + Y  F + E++     +  V  A D D G N+ + Y I   N+    ++S W  +  +   DRE   +Y + +KA  + N            PS + T++ V + + D ND  P + ++ +++     +  +G  +  L+A D D+  N  + + ++
Sbjct: 1945 DVNDNVPIF-LSPGGYAVSVVELGAPGTLVASVWATDADA-GPNGQVTFRIESGGGD--KLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNA----FTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNG-----TVVNITEVMPVVIRIVEVLAVDGD------EGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQG--QPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWP-VFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRIL 2439          

HSP 10 Score: 50.447 bits (119), Expect = 3.294e-6
Identity = 59/247 (23.89%), Postives = 108/247 (43.72%), Query Frame = 3
Query: 1902 TTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGT--IYAKVSFDRE-KEDRYCMRLRISDNGKE--NKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQ--TLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
             T  V I I D NDN P   +++ +  + E  + +   +  + A D D  +N  + + ++  +        NGT  + A  + D E     Y + +  +D  ++   +  +   + + + DVND +P F+                +   PI++S  + PG  + T  A D D+  NG++ YS  I  G PR  F I    G+++V +   L R     Y + ++A D G PPL+    + + + D+
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLR---------------SYEGPIDVSEGQ-PGPRIATFMASDQDSGLNGELEYS--IIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDV 1382          
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 1.345e-49
Identity = 203/770 (26.36%), Postives = 330/770 (42.86%), Query Frame = 3
Query:  399 TQLRYKFSKEN--KYFSLTEKSGTITTKSTIDLE---EICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILY----ELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQE-EGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSV--SGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFS---VEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDR------YCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQI--LVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS---DIKVLLINLADIPP 2621
             +LRY     N   +FS+ E +G +TT   +D E    +  N  A  +  QP          + ++ ++  T+    D ND  P+F  + K    +  N L    +    A D+D+ E N  + Y    ++     E FRL  DS TGK  V  LK+LD E    + ++++A + G     S   +   V D NDN P F    Y  +I EN P  T +  + A DPD+ A  + R   +   A R  F V    G +     LD E   ++   V   DG +  + +   + I V D  D  P    +     + EN+  GT VG +  S   ++++N  +      G             S + E +   I +    DREE    +  + +R            N+  +    ++SVL+ DVN++ PVF  + Y +   E+  +++    V ATDKD G+N  + Y+I E N  +   +   G +      DRE  + Y +T+ A D G   L+++V VN+T+ D NDN P L +SS +     EE    SL  +G ++A D D   NG + +    P   +   +  G I +   FDRE   R      +   +  +D G+    +    + + + DVNDN PQF +  Y                  + S+ E    +  L+ + A D+D   NG + Y++         F +D   G+I +  +L R +  SY + V A+D+G  PL+    + V +++  D PP
Sbjct:  374 AKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQP----------KTAYTSLTVTLL---DVNDEPPLF-TQTKYVATAVENSLPGLFVVSVSAADSDLGE-NGTVRYNFDPDMPAQYREMFRL--DSLTGK--VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSAS---TLDLNANVTYLIVSGDQR---------GSFSIEWSGGRIFTANAIDREE----QAFYQLRVV---------ANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP-LFNSSSYVFHFCEEQEVGSL--VGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVY------------------QASVSESASNLTQLLRVTASDVDEGVNGALRYAIN-EGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPP 1075          

HSP 2 Score: 180.259 bits (456), Expect = 8.939e-46
Identity = 170/664 (25.60%), Postives = 290/664 (43.67%), Query Frame = 3
Query:  843 LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTTICIKVT--DINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMW--PHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE-IP-GQILVTIKAIDLDADKNGKISYSL--KIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGS-YRIHVIASDNGVP------PLSDIKVLLINLADIPP-----------GLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAIL 2735
            +D E Q+ + + + A + G+  + S  V+   V D N++ P F++++Y ++I E+ P+++  + + A D D  K   + Y +           F +  +G + +   LD E  + +   V   D GV   S+++ + VT  D+ND  P  + +       E    G+ VG ++ +D D+    G    +E             P  +   +S    I S   FDRE  +          +++    G       L    T+ V ++DVNDN P F +S+Y     E+      + +V A+D DEG N  + Y I E N+   F +D+ +G I  +   DREE   Y + + A D G   L  +  V + + D NDNPP+  + S  SV+   +  +G +   L A D+D   +G++R+ ++    H  +      G+++     D E +  Y + +   D G+  +    + L + + D NDN      PP  L  D  A            SI E IP G  ++T+ A D DAD NG++ YS+  + P G   +F ID + GEI  +  + R   G  + + V A+D  +P       L ++ VL+ +  D  P           GL    GS + + +      + N  +   V  G +AIL
Sbjct:  719 IDREEQAFYQLRVVANSGGVAGEASVSVL---VHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNG---GEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE------------KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGR---PKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF-TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATI-LVVHVRDFNDN------PPAFLPGDVFA------------SIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGA--HFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAIL 1339          

HSP 3 Score: 155.606 bits (392), Expect = 3.197e-38
Identity = 162/639 (25.35%), Postives = 275/639 (43.04%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITI-----PENTPLSTNIYKIEAIDPDKT--ARLSYRLDNS--VKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV-YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRD---SVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL------------ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIG----YLKAKDDDIAENGEIRFDLM-WPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLL-SRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISY 2429
            ED NDN PVF    +   E E N      I+   A D D   +N  + Y +    E  F   +D+ +G   +   + LD E ++++ + + A ++G     +++ +   V D NDN P F++  Y   +     P+       I  + A D D      ++Y L  S     A     L    G + + R LD E    ++      DG   AA+  + + V D ND  P++  +     + E+   GT + +I  +D D   + E+   I   +P+G      F    D  ++       +   +  +R+ F N          ++  SD      A+L+    +S+++ DVNDN P FT S  +    E++ + A +  V A D D G+NS + Y +                 F +++V+G +  ++  DRE    Y +T+ A D G P L +T  + +T+GD NDN P+      + ++ E+      P G     L A D D   NGE+R+D+      G F + P  GT+      DRE+   Y + +R  D G   + +T   + + + DVND SP F   PY + +R+N  GP      P+          +++ + A D D   +G+++Y
Sbjct: 1507 EDVNDNPPVFAVP-EMELEVEENTGEGEVIFTLSATDAD-QGQNALVTYSVLSGSEGAFV--VDAASG--VLRASRRLDREERASYLLTVRA-SDGTHATDARLSVA--VRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR-----FAVGNDGQLS-------VARALDRERQSFYN---------LVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDE-----PPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDT-ASVRVTLSDVNDCSPAFQLSPYTVHARENTQGP------PV----------LILQVVARDDDLGSSGQVTY 2092          

HSP 4 Score: 145.591 bits (366), Expect = 3.233e-35
Identity = 163/688 (23.69%), Postives = 286/688 (41.57%), Query Frame = 3
Query:  612 EDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEP-----FFNQSTYVITIPENTPLSTNIYKIEAID---PDKTARLSYRLDNSVKLAIRRLFLVQEEGW-----IILNRGLDYEIDQMHLFVVEVFDG----VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI------LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF-SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPY-LLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLL 2597
            +D NDN P F  +   +R S              A D+ V    R +L+           +  D KTG   V   + LD E++  +T+ L A + G      +     ++LD NDN+P     +   +    ++ E+    T    +   D   P     LS  +   V    R  F++   G      + +   LD E   M+   +   D       +A+ ++ + V D+ND  P   ++     + E   +G++V  +   D DS  +N K+  Y     N+L  F      S+ + + +     ++  DRE          + +++++            T   +L+V + DVND  P+FT++ Y    +EN+     +  V A D D G+N  + Y+            F++DS++G +  +K  DREE++ Y + ++AQD G+P L +T KV + +GD NDN P       F S+ EN       +  + A D D   NG +R+ L       F +    G +  +VS DRE+   Y +++   D G    +   + + I + D  D  P F    Y  +  +N+A                 PG ++ ++ A  LD + N  ++Y L +       F I+  GG I  +  + R +   Y++ V+A+  GV   + + VL+
Sbjct:  127 QDANDNPPAF--EKPAYRAS-------------VAEDSPVGAALRDLLHRGRGP----LAVPFDPKTG--MVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSI---VGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADS-GLNAKLR-YSIVSGNDLGWF------SVDESTGLVTTDGKV--DRE----------VASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTA-VTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSFVVFENVA-----------------PGTLVGSVSASTLDLNAN--VTY-LIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLV 748          

HSP 5 Score: 144.05 bits (362), Expect = 9.566e-35
Identity = 191/803 (23.79%), Postives = 319/803 (39.73%), Query Frame = 3
Query:  402 QLRYKFSKE---NKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRK---IYLPQAIDNDVTEKNRKILYELHQNEEE-FFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGM----KEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAID-PDKTARLSYRLD--NSVKLAIRRLFLVQEEGWIILNR-----GLDYEIDQMHLFVVEVFDGVYAAS----------------TTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPS----ITQESNIFEIKSRITFDREEFLNNERIHPIRTALLI---CSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNH-----IHAHIHQVLATDKDEGQNSRITYDILESND-------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLM-WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKE--NKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKI--------PLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            +L Y  +++     +F++  +SG I T + ID E      E   +A        + V    S L  +T   L  DENDN P    +F T     ++ LR      +   QA D D  E N  + Y +   +    FRL  D +TG   +     LD ES      +     E      + ++++  I    + FN   P F         P++     N+ + + I  P     L + LD     +L    L L    G  ++N       + +++    +F+V  F  + ++                   + I V D+ND  P   +   +L ++EN   G  +  +  +D D              G N L  ++          +   S +     R+  DREE          R + L+    SDG    +A+L      SV + D NDN P F+   Y+    E+         A I  VLA D D G    +TY +  S D       F +  V+G +N  +  DRE    YV+  +A D G   L  T ++ + + D NDN P + + S  + E   +   G  +  + A DDD   N E+ F +     +G F +  +G +    + DRE++  Y + +R+SD  +    +  + V + + + DVNDN+P F  P   L+      P ++P            G ++ T++A+D D+ +N  + Y+L              P  F ++   GE+++ + L R    SY + V+A D G PPL+    L + + D
Sbjct: 1216 ELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRA----TDKAIPVHTRRSALKNVT--VLVTDENDNAP----RFVTPTAILVDGLRAAAGSVVGTLQASDPDEAE-NAAVRYAVTGGDAAILFRL--DRRTG--IIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRF---------PQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIV--FSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQ-------------GQNALVTYSVLSGSEGAFVVDAASGVLRASRRL--DREE----------RASYLLTVRASDGTHATDARL------SVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDS-LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA------PEDSPV-----------GAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGD 1941          

HSP 6 Score: 139.813 bits (351), Expect = 2.003e-33
Identity = 118/475 (24.84%), Postives = 202/475 (42.53%), Query Frame = 3
Query:  831 VLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD------GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESN--------IFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLK--AKDDDIAENGEIRFDLMWPHKGY-FDITPNGTIYAKVSFDREKEDRYCMRLRISD 2189
            V + LD ES++ + +   A + G     +++ +   VLD NDN P     +    +PE+ P  T++ +I A D D+   A L + + +         F V  +G + + R LD E    +  VV V D         +++  + + +TD+ND  P    +P      E+   G  V  ++  D DS             G N+   +    D                +  +   +   RE  L+ E        +L    G       LT T TL+V + D NDN P F    Y     E+      + ++ A D DEG N  + YDI     + DF++D V G +   +  DRE    Y + ++A+D G P+ + T  V +T+ D ND  P     S ++V    N    P+  L+  A+DDD+  +G++ +     + G  F ++P+G ++   S DRE + ++ + +  +D
Sbjct: 1685 VTRPLDRESRACYVLRARATDGGGLAATARLYVN--VLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP---EGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDS-------------GRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRE--LDREARQSYALTVLAVDKGR----PPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF-QLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 7 Score: 124.02 bits (310), Expect = 1.356e-28
Identity = 143/592 (24.16%), Postives = 226/592 (38.18%), Query Frame = 3
Query:  927 IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLV-QEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLI-----SGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQ--PFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVS--GWINAMKIFDREEMDHYVVTIKAQD---HGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLM----------WPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIY--EIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRY-FEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            ++  V D NDN P F      + + ENT     I+ + A D D+   A ++Y    SV       F+V    G +  +R LD E    +L  V   DG +A    + + V D ND +P    +     + E+       +   +G +   D DS           P   ++     F  HP   +T   N+         DRE           R   ++ +    T+   L  T  L V + D NDN P            E+      + ++ ATD DEG N+ + + I   +     +V   G ++  +  DRE    Y + ++  D   H    L++ V+V++ + D NDN P   S       E+  V    +  ++A D D   N  + + L               G F + T  G +      DRE    Y + +   D G+     T   L + + D NDN+P+F                  P    E +I   E PG  ++ + A D D   NG++ Y   I  G P   F +D   G + V++ L R    SY + V A D G P  SD   + + L+D+
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTY----SVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHP---VTGALNVTR-----PLDRES----------RACYVLRA--RATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVG-AVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTST-ATLAVTVGDANDNAPRF------------------PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRY--DIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDV 2047          

HSP 8 Score: 84.7297 bits (208), Expect = 1.254e-16
Identity = 100/357 (28.01%), Postives = 150/357 (42.02%), Query Frame = 3
Query: 1584 AQLTITFTLSVLIEDVNDNRPVFTE-SIYNIFFMENNHIHAHIHQVLATDKDEGQNS--RITYDILESNDFK--------IDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKE--NKQETYVHLCIKILDVNDNSP--QFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDA-DKNGKISYS-----------LKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            +Q T    + V++ DVNDN P F E  +  + F E+  +   +    A D+D G N      Y I+  N+                 +      DRE    Y + ++A+D G+P     ++VN+T+ D NDNPP     +   SV E+      P+G   A   D+   G  R  L  P    FD    G +  +   D E   +Y + LR +D G    + + T V   I++LDVNDN P  +F+   YL        P  A +  ++ S    PG +   +   D D+   NG++S S           L  P GVP           +KV+  L R  I  Y + ++ASDNG P
Sbjct:    1 SQPTYPTEVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAED-----SPVG---AALRDLLHRG--RGPLAVP----FD-PKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAV---IQLLDVNDNDPAIRFV---YL--------PPAARSASVDES--AAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAP-GVPGLR-------VLKVASQLDRERIPMYNLTILASDNGKP 318          

HSP 9 Score: 84.7297 bits (208), Expect = 1.297e-16
Identity = 84/361 (23.27%), Postives = 148/361 (41.00%), Query Frame = 3
Query: 1608 LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL----ISSSDFSVEENRNVSLGPIGYLKA--KDDDIAENGEIRFDLMWPH-KGYFDITPNGTIYAKV-----SFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIP--LGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPP---LSDIKVLLINLADIPPGLNNQK 2639
            ++V ++D NDN P F +  Y     E++ + A +  +L          R    +        D  +G ++  +  D E    Y ++++A D GNP L+      I + D NDN P +    +  +  S   + + + G +  L      D    NGE+   ++  + +G+F +   G    +V       DRE+   Y + +  SDNGK   +     L + + DVND++P+F    Y  +         AP            G  +  + A+D D+  N K+ YS+     LG   +F +D   G +     + R    S  +++ A D G  P    + + V L+++ D PP     K
Sbjct:  122 VNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLL-------HRGRGPLAV------PFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSE-----GAPA-----------GSYVKDVTAMDADSGLNAKLRYSIVSGNDLG---WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTK 450          

HSP 10 Score: 71.2478 bits (173), Expect = 1.593e-12
Identity = 90/343 (26.24%), Postives = 137/343 (39.94%), Query Frame = 3
Query:  405 LRYKFSK--ENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENS--FLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLF-------LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA--------ASTTICIKVTDINDETPNIHINPSKLTIKE-NLISGTFVGQIKISDRDSVE 1370
            LRY  ++  E   F++   +G IT   ++D EE              + T  V+  D  +    A  T      DENDN P F     +    E   + +  I L  A D D T  +  + Y +   N    F   ID  TG  F+   + LD E+Q  + + + A + G   + S  ++   V DFNDN P F       +I EN P+ T +  + A DPD        ++  +  +I R F       +  E G I     +D E+    LF V V     A        A   + + VTD ND  P   + P+ + +      +G+ VG ++ SD D  E
Sbjct: 1007 LRYAINEGNEGGKFTVDASTGQITLLGSLDREETA------------SYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITL-TASDED-TGPSGDVRYAIVAGNTHATF--AIDRSTGSVFLA--RRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDAD------VNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREV-TGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRF-VTPTAILVDGLRAAAGSVVGTLQASDPDEAE 1323          
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 171.4 bits (433), Expect = 9.046e-44
Identity = 165/624 (26.44%), Postives = 272/624 (43.59%), Query Frame = 3
Query:  303 FIVYETS-VKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLT---EKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKT-GKPF--VVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHIN------PSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--------FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL----ISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLM 2078
            + +YE     T +G  S DL        R+ +     ++  + +  FSL    E  GT++ +  ID E+ C   +A     +  + CT+          ++       D ND+ P F  + + H E   ++    ++ L  A D DV       L   H +E E F L + ++T G  +  +VV   LD E +  +T+ L AW+ G   +    +++  VLD NDN P F Q++  +T+ E+    T +  + A D D+     + Y   + V   +RRLF L  + G + L   LD+E++  +   ++  D       A   + + V DIND  P I ++         + + E     +FVG + +SD DS E NG + C+             HP   +    + + + +  + DRE+  +   +       L  SDG GT        FT+ +L  D NDN P F  S Y    +ENN   A++  V A D D   N  I Y+++ES            I+  SG I A++  D E M      ++A+D G P L T   V++ I D NDN P +    + +    V   R+  LG  +  ++A+D D   NGE+ + ++
Sbjct:   33 YALYEEQPAGTLVGRLSDDLQ------GRVAEHPSRHFRLMRRDD-FSLVHVEEADGTVSAREVIDREQQC--GQAPSCVIRFDVLCTL----PRGLFQLVHAEVELLDINDHAPDFA-RSEMHVEISESVALGTRVPLEGARDLDV---GGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAE-NGLVACH----------LRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLV-------LEASDG-GTPPRVAARQFTVRLL--DENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIV 618          

HSP 2 Score: 117.472 bits (293), Expect = 7.434e-27
Identity = 150/646 (23.22%), Postives = 260/646 (40.25%), Query Frame = 3
Query:  930 KFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVK--LAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV---YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRP------VFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKI----DSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG------YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEI---KVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPC 2780
            + E+LD ND+ P F +S   + I E+  L T +    A D D    A  +Y LD + +  LA+R      +   +++   LD E +  +   +  +DG     + +T + I V D ND +P        +T++E+   GT +  +  +D D             +G N    ++F   P   +   +F++  +     +  L  +  H + +   I         + +     + V +ED+NDN P      +       +F  E     + +  V  +D D  +N  +   +     FK+    D      N+    DRE+M  Y + ++A D G P      +  + + D NDN P+   S+ + S+ EN N     +  + A D D   NG I ++++           Y  I P+ G IYA    D E       +++  D+G      T   + ++I+D NDN+P    PP       +  P +A             G ++  ++A D D++ NG++SY  +I  G  R  F I+R GGE+     S T + +    + + V+  D G P LS    + I +     G     G+D   P    M       L V+ L    A+ +  ++ V S     C
Sbjct:  123 EVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVD-------------EGPNGEVVYSFS-SPVDAEVRRLFQLDPKTG---KLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSS--LDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN-NSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVP-PLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGL-----------GYLVTVVRARDSDSEANGELSY--RIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG---DDGADETQPLDASM-------LAVMALGAACALTLAAVVLVASTKSGSC 724          

HSP 3 Score: 71.633 bits (174), Expect = 1.027e-12
Identity = 75/305 (24.59%), Postives = 129/305 (42.30%), Query Frame = 3
Query: 1761 YDILESNDFK---IDSVSGWINAMKIFDREE----MDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENG--------EIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLG--VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            + ++  +DF    ++   G ++A ++ DRE+        V+           L   V   + + D ND+ P   + S+  VE + +V+LG  +    A+D D+  N           RF L    +   D      +  K   DRE+E  Y ++L   D G   +  T + + I +LD NDNSP F +                  T   +++ E   PG +L+T+ A D+D   NG++ YS   P+   V R F++D   G++ +   L       Y I + A D G   +     +L+++ DI
Sbjct:   64 FRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDF-ARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLAL--RARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTL-VRITVLDSNDNSPVFAQ------------------TSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDI 346          
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 2.062e-41
Identity = 182/696 (26.15%), Postives = 279/696 (40.09%), Query Frame = 3
Query:  594 TTVFLFEDENDNVPVF-PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEK-KSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVY---AASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIP----GQILVT-IKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTL---------SRSDIGSYRIHVIASDNGVPPLSDIKVLLINL 2606
            T   L EDENDN+P F   + +     +  +  D  + L  A D D    N  I Y L   +  F   +++  TG+  ++   +LD E + ++ + + A + G      S   +   V D ND+ P F  + YV   P + P  T ++ + A D D      L + L  S         +    G I   R L    D + L  V V DG     +A TT+ ++  D   E P     P   + +E+   GT    I +    S    G +  +   G N    F   P           E+      D E   + E +   R +               +    L V + D+NDN P F+ S +     EN      I  + A DKD G N ++ Y I++    N F+++  SG I ++   DRE +  Y +T+KA D G+P+ + TVKV I++ D NDN P+        V E+  V   P+  +   D D   N  I F L+ P    F I P+ G I      +RE    Y +++R SD            + I + DVNDN+P+F +  Y +                     E P    G+ LV  + A D D   NG++ + ++        F + RD GEI   + L         S +++  Y   V A D G PPLS    + IN+
Sbjct:   11 TVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSD--VALVNATDADAG-LNAIISYRLRGGDGHF---SVNPSTGQ--IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFS---VDPRRGVIHAARALQGPRDDLTL-TVRVSDGGAPPRSAVTTVTVRFRDAG-EFPRFAPGPRSFSFREDQPPGT---TITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSG--------EVSVHRALDHEYQHHYELVVEARDSGF----------PPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGF-PVLRVSTLDADEGPNAAITFSLLDPSL-PFSIHPSTGEITVSRRLNREDRSGYAVKVRASD----PAWTVSTDVTIVVDDVNDNAPRFGQTAYYI---------------------EFPEPSEGEALVARVSASDADDGANGQVFFFMRSQT---ENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 2 Score: 143.28 bits (360), Expect = 1.937e-34
Identity = 138/531 (25.99%), Postives = 237/531 (44.63%), Query Frame = 3
Query:  714 AIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG-LDYEIDQMHLFVVEVF---DGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAEN-GEIRFDLM-----WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDN 2258
            A D D    N  I+Y +   +      +I   +G   V+++  LD E++  + + + A + G + K     +   V D NDN P  N S Y   IPEN P  T +  ++A+D D    A   Y LD+        LF++ ++  ++  +G LDYE  Q +   V  F   D  + ++  + +++T +N+  P          + E+   G  VG +  +DRD+  ++G +  Y   G +  + F      S+ + +    + S++  +RE              L + +   G+          ++V I D ND  PVF+ ++Y+    E   +  H+  V A D D     R    +++S +    F I++ +G I      DRE +  Y +T+ A D G P    T  V + + D NDN P L++SS   V EN+   +  +  L+A D D+  N G   F L+     W  +GYF ++ +G +      DRE++  + + + I+D G      T V L + +LD NDN
Sbjct:  779 ATDTDAG-VNGAIVYSIASGDGSGL-FDISRASGD--VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA----DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDA-GIDGTV-FYMLFGESRSKGF------SVNEHTGEIIVSSQLDRERE----------ASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS-AKVTENQPAGM-TVLNLEAGDPDLPPNKGPYTFQLLGSDPAW--RGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTST-VTLHLSVLDQNDN 1277          

HSP 3 Score: 135.961 bits (341), Expect = 3.404e-32
Identity = 145/578 (25.09%), Postives = 240/578 (41.52%), Query Frame = 3
Query:  939 VLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV----YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDG-----MNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPP 2621
            V D NDN P F  +     +PE+ P+ +++  + A D D    A +SYRL    +       +    G II    LD E  + ++  V   DG      ++S T+ + VTD+ND TP     P       +  +GT V  +   D D+           P+G     ++      F  DP       +      +   R++     R+          SDG     + +T   T++V   D  +  P F     +  F E+      I  V A  +   +   ++Y +    +    F +D  SG ++  +  D E   HY + ++A+D G P  +  +K+ + + D NDN P+  SSS F  +   N     I  L A D D   NG++ + ++  + G  F + PN G I +  + DRE    Y + ++ +D G    Q   V + I + D NDNSP+F +      R++ A                  G  ++ +  +D D   N  I++SL  P  +P  F I    GEI VS+ L+R D   Y + V ASD      +D+ +++ ++ D  P
Sbjct:   16 VEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL----RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADA----------GPNGDLRFSLSGSASAGFSVDP----RRGVIHAARALQGPRDDLTLTVRV----------SDGGAPPRSAVT---TVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF-SSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPT-QHCTVKVLISVTDENDNSPRFTQIFSAHVREDAA-----------------VGFPVLRVSTLDADEGPNAAITFSLLDP-SLP--FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAP 537          

HSP 4 Score: 134.42 bits (337), Expect = 9.156e-32
Identity = 157/633 (24.80%), Postives = 275/633 (43.44%), Query Frame = 3
Query:  798 IDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLA-IRRLFLVQE-EGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTIC-----IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL-ESNDFKIDSVSGWINAMKIFDREE---------MDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PPGLN 2630
            +D ++G+  V V + LD E Q ++ +++EA + G     + + ++ +VLD NDN P F+ S +   +PENTP  T I  + A+D D    ++ ++D S+    I  +F V    G I     LD E    +   V+  D    + T  C     I VTD ND +P          ++E+   G  V  +++S  D+ E       +    ++   PF+ HP    T E  +    +R   DR  +    R                 ++   T++  ++++++DVNDN P F ++ Y I F E +   A + +V A+D D+G N ++ + +  ++ +F++   SG I++++     +         ++ Y   + A D G P L++   V I I   N N P+ +    +S      V  G  I  + A D D   NG+I + ++  +    FD+   G ++ + S   +    + + +   D G+         + I + + N  +P+F  PP  LS      P N P            G  L  + A D DA  NG I YS+    G    F+I R  G++ +   L       Y + V A+D G    ++   + I++ D+   PP LN
Sbjct:  281 VDPQSGE--VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKDSG--INGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATD--RGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPV--LRVSTLDADEGPNAAITFSL--LDPSLPFSIHPS---TGEITVSRRLNRE--DRSGYAVKVR----------------ASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRER-YSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAI-ISVTEENQYAPRFAHPPLELSL-----PENHPA-----------GSSLARVTATDTDAGVNGAIVYSIASGDGS-GLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLN 861          

HSP 5 Score: 117.087 bits (292), Expect = 2.057e-26
Identity = 95/383 (24.80%), Postives = 169/383 (44.13%), Query Frame = 3
Query: 1587 QLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHG-NPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGI 2723
            +LT T T++VL+ED NDN P F  +       E+  I + +  V ATD D G N+ I+Y +   +  F ++  +G I      DRE  + YV+ + A D G  P L+++  + + + D ND+ P+ +++   +   +   +   +  + A+D D   NG++RF L       F + P  G I+A  +    ++D   + +R+SD G   +      + ++  D  +  P+F   P   S R++                 + PG  +  + A    + + G +SY L     +   F +D   GE+ V + L       Y + V A D+G PP S    L +++ DI     N    + +S + W           +VVL+ +
Sbjct:    5 RLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDD-LTLTVRVSDGGAPPRSAVTT-VTVRFRDAGE-FPRFAPGPRSFSFRED-----------------QPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDI-----NDNAPEFSSSRFWAKVPENTPPRTIVVLTAV 360          

HSP 6 Score: 102.834 bits (255), Expect = 3.780e-22
Identity = 155/659 (23.52%), Postives = 265/659 (40.21%), Query Frame = 3
Query:  711 QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRL---DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAAST---TICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYE-PDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDR--EEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNT----TVKVNITIGDRNDNPPQLISSSDF--SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR---YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
             A+D D  + N +I Y +        R ++D+     F+ +  +L  ++ S  +V +EA + G     S+      V + N   P F      +++PEN P  +++ ++ A D D      + Y +   D S    I R       G ++L   LDYE ++++   V   DG + A T    + I VTD+ND  P ++ +     I EN  SGT V  +   D DS   +  +  Y   DG  +L  F  +    +       + +++ T++     F   +  H                      T  + V I  VN+  P F +  YN    E+  + A +  V ATD+D G +  + Y +     S  F ++  +G I      DRE      + + A++ G  S+       V VN+ I D ND  P + SS+ +   V E  +V    +G      D         F +   + G  F I  + G I      DRE    Y + +   D G+     T V + + + DVNDN       P+LL            T+  +++  +  G  ++ ++A D D   N K  Y+ ++    P    YF +    G +K ++ + R     + + V  +D G PPL+    L +++ D
Sbjct:  674 SAVDPD-RDVNGQIAYSVVGGNASR-RFDVDAGG---FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISR-----ASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSP--SNAVTMYSLDDGEADL--FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFH--------------------YSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAG--SIRGFDVDEVLVNVAITDAND--PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTV-VVVALEDVNDNG------PFLL------------TSSAKVTENQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSLSSS-GLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLD 1273          

HSP 7 Score: 101.679 bits (252), Expect = 7.945e-22
Identity = 174/753 (23.11%), Postives = 279/753 (37.05%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKA---DQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLP----QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRR----LFLVQEEGWIILNRGLDYEIDQ---------MHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRY--FEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLA 2609
            F +   SG I + ST+D E +  + E   KA     PT  CTV V            +    DENDN P F   F  H      +  D  +  P      +D D    N  I + L      F   +I   TG+  + V + L+ E +S + V + A +          ++   V D NDN P F Q+ Y I  PE +     + ++ A D D  A      +  V   +R       + ++ G I   R L Y              + FVV   D      ++  T+ I +   N   P          +   + +GT +  +   D D  +VNG+I  Y   G N  + F                +++ +  D     +            +  +        L+   T  + + + N   P F      +   EN+   + + +V ATD D G N  I Y I   +    F I   SG +  +   D E    Y +++ A D G  +      V+I++ D NDNPP L +S  + V      S   +  + A D D   N    + L       F +    G +  +   D E +  Y + +R + N  +    +   + ++I  VN+  P+F++  Y     N     +AP            G  + ++ A D DA  +G + Y L    G  R   F ++   GEI VS  L R    S  + VIA + G     D+  +L+N+A
Sbjct:  383 FRVNPNSGEIRSVSTLDRENVA-SYELTVKATDRGSPTQHCTVKV------------LISVTDENDNSPRFTQIFSAH------VREDAAVGFPVLRVSTLDAD-EGPNAAITFSLLDPSLPF---SIHPSTGE--ITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIV---VDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGA------NGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDR-DVNGQIA-YSVVGGNASRRFD-------VDAGGFLHLRASLAGDAGSIFS------------VTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVR-AFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREY-----NFVVSESAPV-----------GAPVGSVFATDRDAGIDGTVFYML---FGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVA 1060          

HSP 8 Score: 83.1889 bits (204), Expect = 3.630e-16
Identity = 65/247 (26.32%), Postives = 104/247 (42.11%), Query Frame = 3
Query: 1884 GNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLS--RSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            G P L  T  V + + D NDN P+   +++       +  +G  +  + A D D   N  I + L     G+F + P+ G I    S DRE  + Y + +   D G      +   L + + DVND++P+F+  PY+        P++AP            G  +  + A D DA  NG + +SL         F +D   G I  ++ L   R D+    + V  SD G PP S +  + +   D
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRF-GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRG-GDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYV-----AYAPSSAPA-----------GTAVFAVTARDADAGPNGDLRFSLSGSASA--GFSVDPRRGVIHAARALQGPRDDL---TLTVRVSDGGAPPRSAVTTVTVRFRD 225          

HSP 9 Score: 75.8702 bits (185), Expect = 6.108e-14
Identity = 150/622 (24.12%), Postives = 239/622 (38.42%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPV------FPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVV-----EVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQN-SRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYL---KAKDDDIAENGEIRF--DLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHL 2228
            F ++  SG +     +D E     N + C AD      T     E S ++I  T     D NDN P+      +P   +        L+ D       A+D D +  N   +Y L   E + F LN   KTG   +     LD E++  + + + A+N       S   +  ++   N+  P F Q  Y   + E+ P+   +  + A D D      + Y L    +    + F V E  G II++  LD E +      V         G       + + +TD ND  P          + E    GT V  +   D DS     +   +     N  + F      SI   + +  + S +  DRE         P+    ++  D         T T  + V +EDVNDN P    S   +   EN      +  + A D D   N    T+ +L S+      F + S SG +   +  DRE+   + + +   D G+P L +TV +++++ D+NDNP +   + D  V  N   S  P G++   + +D DI++    RF  DL       F   PN      +S  R  E R+ + +R SD GK +   T   +
Sbjct:  803 FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKT-----ECSGVSISVT-----DVNDNPPMLNASDYYPVIPENAPSGTTVLVMD-------AVDAD-SPSNAVTMYSLDDGEADLFVLN--QKTG--VLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESR---SKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPP-GWRTFSFLIQSGNAGRAF------SINAHTGLIVVASPL--DRESV-------PLYNLTVVAVD---MGEPPATGTTVVVVALEDVNDNGPFLLTSSAKV--TENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE---ARDVRVHVNYFGSPFPGGFIGDVRPRDPDISD----RFNCDLTSGPFNVFSFQPN--TCRLISQPRSAEGRFELSVRGSD-GKHSPATTTARV 1366          
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 214.157 bits (544), Expect = 4.606e-56
Identity = 209/764 (27.36%), Postives = 335/764 (43.85%), Query Frame = 3
Query:  426 ENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE--DENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT----------ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVF------DGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQ 2636
            +   F L  +SG ++ +ST+D E I            P+ T  V   D  S    IT        D NDN P F    F  +   ++ ++        L   +++     N  I   L     + F   IDS TG  FV+    LD E+ + + + + A + G   K +   +K  +++ NDN P F     V +IPE+  ++T++ K+ A D D T          A  S+++D             Q  G I + + LD E    +  VV         + VY  +T   I+V D+ND  P  +      ++ ENL  G  V ++  +DRD  E N K+  YE   + +   F  +P   +        + ++   DRE+    +  + +R   +    G  + +A   IT T    I D+NDN P F++S Y +   EN    ++I +VLA+D D G N R+TY I+     N F+IDS +G I  + + DRE +  Y +TI A+D G P   +T  V IT+ D NDN P + +S++ S   +  VS+G  +  + A D D   N ++ + ++      F I   NG +  K   +RE    Y + +R SD G      +   L + + DVNDN P F    Y+ S R+N A  T+                 ++T+ A D D   N  + YS+ I     + F+I+   G I  +  L   +   Y + V A+D+     +++ + +INL DI P    Q
Sbjct:  833 QGNSFQLDPRSGILSVRSTLDRETI------------PSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVH-----STVLQVKVEDKDEGSNGAITLSLSGEGSDNF--TIDS-TG--FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKID-------------QSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT---IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGE-NAKV-TYEL-SVGDTSKFEVNPATGL--------VTTKRPLDRED----QASYSLRVTAM--DHGKPSQSAVAAITLT----INDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP-IFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSP-MMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTS-----------------VLTVAADDSDVGANAVLRYSI-ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQ 1517          

HSP 2 Score: 197.208 bits (500), Expect = 7.644e-51
Identity = 201/759 (26.48%), Postives = 335/759 (44.14%), Query Frame = 3
Query:  405 LRYKFSKENK--YFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE--DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQE-EGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDRE-EFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQT-LSRSDIGSYRIHVIASDNGVPPLS---DIKVLLINLADIPP 2621
            LRY F+  N    F+L   +G +T   ++D E+            + +    ++V D  S     T+  L    D NDN PVF       R  E N     ++    A D D +     +   +  N++  F   ID  TG   + + K+ D E+++ + + ++A + G+  K     +   + D ND+ P F+ S Y   IPE+T + + +  + A D D     RL YRL   +   ++  F +    G I ++  LD E    +   VE  DG   + ++   + I + DIND +P I   P    + E+   G  +GQ+  +D D    NG +     D   N   F      SI   + +  +K+++ ++++ +++            +   DG   + + LT+   + V+++DVNDN P F +S+Y     EN      +  V ATD D G N +I+Y IL  N+   F +D  +G I      DRE +  Y +TI A D           VNI+I D NDN P     S F++ E+       +G L A D DI  NG + + ++  ++G  F + P +G +  + + DRE    Y + ++ SD G   +Q     + + +LDVNDN+P+F +  +       +G         + S++      ++ +K  D D   NG I+ SL         F ID  G    +S+T L      +Y++ V A D G P  S    +K+ +IN+ D  P
Sbjct:  306 LRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQ------------RSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE-NTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVF--TIDGSTG--IISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL---ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVFRVSESSSPGHQIGQVAATDADDSS-NGDVRYALSD---NTDVF------SINTSTGLITLKTQLDYEKKTQYM----------VTVTAKDGGTPSRSSLTV---VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGT-RVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSP-QQSITASIHVSVLDVNDNAPRFEKSLF-------SGEIRE-----DASVH----STVLQVKVEDKDEGSNGAITLSLSGEGS--DNFTIDSTG--FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVP 995          

HSP 3 Score: 194.897 bits (494), Expect = 4.117e-50
Identity = 209/753 (27.76%), Postives = 327/753 (43.43%), Query Frame = 3
Query:  417 FSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFK-FKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKN-LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTT--ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKIC----------CYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            FS ENK F +  K+G I T + +D E            D  TM  +       +F+ +IT     +D NDN P F    +KT    ++ +     +    A+D DV   N ++ Y L   +  +F   +DS+     V+  K   D E+++++ V L A + G   +  Q  ++ E+LD NDN P F+ + Y  ++ E+  +   +  + A D D       R   +         L    G + ++R LD+E    +   + V D G    + T  + I V DIND  P    +  +  +KEN  +GT   Q+  +DRDS   NG +            +  DG   +      PD         +E K+R     +     +R  P++            + AQ+TI       IEDVND+ PVF+ S Y+    E+  I + +  V ATD D G   R+ Y ++  N    F ID+ SG I      DRE    Y + ++A+D G+ S +++ +V I + D NDN P       F V E+   S G  IG + A D D + NG++R+ L   +   F I T  G I  K   D EK+ +Y + +   D G  ++    V + + + DVNDN PQF +  Y  +  +N+A                  G  +  + A D D+  NGKISYS+ +       F +DR  GEI     L R  I SY + + A D  +        + I++AD
Sbjct:  109 FSGENK-FMMNSKTGEIRTVTPLDHE----------TKDSYTMRISAFDGKHTTFVPLIT----VDDVNDNAPFFALSVYKTGVYEDVAV--GSIVRQLTAVDLDV-GINARLSYSLVSGDTSYF--TVDSQG----VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDS-STNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPD---------YENKTRYDLTVQA---RDRGVPVK-----------YDTAQVTI------FIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESS--SPGHQIGQVAATDADDSSNGDVRYAL-SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTV-VKVMVDDVNDNPPQFAKSLYTCTVGENLAA-----------------GVAVCYVTATDADSGANGKISYSI-LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIAD 782          

HSP 4 Score: 189.504 bits (480), Expect = 2.129e-48
Identity = 173/620 (27.90%), Postives = 276/620 (44.52%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF--SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMW-PHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPY 2285
            F +   +G IT    +D E +   N      D       V  W   +F+AI        DENDN P+F     ++   E   +  R + +  A D D    N ++ Y + + +   F +N         + V K ++ E+   +T+ + A + G     S   +   V D NDN P FN  +Y+ ++ EN+  ST++  + A D D  A    R         +R  +    G I+    LD+E    +   V   D  Y A T + I+V ++ND TP         +++EN  + T V ++  SDRDS    G +  Y   G  +   F      SI Q S I            + L+ E +      + +   G    N  L+    +++ I D NDN P F  S Y+   +EN+   +   ++ ATD DEG N+RITY++  ++ F I + SG I   +  DRE    Y + I+A+DHG P   +++ + +T+ D ND+ P LI+SS    SV EN+      +  L A D D   N E+ F L+   HK  F +    G I  KV  DRE++  Y +R+ ++D G  +   +   + I ++D +DN P+F    Y
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASYNLTISAKD-----SGVPPWVSTAFVAIT-----VADENDNSPIFASNETSYGIDEGVSIGSR-VAVVTATDRD-EGSNAQVFYSIVRGDTSAFAIN----AMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF---GSLS-YSIVGGKDSDKF------SIDQRSGIISTA--------DVLDRELVSLYAIQVRVTDAG----NPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRIL-ASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS-LSSVADVIIDVIDEDDNCPRFQPTEY 1829          

HSP 5 Score: 183.341 bits (464), Expect = 1.555e-46
Identity = 182/627 (29.03%), Postives = 276/627 (44.02%), Query Frame = 3
Query:  762 LHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTIC--IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            +  N++  F   IDS TG       +  D ES+S + + + A +   +  K + V+  +V D NDN P F  ++YV  I ENTP +  +  + A D D    A ++Y L +       +  +  + G I     LD+E    +   +  FDG +   TT    I V D+ND  P   ++  K  + E++  G+ V Q+   D D V +N ++      G           D S     +   I+++  FDRE   +       + AL     G  + + Q T+     + I DVNDNRPVF+ + Y     E+  I A +  V A+DKD G N+ + Y     N    F +D+V+G +   +  D E+   Y + +   D G+P L  T  + I + D NDNPP + S S +      N   G    + A D D + NG + F ++  +  G F I    G I    S D E + RY + ++  D G   K +T   + I I DVND+SP F              P+N      E ++    G  +VT+ A DLD+   G++ Y L I   V   F ID + G I+VS  L R    SY + V A D G    S    + I L DI
Sbjct:    4 MDGNDQGMF--TIDSSTGS-ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGEN----KFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKH---TTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD-VGINARLSYSLVSG-----------DTSYFTVDSQGVIRTKGAFDRETKAS------YQVALRAQDGGSPSRSGQATV----EIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-VFSPSAYQSRVKENTPAGT--QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDT-AQVTIFIEDVNDHSPVF-------------SPSNYSKQIPESTVI---GSTVVTVTATDLDSGPRGRLEYRL-ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDI 576          

HSP 6 Score: 181.8 bits (460), Expect = 4.006e-46
Identity = 180/683 (26.35%), Postives = 302/683 (44.22%), Query Frame = 3
Query:  621 NDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKS---RIT----FDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF-SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH-KGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            NDNVP F    +     E   +    + L  A D+D T     I+     N    F+  ID  +G   + V K LD E+ +N+T+++ A   G + +         VLD NDN P FN  +Y  ++ EN P+   + K+ A D D  + A+++Y L     +     F V    G +   R LD E    +   V   D      +A   I + + D+ND +P    +   LT+ EN  +G+ + ++  SD D+   NG++      G                   N F I S   RIT     DRE   +          L I +   G        T  +++ + D NDN P+F  +  +    E   I + +  V ATD+DEG N+++ Y I+  +++ F I++++G +   K  +RE +  Y +TI+A D G+P + +  ++ + + D NDNPP   S S   SV EN   S   +  + A D D+  N  +R+ ++  + +  F I + +G I      D E++ +Y + +  +D    +K     ++ I+++++ND +P F +  Y  S R+N         +P   S+ ++             D D  G +SYS+ +       F ID+  G I  +  L R  +  Y I V  +D G PPLS++  + I + D
Sbjct:  991 NDNVPSFVSPAQVTSIPEDVAINTHVVKL-NATDSDGTPLTFDIV---EGNAGSSFK--IDQSSG--LISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL----SVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDA-GANGRVTYSIISG----------------NHGNAFRIDSTTGRITVVGVVDREALASYN--------LTISAKDSGV--PPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVL-TVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPAFTQQNYTASVREN---------SPTSTSVVKVSAS----------DRDSFGSLSYSI-VGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILD 1609          

HSP 7 Score: 174.866 bits (442), Expect = 6.590e-44
Identity = 187/694 (26.95%), Postives = 295/694 (42.51%), Query Frame = 3
Query:  600 VFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRL---DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPH-KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP---PLSDIKVLLINLADIPP 2621
            V   +DENDN P FP   + F     +        ++ +  A D D +  N  I Y L   E +F    ++SKTG+  +  +  LD E++ ++T+ + A++     K +  V    V D NDN PFF  S Y   + E+  + + + ++ A+D D    ARLSY L   D S        F V  +G I      D E    +   +   DG     +   T+ I++ D+ND  P         ++ E++  G  +  +  SD+D+   N     Y     N    FT      +   S   + + R ++                AL +     G+    LT T  L + + D+NDN PVF+ S Y     EN        QV ATD+D   N  + + I++ ND   F ID  +G I+  K  D E    Y +T++A+D G P    T +V I I D ND+ P + S S++S +   +  +G  +  + A D D    G + + L+  + KG F+I  N G+I      DRE    Y +++   D      + +   + I + D+NDNSP F + PY+                  +S    PG  +  + A D D   NG + Y+L     V   F I+   G I +   L       Y + V A D G P    L+ +KV++ ++ D PP
Sbjct:   57 VIDVKDENDNAPEFPLNSYVFNIRENTPA-----AQVAIVTATDRD-SGTNAAITYSLFSGENKFM---MNSKTGE--IRTVTPLDHETKDSYTMRISAFD----GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-------YFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDN--GNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSY----------------ALGLSVTDRGS--PPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSP-VFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIF-QGPYVF----------------RVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV---FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPP 683          

HSP 8 Score: 166.007 bits (419), Expect = 2.991e-41
Identity = 192/701 (27.39%), Postives = 295/701 (42.08%), Query Frame = 3
Query:  615 DENDNVPVF-PFKF-KTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTA--RLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVE--------VNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIG--DRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKG-YFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD---IKVLLINLADIPPGLNNQK 2639
            D NDN PVF P  + K+  E   NL   + +    A D D  E N K+ YEL   +   F +N    TG   V   + LD E Q+++++ + A + G   + +   I   + D NDN P F+QS Y +T+ ENT   +NI ++ A DPD  A  R++Y + +       R+      G I +   +D E    +   +   D GV  + ++  + I V D ND +P    N +   I E +  G+ V  +  +DRD           V G    +  + MN +                       +T  +E  +N E + P  T  +  SD     +  +T    L+V++ DVNDN PVF    Y     EN+     +  V A D D G N+ + Y I+  ND   FKI+S SG I      D EE   Y + + A D        T K N+TI   + ND  P     +   SV EN   S   +  + A D D    G + + ++       F I   +G I      DRE    Y +++R++D G          + IKILD NDNSP+F                ++ +    +     P      + A D D   N +I+Y+L         F I    G I ++Q L R +  +Y + + A D+G PP +    I+V +I++ D  P +N+  
Sbjct: 1091 DVNDNAPVFNPGSYAKSLHE---NLPIGQTVAKVTATDRDEGE-NAKVTYELSVGDTSKFEVN--PATG--LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRID--STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGV-----------------------LTVKKE--INRETV-PTYTLTIRASD---RGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVV-KVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNP-PLSNLTWVTIKILDENDNSPKF----------------DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLS----RNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSS 1723          

HSP 9 Score: 128.642 bits (322), Expect = 9.262e-30
Identity = 171/752 (22.74%), Postives = 300/752 (39.89%), Query Frame = 3
Query:  402 QLRYKFS-KENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDEN--SFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL---ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQL-ISSSDFSVEENRNVSLGPIGY---LKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            ++ Y+ S  +   F +   +G +TTK  +D E            DQ + +  V   D    S  A+        D NDN P F     T   +E N      I    A D D     R     +  N    FR  IDS TG+  + V+  +D E+ +++ + + A + G+    S   +   V D NDN P F  +     I E   + + +  + A D D+   A++ Y +   V+       +    G + + + ++ E    +   +   D    +  +   + + V D+ND  P  +      +++EN    T V  +   D D V  N  +  Y     N+ + F  +    +   +   + + +  +  E               +  +D   T    +TI       + ++ND  P FT+  Y     EN+     + +V A+D+D      ++Y I+   +S+ F ID  SG I+   + DRE +  Y + ++  D GNP L+    V I I D NDN P+   SS   S+ EN      P  +   L A D D   N  I ++L   +  +     +G I      DRE +  Y + ++  D+G    Q + + + + ++D+ND+ P       L++  ++ G       P E  +  I         A D D   N ++++SL +       F +D   G+I     L R     Y + +  +D G P LS +  ++I++ D
Sbjct: 1133 KVTYELSVGDTSKFEVNPATGLVTTKRPLDRE------------DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTE-NTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFR--IDSTTGR--ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI---VRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSD-VGANA-VLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLE---------------VTATDSKYTAKTNVTI------RVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENS----APSSFSFKLAATDADEGTNARITYNLSR-NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTP-PQASSITIRVTVIDINDHRP-------LINSSSLRGSVR-ENQPKETHVMRI--------LASDADTGLNAELTFSL-LSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 10 Score: 67.781 bits (164), Expect = 2.826e-11
Identity = 84/324 (25.93%), Postives = 146/324 (45.06%), Query Frame = 3
Query:  789 RLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GV--YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPD---PSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKD 1736
            + +ID ++G   +     LD E  S + + +   + G     +   +  ++LD NDN P F+ S+Y  +I EN+  S+  +K+ A D D+   AR++Y L  +    I         G I L + LD E    +   ++  D G    A+S TI + V DIND  P I+ +  + +++EN    T V +I  SD D+             G+N    F+   +      T ++   +I +++  DRE+    + ++ +R  + +   G    N  L+    + + + D +DN P F  + YN+   E+    A I QV A D D
Sbjct: 1559 KFSIDQRSG--IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIG-----ASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT-------------GLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQ----QAVYTLR--IGVADKG----NPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Match: EDO39230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP5])

HSP 1 Score: 193.356 bits (490), Expect = 1.977e-49
Identity = 188/703 (26.74%), Postives = 315/703 (44.81%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEI-NLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRIT---FDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDE---GQNSRITYDILES--NDFKIDSVSGWINAMKIFDREEM-DHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDLMW---PHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQ-ETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPG--QILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDG-----GEIKVSQTLSRSDIGSYRIHVIASD-NGVPPLSDIKVLLINLAD-----IPP 2621
            D ND  P F     T     + N     K+   +AID+D +E +R++ YE+  N        ID+ TG   +     LD E    + V + A +   KE     ++   V+D ND  P F   +Y I++PE++P+ T++  I A D D  + A+++Y +          +     +G +++N  LD+E    +   V   DG ++ +  + + + D+ND  P       +  I+EN   G  V  +  SD DS  ++  +   +  G +  Q          +   N++    R      DREE        P++   +I +DG  T  A++ +  T      DVNDN P F  S Y  +  EN      +  + A D D+   G N++++Y++ +S  + F ID +SG I     FDRE+  + + V +KA D GNP L+ +V   I + D ND+ P+        SV EN      P GY    + A D+D+  N E  F ++    PH  Y D   NGT+      D EK+  Y + L ++D G    Q +   ++ I+ILD NDN+P+F+   Y           NA       S+ E  G  Q ++T+ A+D D+  NG  ++++         F I+ +      G I+    L +    S+ + V A+D  G+    ++++ +I++ D     +PP
Sbjct: 2562 DVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVTYEMKDNPN----FQIDASTG--MITTKTTLDREVTPKYDVEVTAKDGVNKESA---ILYITVVDQNDQPPVFAPKSYAISVPEDSPIGTSVLDIYATDADVGENAKITYFISKGDPEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATDGKFSDTAVVTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASDIDSPTISFSL---DDRGKDYFQITPIR----ASGPGNVWVGDIRTGSKQLDREE-------SPVKVFTVIANDGKHTAQAEIRVNLT------DVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSDANDHKPKFTEKFYRGSVAEN-----APPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYIDPF-NGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDANDNAPEFIPKIY-----------NA-------SVLEDVGARQPVLTVTAVDKDSGPNGNFTFAIDPRSDPDDAFTIEPNPNNASIGIIRTRVPLDQEKTPSFHLKVTATDAGGLQGEGEVRINVIDVNDNGPWFVPP 3211          

HSP 2 Score: 167.162 bits (422), Expect = 1.942e-41
Identity = 184/652 (28.22%), Postives = 287/652 (44.02%), Query Frame = 3
Query:  423 KENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLP----QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEG----WI----ILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKI-CCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSL--NTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRF--DLMWPHKGYFDITPN------GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSR 2297
            K+N  F +   +G ITTK+T+D        E   K D   +T    V  E++ L I        D+ND  PVF       +   I++  D  I        A D DV E N KI Y + + + E  + +I +   K  +VV   LD E++S++T+ + A +    +     V+   + D ND  P F+   Y   I ENT     +  + A D D +  +S+ LD+  K   + +  ++  G    W+      ++ LD E   + +F V   DG + A   I + +TD+ND  P    +P    ++EN  SGT V  I+  D D     G     YE   + +     F  DP     S +  IK+++TFDRE+  N  ++    T            N +L+ +    + + D ND++P FTE  Y     EN      + +V ATD+D G N+   + +++ ND   F ID  +G +    I D E+   Y +T+   D G P L  + T  V I I D NDN P+ I    + SV E+      P+  + A D D   NG   F  D        F I PN      G I  +V  D+EK   + +++  +D G    +     + I ++DVNDN P F+ PP+ + +
Sbjct: 2613 KDNPNFQIDASTGMITTKTTLD-------REVTPKYDV-EVTAKDGVNKESAILYITVV-----DQNDQPPVF-----APKSYAISVPEDSPIGTSVLDIYATDADVGE-NAKITYFISKGDPEG-KFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATDGKFSDTA---VVTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASDID-SPTISFSLDDRGKDYFQ-ITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTVIANDGKHTAQAEIRVNLTDVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYE---LTDSAGDKFSIDPL----SGL--IKTKVTFDREQTPNKFKVRVKAT---------DAGNPRLSASVDGIIHVSDANDHKPKFTEKFYRGSVAENAPPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYIDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDANDNAPEFIPKIYNASVLEDVGARQ-PVLTVTAVDKDSGPNGNFTFAIDPRSDPDDAFTIEPNPNNASIGIIRTRVPLDQEKTPSFHLKVTATDAGGLQGEG---EVRINVIDVNDNGPWFV-PPFFVGQ 3216          

HSP 3 Score: 137.502 bits (345), Expect = 1.943e-32
Identity = 199/764 (26.05%), Postives = 315/764 (41.23%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFL-FEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLN-------------IDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYR-LDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMH--LFVVEVFDGVYAASTTICIKVTDINDETPN--IHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKI--DSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-----NGTIY------AKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLD---ADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDI-GSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            FS+  ++G + + +++D E   D+  A  KA+  +     +  DE+  L     + +  ED NDN P F    K       +      I   QA D D +  N KI Y L  +    FRL+             +  +TGK  ++ +   D ES       +     G   K ++   + E+L  N+  P F+Q  Y  +I EN    + + +I A      A +SY  +D + +  I  LF VQ +G+II     DYE    +   F  +    +  ++  + I + D+ND +P   + IN     + EN  + T V  +K  D D  E + ++             +    +P+   +++   I ++ T DRE       + P     +   DG    +A L IT      + D ND  PVF    Y I   E++ I   +  + ATD D G+N++ITY I + +    F I    V G +      D E    Y + + A D      + T  V +TI D ND PP + SS  +      N   G  G +     DI ++  I F L    K YF ITP      G ++           DRE+       + I+++GK   Q     + + + DVNDN+P+F   PY+   +      N P+           G  ++ I+A+D D   A  N K+SY L    G    F ID   G IK   T  R      +++ V A+D G P LS     +I+++D
Sbjct: 2295 FSIEPRTGVVRSLTSLDREN-KDSYNAIIKAEDGS-----SKQDESERLLWYCYLTINVEDVNDNRPYF-LAAKYFGSVFSSAPNGSNILTVQATDAD-SGSNAKIKYALLDSAGGLFRLDSSGILRTNTNPARLQLETGKKLLLEVSAKDVES-------IAGTQPG---KPTKYTTQIEILVSNEEPPKFSQQVYTASINENMETGSTVTRITATS-STGAEISYENVDTNPRAKI--LFRVQPDGYIITGDRPDYERGTTYNMQFAAKDKKTLLYSTVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVT------------YEMKDNPNFQIDASTGMITTKTTLDRE-------VTPKYDVEVTAKDGVNKESAILYIT------VVDQNDQPPVFAPKSYAISVPEDSPIGTSVLDIYATDADVGENAKITYFISKGDPEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATDG---KFSDTAVVTVTIQDVNDLPP-VFSSPLYESRIQENTGPG-AGVVMVTASDI-DSPTISFSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTV-IANDGKHTAQ---AEIRVNLTDVNDNAPRFPASPYIGYVEE-----NKPS-----------GTSVMYIQAVDDDDPLAGGNAKLSYELTDSAG--DKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSD 2984          

HSP 4 Score: 132.494 bits (332), Expect = 8.260e-31
Identity = 160/588 (27.21%), Postives = 252/588 (42.86%), Query Frame = 3
Query:  897 GMKEKK----SQIVIKFEVLDFNDNEPFFNQS--TYVITIPENTPLSTNIYKIEAIDPDKTA---RLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCY----EPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSV--SG----WIN----AMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDD---IAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKE-DRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPL 2576
              K+KK    S + +   ++D ND  P F  +  T    + EN P  T +  ++AID D +    R++Y + ++    I         G I     LD E+   +   V   DGV   S  + I V D ND+ P        +++ E+   GT V  I  +D D  E N KI  +    +P+G  ++       +  +  + + FE KS  T +                 +  +DG  ++ A +T+T      I+DVND  PVF+  +Y     EN    A +  V A+D D    S  + D    + F+I  +  SG    W+       K  DREE    V T+ A D G  +    ++VN+T  D NDN P+  +S      E    S   + Y++A DDD      N ++ ++L       F I P +G I  KV+FDRE+  +++ +R++ +D G   +    V   I + D ND+ P+F E  Y   R ++A   NAP           PG  ++ + A D D   N +  + + +    P  F ID   G + VS  L       Y I +  +D G+PPL
Sbjct: 2542 AAKDKKTLLYSTVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVTYEMKDNPNFQID-----ASTGMITTKTTLDREVTPKYDVEVTAKDGVNKESAILYITVVDQNDQPPVFAPKSYAISVPEDSPIGTSVLDIYATDADVGE-NAKITYFISKGDPEGKFSIVTSPVKGELVVNGKLD-FETKSSYTLE-----------------VTATDGKFSDTAVVTVT------IQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASDIDSPTIS-FSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTVIAND-GKHTAQAEIRVNLT--DVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKATDAGNP-RLSASVDGIIHVSDANDHKPKFTEKFY---RGSVA--ENAP-----------PGYSVLRVTATDEDVGPNAEFEFVV-VQGNDPHAFYIDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPL 3077          

HSP 5 Score: 116.701 bits (291), Expect = 4.380e-26
Identity = 176/683 (25.77%), Postives = 293/683 (42.90%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEF-FRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGM--KEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRL-----DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPD--PSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQD-HGNP-SLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFME-PPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGS-YRIHVIASDNGVPPL-SDIKVLLI 2600
            D NDN P F F  ++ +   I+    +   L +A+D D      ++ Y +           NI+ KTG  F    + +     S++ +I+ A +      +K  +  +  +VLD     P F Q TY   + E   +   +  + A+     A L Y       DN+        F V   G I + + LD E    +   + V  G +   TT+ + +TDIND+ P+      + +IKE L   T +    I+       NGKI      G+        HPD       +S   +I +++T D E        H   T L I ++ +G+   +L+    + + + D NDN PVF  + Y             + QV ATD D GQN +ITY I++ N+   F I+   G I   K       D + + ++A+D + +P S + TV++N+ +    D PP  ++S     V+E    +    G +KA     A +  + + L+  ++ G F I P+ G++ A    D E+  RY +++   D      +   V L I ++++NDN P F++     + R  I   T +PT   E       G+++  + A D D D+      +  +P  V   F+ID  G    V+      D+   Y  +V A DNG PP  +D+KV L+
Sbjct: 1103 DVNDNGPRFAFH-ESSKTVVIDSFSAKDTQLARALDADSGSLG-EVTYGIDGGRSTSNLPFNINVKTGMIFAT--REILYTQGSSYIIIVVATDGATDGSQKIQKFTVNVQVLD-TPRPPSFPQKTYSAPVTETAGVGDTVTTVRAVYSKPNAFLKYTFVSGNEDNT--------FCVNGFGIISVAKSLDREKVAGYTLGMRVTLGQHVDDTTVYVNLTDINDDAPHFTSAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGV--------HPDWDKYFNIDSATGKITTKMTLDYE-------THKSHT-LFIRAEDNGSPK-RLSGIAQVDIDVIDRNDNSPVFAAAFYRAKISLGAVKGTSVLQVHATDLDSGQNGQITYSIIQGNEEEAFTINE-QGVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVYL---PDGPPMFVVSPVTVYVKEGVPANHRVAG-VKA-----ATSEALTYTLLSGNEAGMFRINPSTGSLDATRELDYEERRRYELKIEARDT---RDRSAMVELIIIVVNINDNKPTFVDIVDGQIDRKAIG--TCSPTDIAE-------GEVITRLGAFDRDGDE-----ITFIVPDDVKDLFKIDSRG---VVTAKKPIEDLPKIYPFNVKALDNGEPPQETDVKVRLV 1725          

HSP 6 Score: 116.701 bits (291), Expect = 4.888e-26
Identity = 131/494 (26.52%), Postives = 209/494 (42.31%), Query Frame = 3
Query: 1062 ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHL-----FVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIF------EIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN-DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEEN--RNVSLGPIGYLKAKDDDIAENGEIRFDLM-WPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISD-NGKENKQET---YVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDG 2483
            ARL Y++   V   +   F+   +G I+LN  LD+E DQ           ++ DG+  ++  + I V + ND  P        + I E+   G  V ++   D D +      C   P  +      T+  +PS  Q    +      +I   +  D E+    +R H     L + +   G  + Q  + F ++V + +VNDNRP F +S Y     E       +  V+A D D      +TY        F +D  +G I      D  + + Y + + A+D G   L +TV V   + D N+N PQ  +    S+ EN  R+     I  L A D D  +NG+I + +     +  F I P  G + +  S DRE +D Y   ++  D + K+++ E    Y +L I + DVNDN P F+   Y  S       ++AP            G  ++T++A D D+  N KI Y+L    G    F +D  G
Sbjct: 1968 ARLDYKI---VSGNVGDKFIAMGDGRILLNSLLDFERDQTQYNLKVKATEQIPDGL-DSTVDVKIDVINANDHFPYFDQQLYSVQIPESTAVGVLVQEVTAKDCDCLSS----CTCSPGFL------TYSIEPSKEQGGKFYIDPATGKISVSVALDYED----QRYH----LLKVYATDKGKKSFQ-GLCF-VNVTLTNVNDNRPTFLKSAYEFRVAEGAATGESLAIVVAVDAD---GDAVTYSKAGGALQFSVDQSTGVITLNSALDPNK-NQYTLQVMAKDSGG--LTSTVSVTFNVADANNNVPQFTNCGTVSIRENDPRDTK---ITQLTATDADRGQNGQITYSIEDASSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVF-----SSAPN-----------GSNILTVQATDADSGSNAKIKYALLDSAG--GLFRLDSSG 2410          

HSP 7 Score: 116.316 bits (290), Expect = 5.786e-26
Identity = 175/699 (25.04%), Postives = 279/699 (39.91%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFP-FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKF-----EVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG---LDYEIDQMHLFVVEVFDGVYAAST--------TICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESI--YNIFFMENNHIHAHIHQVLATDKDEGQ-NSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDL-MWPHKGYFDITPN---GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSL 2435
            FS+ + +G IT  S +D              ++   T  V   D     + ++  F   D N+NVP F      + RE   N  RD KI    A D D   +N +I Y +     +    +I+ +TG   V  L +LD E++ ++  I++A +   K+ +S+ ++ +      V D NDN P+F  + Y  ++  + P  +NI  ++A D D    A++ Y L +S       LF +   G +  N     L  E  +  L  V   D    A T        T  I++   N+E P         +I EN+ +G+ V +I  +     E++     YE    N      F       Q         R  ++R    N +     +  LL               T  + + I DVND  P F  +I   N   +EN      +  + A D D  + + R+TY++ ++ +F+ID+ +G I      DRE    Y V + A+D  N     +  + IT+ D+ND PP     S   SV E+      PIG     + A D D+ EN +I + +     +G F I  +   G +      D E +  Y + +  +D     K      + + I DVND  P F  P Y                  E  I E   PG  +V + A D+D+     IS+SL
Sbjct: 2194 FSVDQSTGVITLNSALD-------------PNKNQYTLQVMAKDSGGLTSTVSVTFNVADANNNVPQFTNCGTVSIRE---NDPRDTKITQLTATDAD-RGQNGQITYSIEDASSQTL-FSIEPRTG--VVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPNGSNILTVQATDADSGSNAKIKYALLDSAG----GLFRLDSSGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTTQIEILVSNEEPPKFSQQVYTASINENMETGSTVTRITATSSTGAEIS-----YENVDTNPRAKILFR-----VQPDGYIITGDRPDYERGTTYNMQFAAKDKKTLLYS-------------TVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVTYEMKDNPNFQIDASTGMITTKTTLDREVTPKYDVEVTAKDGVN---KESAILYITVVDQNDQPPVFAPKSYAISVPEDS-----PIGTSVLDIYATDADVGENAKITYFISKGDPEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATD----GKFSDTAVVTVTIQDVNDLPPVFSSPLY------------------ESRIQENTGPGAGVVMVTASDIDSP---TISFSL 2812          

HSP 8 Score: 115.546 bits (288), Expect = 1.156e-25
Identity = 117/485 (24.12%), Postives = 212/485 (43.71%), Query Frame = 3
Query:  915 SQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD-------KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTIC---IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPS-----LNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDR---EKEDRYCMRLRISD----NGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS 2294
            S + +K +V++ ND+ P+F+Q  Y + IPE+T +   + ++ A D D           L+Y ++ S K    + ++    G I ++  LDYE  + HL  V   D    +   +C   + +T++ND  P    +  +  + E   +G  +  +      +V+ +G    Y   G   LQ F      S+ Q + +  + S +  ++ ++          T  ++  D  G     LT T +++  + D N+N P FT +   +   EN+     I Q+ ATD D GQN +ITY I +++    F I+  +G + ++   DRE  D Y   IKA+D  +       L     + I + D NDN P  +++  F    +   +   I  ++A D D   N +I++ L+    G F +  +G +    +  R   E   +  + +   D     G +  + T     I+IL  N+  P+F +  Y  S
Sbjct: 2022 STVDVKIDVINANDHFPYFDQQLYSVQIPESTAVGVLVQEVTAKDCDCLSSCTCSPGFLTYSIEPS-KEQGGKFYIDPATGKISVSVALDYEDQRYHLLKVYATDKGKKSFQGLCFVNVTLTNVNDNRPTFLKSAYEFRVAEGAATGESLAIVV-----AVDADGDAVTYSKAG-GALQ-F------SVDQSTGVITLNSALDPNKNQY----------TLQVMAKDSGG-----LTSTVSVTFNVADANNNVPQFT-NCGTVSIRENDPRDTKITQLTATDADRGQNGQITYSIEDASSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPNGSNILTVQATDADSGSNAKIKYALLDSAGGLFRLDSSGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTTQIEILVSNEEPPKFSQQVYTAS 2476          

HSP 9 Score: 110.923 bits (276), Expect = 2.489e-24
Identity = 154/656 (23.48%), Postives = 277/656 (42.23%), Query Frame = 3
Query:  711 QAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKS-QIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQ-EEGWIILNRGLDYEIDQMHLFVVEV--FDGVYAASTTICIKVT--DINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGW--INAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISS-SDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLM------WPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLIN--LADIPP 2621
            QA D D+   N ++ YEL  Q   E F LN +++      +            + +++ A +   +   S Q+ +   V   +++   F++S+Y   +PE++  +T ++  +A     ++ ++Y L    K     +F ++ + G + L + LD+E        V      G    ++ +  KVT  D+ND  P    + S  T+  +  S       +  D DS  + G++  Y  DG  +     F+             +K+ + F   E L  +    I   +++ +DG  T+ +Q    FT++V + D     P F +  Y+    E   +   +  V A       N+ + Y  +  N+     V+G+  I+  K  DRE++  Y + ++    G    +TTV VN+T  D ND+ P   S+    S++E        +  + A D D   NG+I + ++      W    YF+I +  G I  K++ D E    + + +R  DNG   +      + I ++D NDNSP F    Y                  ++S+  + G  ++ + A DLD+ +NG+I+YS+ I       F I+   G I V ++L+      + + V A D    P S    + IN  L D PP
Sbjct:  924 QAEDMDIG-TNAQVRYELLRQENSERFILNDNNQLSTASTLT-------PNVRYQLLIRASDSATRNPSSAQVPVYVSVYSPSESPIVFDKSSYNQNLPEDSSANTLVFTAKATRSGSSSGITYELVGGYKQIGEAMFSIKPDTGQVYLIKKLDFETKSYFPIAVRAKYSGGAIELASEVVAKVTIVDVNDNGPRFAFHESSKTVVIDSFSAKDTQLARALDADSGSL-GEVT-YGIDGGRSTSNLPFN-----------INVKTGMIFATREILYTQGSSYI--IIVVATDG-ATDGSQKIQKFTVNVQVLD-TPRPPSFPQKTYSAPVTETAGVGDTVTTVRAVYSKP--NAFLKYTFVSGNEDNTFCVNGFGIISVAKSLDREKVAGYTLGMRVT-LGQHVDDTTVYVNLT--DINDDAPHFTSAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGVHPDWDK--YFNIDSATGKITTKMTLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAFYRA----------------KISLGAVKGTSVLQVHATDLDSGQNGQITYSI-IQGNEEEAFTINEQ-GVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVYLPDGPP 1529          

HSP 10 Score: 103.605 bits (257), Expect = 4.226e-22
Identity = 154/583 (26.42%), Postives = 248/583 (42.54%), Query Frame = 3
Query: 1002 ENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVF-----DGVYAASTTICIKVTDINDETPNIHINPSKLT---IKENLISGTFVG---QIKISDRDSVEVNG-KICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE--SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNP---SLNTTVKVNIT----------IGDRNDNP----PQLISSSDFSVEENRNVSLGPIGYLKAKDDD-IAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDR---YCMRLRISDNGKENKQETYVHLCIKILDV--NDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKN-----GKISYSL--KIPLGVPRYFEIDRDGGEIKVS-QTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            E  P  +++Y  ++   D  +   Y+ D +V L    LF + E G +   + ++YEI + + + + V      + +   + T+ I + D+N+  P   ++  +     +KE     T V    Q   +DRD+  + G  I      G   ++  T      +T    +    +     R++  NN    P     +  +DG    N   + T  + V +ED ND  PVF  S Y     EN  I   + +V ATDKD+G N  I Y +    ++ F ID+++G I   K  D    D + + I A+D G+P   S   TV++++             D  +N     PQ  S   FS+ E+     G +  ++A D+D I  N  +R+ L       F I P +G +    S D E       Y + +  +D G  +   T   L I+I DV  N NSP+F +P   +               +E+S       ++ T+ A D D+  N     GK+ YS+     LGV   F +D + GE+KV+  +L R     Y + V ASDN   P S    L+INL D
Sbjct:   39 EGRPARSSVYLFDSSSGDVFSL--YQADPTVPL----LFQISEVGHVTSTQEIEYEIGKTNKYDLTVLQRPRGETLGGIAITLRITILDVNNFHPVFQLSQGEHYEGFVKEGTAENTIVEGLEQCHATDRDTSGIRGYSIISGNEKGYFKVE--TVQIGSGVTSRKFLVLKTTGKPIVRDD--NN----PYIMLTVQVTDG---GNPSHSGTANIRVNVEDANDQTPVFESSQYRETIAENTPIQTSVLRVRATDKDDGTNGGIYYYMKNPVNSYFTIDAITGVIRVAKTLDYNARDKHTLYISARDRGDPPRTSAEATVEISLRENIQGWPLPDSADPKENTKPYFPQ--SRYTFSIREDFPPK-GALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSAT-TQLLIEIQDVDENKNSPRF-DPQQAI---------------LEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTGLGV---FRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLD 581          

HSP 11 Score: 96.2857 bits (238), Expect = 7.160e-20
Identity = 151/602 (25.08%), Postives = 238/602 (39.53%), Query Frame = 3
Query:  585 AIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVV------LKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD-----KTARLSYRLDNSV--KLAIRRLFLVQEEGWIILNRGLDYEID----QMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDP--SITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKID-----SVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDN-----PPQLISSSDFSVEENRNVSLGPIGYLKAKD-DDIAENGEIRFDLMWPHKGY-FDITPNGT------IYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQ 2267
            A++T     +D ND  PVF       R  E N      + +  A D D    +  I + L    +++F++     +G   V V       K LD E +S   V     N+G  +  +Q  I+  + D NDN P F  S Y+  + EN P  T++  I+A+D D       A+LSY L +S   K +I  L      G I      D E      ++ +   +  +   +AS    I V+D ND  P       + ++ EN   G  V ++  +D D     G    +E   +    P  F+ DP       S I + + +  +               T  L  +D  G    Q   T  + + I D NDN P F   IYN   +E+      +  V A DKD G N   T+ I   +D    F I+     +  G I      D+E+   + + + A D G       V++N+   D NDN     PP  +      V   + V+      LKA D D   ++  I F +     G  F + P         +++   FDRE    + + +   DN     Q+ + ++ + +LDVNDN+P+
Sbjct: 2760 AVVTVTI--QDVNDLPPVFSSPLYESRIQE-NTGPGAGVVMVTASDID----SPTISFSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDRE-ESPVKVFTVIANDG--KHTAQAEIRVNLTDVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPL-----SGLIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSDANDHKPKFTEKFYRGSVAENAPPGYSVLRVTATDEDV----GPNAEFEFVVVQGNDPHAFYIDPFNGTVLVSGILDYEKKKEY---------------TITLTVAD-RGMPPLQGDETAYVVIEILDANDNAPEFIPKIYNASVLEDVGARQPVLTVTAVDKDSGPNGNFTFAIDPRSDPDDAFTIEPNPNNASIGIIRTRVPLDQEKTPSFHLKVTATDAGGLQGEGEVRINVI--DVNDNGPWFVPPFFVGQIKEGVSARQFVT-----KLKAYDPDAFVKDQVITFSIYNGTVGENFKLDPVSVTNESVDLHSYGVFDREAAPVWKIGIEAVDNVGPKPQKNFTYVYVDVLDVNDNAPK 3319          

HSP 12 Score: 85.5001 bits (210), Expect = 1.405e-16
Identity = 124/490 (25.31%), Postives = 213/490 (43.47%), Query Frame = 3
Query: 1185 LFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFL--NNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIE--------DVNDN-RPVFTESIYNIFFMENNHIHAHIHQVLATDKDE-GQNSRITYDILES--NDFKIDSVSGWINAMKIFDREEMDH---YVVTIKAQDHGNPSLNTTVKVNITIGDRNDN-------PPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAEN-----GEIRFDLMWPHK-GYFDITPN-GTIYAKV-SFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVI 2549
            +  V+V DG    ++ +  I + V D ND+TP    +  + TI EN    T V +++ +D+D    NG I  Y  + +N+   FT      + + +   +  +R   D+        +R  P RT+            A+ T+  +L   I+        D  +N +P F +S Y     E+      +  + A D D  G N R+ Y +  +  + F ID  SG +      D E   +   Y +T+ A D G  SL+ T ++ I I D ++N       P Q I     ++++N  V+      + A D D   N     G++ + ++     G F +  N G +   V S DRE   +Y + ++ SDN     + + + L I +LD +DN P F +P Y+        P N P+               VT+  +  DAD+    SY++  P GVP  ++I+   G I+ S++L +S++ +  + VI
Sbjct:  217 MLTVQVTDGGNPSHSGTANIRVNVEDANDQTPVFESSQYRETIAENTPIQTSVLRVRATDKDD-GTNGGIYYYMKNPVNSY--FTIDAITGVIRVAKTLDYNAR---DKHTLYISARDRGDPPRTS------------AEATVEISLRENIQGWPLPDSADPKENTKPYFPQSRYTFSIREDFPPKGALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRFDPQQAILEISENLKQNSLVTT-----VSATDSDSVGNPSSPDGKVVYSIVGGTGLGVFRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNAT-FPRSSRLFLMINLLDEDDNFPYFSQPIYIAQV-----PENQPS------------GTFVTV-VVGRDADEGFNPSYTVITP-GVP--YKIEPSTGVIRTSKSLDQSELSTRELQVI 661          

HSP 13 Score: 84.3445 bits (207), Expect = 3.518e-16
Identity = 133/601 (22.13%), Postives = 243/601 (40.43%), Query Frame = 3
Query:  711 QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNH-----TVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTA-------RLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTT---ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND--FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENR--NVSLGPIGYLKAKDDDIAENGEIRFDLMWP-HKGY-FDITP-NGTIYAKVS----FDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL 2435
            +A DND    N+++ Y L  N    F   ID ++G   V +  ++D E+  N+     TV       G     +Q++I+ + +D N N P F+    ++ I EN   ++ +  + A D D          ++ Y +     L + R+     E  + +   LD E    +  VV+  D      ++   + I + D +D  P          + EN  SGTFV  +   D D    N       P       P+   P   +        I++  + D+ E    E    ++  + + + G  T + Q+ IT     +I  VN   PVF  + Y++   E      ++  + A D     +  + Y +    D  F++D  SG ++    F+ E +D Y + I+A+      +  +  + + + +  D P     S   +V+E+     +L P G L    D  ++  +   + +   H  Y F++T  +G  + +V      D     +Y   +R +D    N   T   + + ++DVND+ P+F++  Y LS      P++ P            G  LVT++A D+D   N ++ Y L
Sbjct:  391 RAADNDPIGPNKRLRYSLSGNGVSKFA--IDPESG--VVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRFDPQQAILEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTGLGVFRVDSNTGEVKVAVPS-LDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDNFPYFSQPIYIAQVPENQPSGTFVTVVVGRDADE-GFNPSYTVITPG-----VPYKIEPSTGV--------IRTSKSLDQSELSTRE----LQVIVRVSTAGSKTADGQVNIT-----VISKVN-RPPVFKNTPYSVKVPEEMGPLPNLFCIAAVDS---LSRPVQYTLAPGADGLFEVDKDSGRLHTKNSFNYENVDRYNLRIEARTSSVQEV-ASASLTVEVTEEKDLPKFSSDSYQLTVDESAAPGTTLAP-GLLIIDSDTSSDQFDCSMEAITSLHTLYNFEVTQQSGRCFLRVQAGGKLDAHLASKYTFNVRATDRNFRNMFAT-AQVEVNVIDVNDHKPEFLQESYWLSV-----PSSTPA-----------GSSLVTVQAEDMDIGTNAQVRYEL 940          

HSP 14 Score: 83.5741 bits (205), Expect = 4.845e-16
Identity = 168/709 (23.70%), Postives = 288/709 (40.62%), Query Frame = 3
Query:  594 TTVFL-FEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQ-AIDNDVTEKNRKILYEL----HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIV-IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSIT---QESNIFEIK--SRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQ-----------NSRITYDILE--SNDFKIDSVSGWINAMK-IFDREEMDHYVVTIKAQDHGNPSLNTTVKVNIT-IGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIP--------LGVPRY-FEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLL 2597
            TTV++   D ND+ P F       R  +  L  D +I  P  A+D+D    N KILY +    H + +++F  NIDS TGK  +     LD E+  +HT+ + A + G  ++ S I  +  +V+D NDN P F  + Y   I       T++ ++ A D D  +  +++Y +   ++      F + E+G I++++ L           VE  D      + S T+ I V  + D  P   ++P  + +KE + +   V  +K +  +++     +      GM  + P T   D +     +E   +E+K  +R T DR   +                               L +++ ++NDN+P F +       ++       I     TD  EG+              IT+ + +   + FKIDS  G + A K I D  ++  Y   +KA D+G P   T VKV +  +  R D     ++     V E+      P G + A       NG +   L+ P K  F +  NG +      D E +  + M +R     + N  +  V +       NDN P +ME      R+ +A           ++     G  +  ++A D D   +G + Y LK P           P++ F I+    +++V+ +L       Y + V A D G+P L+   + L
Sbjct: 1302 TTVYVNLTDINDDAPHFTSAIY-RRSIKEGLAEDTEILPPVIAVDHDFGS-NGKILYSILSGVHPDWDKYF--NIDSATGK--ITTKMTLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAFYRAKISLGAVKGTSVLQVHATDLDSGQNGQITYSI---IQGNEEEAFTINEQGVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVY-LPDGPPMFVVSPVTVYVKEGVPANHRVAGVKAATSEALTYT--LLSGNEAGMFRINPSTGSLDATRELDYEERRRYELKIEARDTRDRSAMVE------------------------------LIIIVVNINDNKPTFVD------IVDGQIDRKAIGTCSPTDIAEGEVITRLGAFDRDGDEITFIVPDDVKDLFKIDS-RGVVTAKKPIEDLPKI--YPFNVKALDNGEPPQETDVKVRLVFVHYRPDQKHVRVN-----VREDT-----PTGSVIATVRRYFPNGIV--SLLLPEKANFSVRANGDVILLTPLDYESQQFHRMTVREELGNQTNDVDVEVVVLDV----NDNRPIWME------RERLA----------RVNTNSRAGAQVYQLEARDEDDGSSGLVGYQLKSPSNDAKRKRRSPPQHPFTINPKTRQMEVAGSLKDQ---RYDLDVFAFDYGIPRLTSDTITL 1924          

HSP 15 Score: 68.9366 bits (167), Expect = 1.400e-11
Identity = 64/237 (27.00%), Postives = 108/237 (45.57%), Query Frame = 3
Query:  402 QLRYKFSKEN-KYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFE----DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDV----TEKNRKILYELHQNEE-EFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRL 1082
            +LRY  S      F++  +SG +T   ++D E   +N+             TV   D+       TT  L E    DEN N P F  +      SE NL ++  +    A D+D     +  + K++Y +        FR  +DS TG+   V + +LD E  S +T++++A +     + S++ +   +LD +DN P+F+Q  Y+  +PEN P  T +  +   D D+    SY +
Sbjct:  403 RLRYSLSGNGVSKFAIDPESGVVTLTDSVDYENTPNNH---------VYDLTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRFDPQQAILEISE-NLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTGLGVFR--VDSNTGE-VKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDNFPYFSQPIYIAQVPENQPSGTFVTVVVGRDADEGFNPSYTV 626          

HSP 16 Score: 67.3958 bits (163), Expect = 4.511e-11
Identity = 100/379 (26.39%), Postives = 161/379 (42.48%), Query Frame = 3
Query: 1596 ITFTLSVLIEDVNDNRPVFTESI---YNIFFMEN---NHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSV---SGWIN--------AMKIFDREEMDHYV-VTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF--SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREKEDRYCMRLRISDNG--KENKQETYVHLCIK-------ILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDA-DKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGS---YRIHVIASDNGVPPLSDIKVLLINLADI 2615
            I  TL + I DVN+  PVF  S    Y  F  E    N I   + Q  ATD+D   +    Y I+  N+   FK+++V   SG  +          K   R++ + Y+ +T++  D GNPS + T  + + + D ND  P +  SS +  ++ EN  +    +  ++A D D   NG I + +  P   YF I    G I    + D    D++ + +   D G       E  V + ++       + D  D  P+    PY             P +    SI E   P   L+ ++A D D    N ++ YSL    GV + F ID + G + ++ ++   +  +   Y + V A+D G   LS    LLI + D+
Sbjct:  111 IAITLRITILDVNNFHPVFQLSQGEHYEGFVKEGTAENTIVEGLEQCHATDRD--TSGIRGYSIISGNEKGYFKVETVQIGSGVTSRKFLVLKTTGKPIVRDDNNPYIMLTVQVTDGGNPSHSGTANIRVNVEDANDQTP-VFESSQYRETIAENTPIQTSVL-RVRATDKDDGTNGGIYYYMKNPVNSYFTIDAITGVIRVAKTLDYNARDKHTLYISARDRGDPPRTSAEATVEISLRENIQGWPLPDSAD--PKENTKPYF------------PQSRYTFSIREDFPPKGALLVMRAADNDPIGPNKRLRYSLS-GNGVSK-FAIDPESGVVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDV 469          

HSP 17 Score: 58.9214 bits (141), Expect = 1.851e-8
Identity = 78/331 (23.56%), Postives = 139/331 (41.99%), Query Frame = 3
Query:  429 NKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENS--FLAIITTVFL-FEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ-NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGV-YAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDG 1406
            +KYF++   +G ITTK T+D E               + T  +   D  S   L+ I  V +   D NDN PVF   F   + S +  ++   +    A D D + +N +I Y + Q NEEE F +N      +  ++V K+L   +    ++ +EA ++    +   + ++  V    D  P F  S   + + E  P +   +++  +    +  L+Y L +  +  + R+      G +   R LDYE  + +   +E  D    +A   + I V +IND  P        + I +  I    +G    +D    EV  ++  ++ DG
Sbjct: 1367 DKYFNIDSATGKITTKMTLDYET------------HKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAFYRAKIS-LGAVKGTSVLQVHATDLD-SGQNGQITYSIIQGNEEEAFTIN-----EQGVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVY-LPDGPPMFVVSPVTVYVKEGVPAN---HRVAGVKAATSEALTYTLLSGNEAGMFRIN--PSTGSLDATRELDYEERRRYELKIEARDTRDRSAMVELIIIVVNINDNKPTF------VDIVDGQIDRKAIGTCSPTDIAEGEVITRLGAFDRDG 1666          
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 192.586 bits (488), Expect = 2.530e-49
Identity = 192/701 (27.39%), Postives = 308/701 (43.94%), Query Frame = 3
Query:  588 IITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKN--LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAA---STTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIR------------FDLMWPHKGYFDI--TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            ++  V   ED NDN PVF     T    E        I   +AID D+ + N  +LY + +N  ++  +N  + TG   V+ L +  LD E +      + A + G+  K S   +  +++D NDN P FN + Y   + EN P  T +  + A D D    A+LSY L     +   R  +  + G I     L+ E    +   +   D    A   +T + I VTD ND  P    +    +++E++  G  VG++  +D D +  N ++  Y   G  +L           +       I +  T DRE+  +          L+I +  HG     L    ++ + IEDVNDN+P+F++S+YN+   E+  +   + QV+ATD DEG N + TY I   +    F ID+ +G I      D E+   Y +T+ AQD G P L     V I + D +DN P +     +S E   NV+ G  +  + A D D AE    R              L+    G   +  TP+G +      +RE   RY +++         +Q++ V   I +LDVNDN+P+F    Y+ S     GP              I    ++T+KA D D  ++G+I +++ +       F++D   G +  ++ L R D   Y + V+A D G P LS    + I + D+
Sbjct: 1277 LLKVVVQVEDVNDNPPVFSMPGYTIEYWE-ESPEGTSILQVKAIDADIGD-NAAVLYSIVENVTDYVTVN--AITG---VISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG---VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDED-INDNARVRYYISSGNTSLM---------FSVNETTGIISTTSTLDREQNAS--------YTLIITAKDHGI--PALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP-VFHKPRYSAELYENVTRGHHVITVNATDID-AEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCL------NRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGP--------------ITDATILTVKAQDGDEGESGEIIFTI-VSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDM 1924          

HSP 2 Score: 158.303 bits (399), Expect = 8.166e-39
Identity = 202/804 (25.12%), Postives = 329/804 (40.92%), Query Frame = 3
Query:  399 TQLRYKFS----KENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIY--KIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEI--------------------------DQMHLFVVEV-FDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRD-------SVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI--GYLKAKDDDIAENGEIRFDL--------MWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGK-ENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQI---LVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDI---------GSYRIHVIASDNGVPPLSDIKVLLINLA 2609
            +Q++YKFS     +  +FSL   +G +T    +D E           A    +             +  T +    D +D  P F   F   +E E N      +   +A D DV   N  ILYE+   N +  F   IDS TG   + V  ++DAE      + ++A         + + +   V+D NDN P F QS Y+  + E+  L   +   +++  D DK       L + V     +  +    G + +N+ LDYE                           ++  +   E      ++A+ ++ + + ++ND  P    +    T+ E +  GT +  I  +D D       + E+ G    Y          F+ + D      + I +     T  + +F             L+  DG G    Q     T++V ++DVNDN P FT   Y     EN      + QV ATDKD G+N R++++I   +D   F I+  SG +   +  DRE +  Y +T+ A DHG  S +  V++ + + D NDN PQ+      +   +     G +    + A D D   NG++ + +        +    G   I+P G        DRE +D Y + + ++DNG   N   T VH  + ILDVNDN+P F +P           P  +  T + +++ E PG I   L+ I A D DAD NGK++YSL        +F +D   GE+ V + L R            G + + + A+D    P+SD K   + ++
Sbjct:   79 SQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFE----------VARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYL-KEIEENTPIGSTVVTVEARDGDVG-INNPILYEIISGNSDGVF--TIDSNTG--VITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAY----------FSVNADNGTISAAQILDYD---TLRQYQFS------------LVVKDGGGF--YQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTG-------LDRELKDSYDLIINVTDNGSPPNTNSTTVH--VTILDVNDNTPAF-DP----------NPAQSLATYV-ITVDEGPGTINKTLIDINATDPDADANGKVAYSLS--GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQAT-PISDRKSATVRVS 814          

HSP 3 Score: 138.272 bits (347), Expect = 9.250e-33
Identity = 166/673 (24.67%), Postives = 280/673 (41.60%), Query Frame = 3
Query:  438 FSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWD------ENSFLAIITTVFLFEDENDNVPVFP---FKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTIC---IKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNH--IHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSD---------FSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQIL 2375
            F++   +G ITT+  ++ EE              + T T+   D      E +   IIT      D ND+VP F    + F    + ++     R        D D+ +  R   Y    N    F +N         +     LD E  +++T+I+ A + G+   +S   +   + D NDN+P F++S Y +T+ E+  L T + ++ A DPD+ A   +    +        ++    G I +   LDYE   ++   V   D      T  C   I V+D++D  P  H       + EN+  G  V  +  +D D+ E + K   Y  +  N    F       I ++S +  +    +      LN E        +   S  + T    L +   ++VL  DVNDN P F    Y    +E+      A I  V A D DEG++  I + I+  N+   F++D+ +G +   +  DRE+   Y + + A+D G P+L+++V VNIT+ D NDN P L +  D         FSV+EN +  + P+G + A+D D  +N    +      + YF +   +G +  +++ DRE    + + ++ S++           L I  L            P    R  +A P N+ TT    +   +PG +L
Sbjct: 1446 FAIDPDTGNITTREPLNREETG------------SYTLTLRAVDSAIRAREGTTRVIITVT----DANDHVPQFTQSGYAFSVREDVKVGHTVGRV----ATTDEDINDNARVRYYISSGNTSLMFSVN----ETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDA-EASHKRVYYRIESGNTDSMFL------IGEQSGVITLNCTPS----GCLNRETHARYELQVAAISRVNLTEQKSL-VPAVITVL--DVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGV-PVGVVAAQDLD-TKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASND----------KLNITTLQ-----------PLARKRRAVADPANSNTT--NTTQAPLPGMVL 2055          

HSP 4 Score: 137.887 bits (346), Expect = 1.389e-32
Identity = 160/631 (25.36%), Postives = 258/631 (40.89%), Query Frame = 3
Query:  711 QAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEA-----------WNEGMKEKK-------------SQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDG--VYA--ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSR--ITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHI--HQVLATDKDEGQNSRITYDILESND-FKIDSVSGWINAMKI-FDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDN-------PPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVSFDREK---------EDRYCMRLRISDNGK--ENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSL 2435
            Q  D D     R++LY L   + + F ++  S T    + + K LD E Q N T   E            W    +EKK             +   +   +++ NDN+P F +S+Y  T+ E     T+I  I A D D      L+Y L    +      F V  + G I   + LDY+  + + F + V DG   Y   A  T+ + + D+ND  P     P    I ENL +GT V Q+  +D+DS E NG++                  + S   +   F I     +T  RE  L+ E I      L + +  HG ++    +  T++VL  D NDN P  T+ +     +        +    + A D D G N ++TY +   +  F ++S +G +       DRE  D Y + I   D+G+P    +  V++TI D NDN       P Q +++   +V+E        +  + A D D   NG++ + L     G+F + P  G +  +   DRE          + R+ + +  +D      +++   V + I + D NDNSPQF    Y                   LS    PG  ++ + A D D +  GK+ Y++
Sbjct:  283 QVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGT----LYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL----RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGE-NGRLSF----------------NISAGDDGGHFSINGSGLVTTARE--LDRETIATY--TLTVSAYDHGVSSRHKHVQLTVNVL--DENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNY----------------ETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI 866          

HSP 5 Score: 134.806 bits (338), Expect = 1.107e-31
Identity = 176/684 (25.73%), Postives = 289/684 (42.25%), Query Frame = 3
Query:  600 VFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLP----QAIDNDVTEKNRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGM-KEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITP-NGTIYAKVS-FDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPP-YLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            V   +D NDN PVF        +   ++L +     P     A D D    N KI Y+L + N+++ F +N  + TG+  + V   +D E+     + ++A ++G    +K+   +   V D NDN P F+ + Y   I EN+P+ + I  +    PD+    S     S   A   L   +E+  I L                                   INDE+P    +   + + E+   G  +G++  +DRD  E    I  Y  +G        F+    +++ +    + S +  DRE    N  I  +  A ++      T    +T+T        DV D++P F  S   +   EN  I  ++ ++ A DKD G    I+Y I   +    F ID+V+G I  +   DRE +  Y + ++A+D  N  ++  +KV + + D NDNPP + S   +++E       G  I  +KA D DI +N  + + ++     Y  +    G I    S  DRE E+ +   +R +D+G  +K  T   + IK++D+NDNSP F     Y   R+N   P   P               ++ + A D D   N K+SY L   L     F ID D G I   + L+R + GSY + + A D+ +        ++I + D
Sbjct:  907 VIYVDDVNDNDPVF-----NQSKYAADVLENSPTGTPVLRVHASDRD-QGANGKITYKLTNGNKDDAFSIN--NVTGE--ITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV----PDQKISSSTLRPRSSPRAPAALLTAREKRPITL-----------------------------------INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD--EGINAIIFYSSNGAE----AKFY----VSRSTGDIIVDSPL--DRE--FKNVYILNVTAANIVAGAQDTTTQVHITVT--------DVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN-LVSDLLKVVVQVEDVNDNPP-VFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSST-ASVAIKLVDINDNSPVFNNTDYYAYVREN--QPAGTP---------------VLVVTASDKDVGTNAKLSYVLSGVLYT--RFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTD 1495          

HSP 6 Score: 116.316 bits (290), Expect = 5.457e-26
Identity = 162/654 (24.77%), Postives = 264/654 (40.37%), Query Frame = 3
Query:  405 LRYKF-SKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSF---LAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVIT-IPENTPLSTNIYK-IEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILN-RGLDYEIDQMHLFVVEVFDGVY---AASTTICIKVTDINDETPNIHINPSK------LTIKEN--LISGTFVGQIKISDRDSVEVNGKIC---CYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALL--ICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHY------VVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQF 2270
            L Y+    +  YFS+   +GTI+    +D + +                 ++ V D   F   +AI T     +D NDN P F     T   +E NL     ++   A D D  E  R        ++   F +N     G   V   + LD E+ + +T+ + A++ G+  +   + +   VLD NDN P       + T I E     T +   I A+DPD  A  + +L  S+     R  L    G + ++  GLD E+   +  ++ V D        STT+ + + D+ND TP    NP++      +T+ E    I+ T +  I  +D D+ + NGK+      +  G   L P T              E+  R   DRE    +         LL    +D     + + + T  +S+ + D NDN P F    Y     E     +++ QV ATD+D     ++ Y+I + ++ +   V   +            HY       V  K       S+  T  V I + D NDN P + + S ++ +   N   G P+  + A D D   NG+I + L   +K   F I    G I      DRE    + + ++  D G+ + ++T+  + I + D NDN PQF
Sbjct:  424 LTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQ------------YQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAE-NLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSIN-----GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPD--AGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLI-DINATDPDA-DANGKVAYSLSGDEHGFFRLDPVTG-------------ELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVR-----------HYNWHKKNCVLCK---ESKCSVERTYVV-IYVDDVNDNDP-VFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQF 1026          

HSP 7 Score: 115.931 bits (289), Expect = 7.399e-26
Identity = 176/676 (26.04%), Postives = 288/676 (42.60%), Query Frame = 3
Query:  615 DENDNVPVF--PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRG-LDYEIDQMHLFVVEVFD-GVYA--ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNG----KICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKD-EGQNSRITYDILESND---FKIDSVSGWIN----AMKIFDREEMDHYVVTIKAQDHGN-PSLNTTVKVNITIGDRNDNPPQLISSSDFS--VEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDN 2561
            D NDN PVF     +   RE   N      + +  A D DV   N K+ Y L  +   + R  ID  TG   +   + L+ E   ++T+ L A +  ++ ++    +   V D ND+ P F QS Y  ++ E+  +   + ++   D D    AR+ Y + +        +F V E   II     LD E +  +  ++   D G+ A  ++T++ I + D+ND  P    +   +T++E++   T V Q+  +D D    NG    KI   + D +       F+ D +    + +  IK+++ +++    N          L + +   GT    LT    + + + DV+DN PVF +  Y+    EN     H+  V ATD D E  + R+ Y I   N    F I   SG I          +RE    Y + + A    N     + V   IT+ D NDN P+  S S     +E+   ++   I  +KA+D D  E+GEI F ++  ++ G F +    G +      DRE    Y + +   D G E    + V + I +LD+NDN P    P  +L           P      S+ E    G  +  + A DLD  KN  + Y         +YF ++   GE++   TL R D   + ++V AS++
Sbjct: 1391 DINDNSPVFNNTDYYAYVRE---NQPAGTPVLVVTASDKDVG-TNAKLSYVL--SGVLYTRFAIDPDTGN--ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSG---NTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDE-GANGQFTYKITAGDTDDV-------FYIDAN----TGLITIKAKLDYEKTSLYN----------LTVSAQDLGT--PPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKG-EPALSSSVTVNITVLDMNDNLPILQTPMDVL----------IPERRTTFSVKENLDAGVPVGVVAAQDLDT-KN--LIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASND 2017          

HSP 8 Score: 114.005 bits (284), Expect = 2.653e-25
Identity = 175/692 (25.29%), Postives = 284/692 (41.04%), Query Frame = 3
Query:  621 NDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNR------KILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYA--ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFH---PDPSITQESNIFEIK-SRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVF------TESIYNIFFMEN-NHIHAHIHQVLATDKDEGQNSRITYDIL--ESNDFKIDSVSGWINAMKIFDRE--EMDH-------YVVTIKAQDHGNP---SLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDR-----EKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            NDN P+F        +S  N   D +I  P     D+T  +        + YEL   +  +F +N D+ T     ++  + D   Q   +++++    G  ++ +   +   + D NDN+P F    Y   I EN P  T ++++ A D D  +  RLS+ +           F +   G +   R LD E    +   V  +D GV +      + + V D ND TP I      LTI  N+  G   G + +S          I   +PD  +N Q  T+     D   T  S    ++ S    DRE   + + I      + +  +G   N    T + T+ V I DVNDN P F      + + Y I   E    I+  +  + ATD D   N ++ Y +   E   F++D V+G ++  K  DRE  +M         +++ I A D   P     + TV+V+IT+ D NDN PQ   S ++    +     G  +  + A D D+   G++ +++            +G    K   ++         + C+  + S   K + + TYV   I + DVNDN P F +  Y  + D +    N+PT           G  ++ + A D D   NGKI+Y L         F I+   GEI V+  + R  + ++ + V A D G P
Sbjct:  383 NDNKPMFA-------KSSYNYTMDEEI-TPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQIL--DYDTLRQYQFSLVVKDGG-GFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGG---HFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT---DGLTITTNISEGAGGGTVLLS---------SIAAVDPDAGSNGQ-LTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLI------INVTDNGSPPN----TNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF-QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNIT-----------DGDENRKCEVEKLVRHYNWHKKNCVLCKES---KCSVERTYV--VIYVDDVNDNDPVFNQSKY--AADVLE---NSPT-----------GTPVLRVHASDRDQGANGKITYKLT-NGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEP 1003          

HSP 9 Score: 87.0409 bits (214), Expect = 3.904e-17
Identity = 100/345 (28.99%), Postives = 152/345 (44.06%), Query Frame = 3
Query: 1629 VNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKV-SQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI---PPGLNN 2633
            +ND  P+F +S+Y +   E+      I +V ATD+DEG N+ I Y    SN     F +   +G I      DRE  + Y++ + A +    + +TT +V+IT+ D  D+ P   SSS  +V+ + N S+G  +  + A D DI +          P+ G F I    G I      DRE   +Y + ++  D+   N     + + +++ DVNDN P F  P Y                 IE       G  ++ +KAID D   N  + YS  I   V  Y  ++   G I + S  L R     +   + A+D+GVP  S    + I L DI    P  NN
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY---SSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSS-LTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPY-GLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS--VNLVSDLLKVVVQVEDVNDNPPVFSMPGYT----------------IEYWEESPEGTSILQVKAIDADIGDNAAVLYS--IVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNN 1401          

HSP 10 Score: 82.0333 bits (201), Expect = 1.522e-15
Identity = 62/204 (30.39%), Postives = 100/204 (49.02%), Query Frame = 3
Query: 1614 VLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFS-VEENRNVSLGPIG----YLKAKDDDIAENGEIRFDLMWPHK-GYFDITPN-GTIYAKVSFDREKEDRYCMRLRISD 2189
            ++++D NDN PVFTE  Y     EN  +   I ++ A D D G NS++ Y    +       F ++SV+G +      D E    Y++ + A+D G P L +   V I + D +D PP+ + S     +EEN      PIG     ++A+D D+  N  I ++++  +  G F I  N G I    S D EK D + + ++ S+
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENT-----PIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASE 232          

HSP 11 Score: 57.3806 bits (137), Expect = 4.235e-8
Identity = 114/463 (24.62%), Postives = 184/463 (39.74%), Query Frame = 3
Query:  402 QLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVF--LFEDENDNVPVF-PFKFKTHRESEINLLRDRKIYLPQAIDNDVTE----KNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAES-------QSNHTVILE--AWNEG--MKEKKSQIV-IKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRL---DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQV 1718
            QL Y  S  +  F+L   +G +    T    E+ D+ +             +NV D  S     +T       D NDN P F P   ++     I +           ID + T+     N K+ Y L  +E  FFRL  D  TG+  + V K LD ES       Q +   +L+  A ++   + ++KS  V +   V D NDN P F    Y   + E     +N+ ++ A D D     ++ Y +   D + K  + +L  V+   W   N  L  E                   T + I V D+ND  P  + +     + EN  +GT V ++  SDRD    NGKI  Y+    N    F+ +   ++T E  +  +  R           E +H     L + ++  G  +++ T    + + ++D NDN P F+ + Y     EN+ + + I  V
Sbjct:  634 QLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYD-----------LIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRL--DPVTGE--LSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKL--VRHYNWHKKNCVLCKE------------SKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQ-GANGKIT-YKLTNGNKDDAFSIN---NVTGEITVAGVIDR-----------EAVHTF--VLTVQAEDQGEPSSRKTFAEVV-ITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV 1048          

HSP 12 Score: 55.0694 bits (131), Expect = 2.530e-7
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  603 FLFEDENDNVPVF---PFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELH---QNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD 1055
             + +D NDN PVF   P+  K    + +       I    AID D +  N ++ Y+       +  FF LN  S  G+  + +   LD E   ++ +++ A + G+ + +S+  +  EV D +D  P F QS Y+  I ENTP+ + +  +EA D D
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGT----TILKISAIDAD-SGTNSQVQYKFSNATATQTPFFSLN--SVNGE--LTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGD 181          
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 177.948 bits (450), Expect = 5.459e-45
Identity = 201/694 (28.96%), Postives = 306/694 (44.09%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRL-NIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYV-------ITIPENTPLSTNIYKIEAIDPDKTARLSYRL-------DNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTT--ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF-SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWP-HKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE-IPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            DEND+ PVF         +E N      I    A D D +  N  I Y +  +  +   + ++DS TG   +   +NLD E ++++T  + A + G+  K     +   VLD NDN P   + TY+           EN+ ++TNI  I   D D        L       +   K+     + +Q      L + LD E+   +   + V D GV + ST   + I VTD+ND +P    N     I E   +G++V Q+  +D D  E +     Y   G N+L  F       +  +S +  + +    DRE+  +          + I +  HG+  A  T + T++V I D NDN+P F +S Y     E   I A + QV ATD D G N RITY+I  S+      F++++ +G +      DRE    Y  T+ A+DHG+P L ++VKV +TI D NDN P       F S+ EN     G +  + A D D   N  I +D++   + G F I +  G I    S D E E+ + + +   D G +   +T V + + +L+  DN P F+   Y                    ++YE +P   LV  +      DKNG ISY+  I  G P   F +D  GG IK++  + R +   Y + VIA    V PLS    + I + D
Sbjct:  198 DENDHAPVFTQNSYLGSIAE-NTKPGVSILRVSAADRD-SGSNGDIKYAIDWDAIQSNSIFDLDSSTG--VIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQL-KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQ------LQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPD--EGDNGTVSYSITGGNDLGWF------QVDFQSGL--VTTAKPLDREQVSS--------VTITITAQDHGS--APKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENE--PPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAV-VNVTVLNKADNLPVFLYEMY------------------NFTVYENVPKGTLVG-RVYATTKDKNGSISYA--IVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLD 836          

HSP 2 Score: 174.096 bits (440), Expect = 9.908e-44
Identity = 201/764 (26.31%), Postives = 316/764 (41.36%), Query Frame = 3
Query:  414 KFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ--NEEEFFRLNIDSKTGKPFVVVLKN-LDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTAR--LSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAAS---TTICIKVTDINDETPNIHI------NPSKLTIKENLISGTFVGQIKISDRDS---VEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENGEIRFDLMWPHK---GYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNG---VPPLSDIKVLLINLADIPP 2621
             F    K F     +G I+T + ID E               T   ++ +   N     I+     +D NDN P FP  + T R  E ++  +    +  A D D    N  + Y +    N   F        TG    V+ K  LD E+   + + + A + G        +I   +LD ND+ P F Q++Y+ +I ENT    +I ++ A D D  +   + Y +D     +     L    G I   + LD+E+   + F V   DG   +     T+ I V D ND +P + I      N  K    EN +  T +  I ++D+DS    +   KI   + +G   ++   F            + I+ +   DRE       + P     L  +D  G   ++ T+ F L + + DVNDN P FT + Y     E     +++ Q+ ATD DEG N  ++Y I   ND   F++D  SG +   K  DRE++    +TI AQDHG+     +  V +TI D NDN P+ + SS +    +   S+G  +  + A D D  +NG I +++        G F++ T  G ++ K   DRE +  Y   +   D+G      + V + + I D+NDN+P F    Y  S                +   E PG++L  + A D D   N  ISY + I       F ID   G I    +L       + + + A D G       + + V ++N AD  P
Sbjct:   34 AFEGSPKQFGFNSNTGVISTTARIDRET--------------TTQISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRE-SMDVNTTNPINTATDPDA-GNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF------------YFIQLQKPLDRE-------LVPFYNLTLNVTD-KGVP-SRSTLGFVL-IDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSS-YKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSS-VKVELTISDINDNAPVFYPVEYFAS----------------IMENEPPGKLL-QVTATDADEGTNAVISYDI-IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLP 739          

HSP 3 Score: 164.081 bits (414), Expect = 1.087e-40
Identity = 180/669 (26.91%), Postives = 290/669 (43.35%), Query Frame = 3
Query:  615 DENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEK-NRKILYEL-HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDK--TARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVV---EVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE---SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGY-LKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETY-VHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLS 2579
            D NDN P F     T   SE   L     Y+ Q    D  E  N  + Y +   N+  +F+++  S      V   K LD E  S+ T+ + A + G   K     +   ++D NDN+P F +S+Y  TI E   +   + ++ A D D     R++Y + +S    +  LF L  + G +     LD E   ++ F V   +  D    +S  + + ++DIND  P  +      +I EN   G  + Q+  +D D  E    +  Y+  G NN   F      SI   + +    + +  + EEF           +L+I +   G   A  T    ++VL  +  DN PVF   +YN    EN      + +V AT KD  +N  I+Y I+    +N F +DS  G I      DREE   Y++ + A+      L+    VNI + DRNDN PQ  S+S   V+ +    +G + Y   A D D  +NG +R+ L    +G   I + +G I          E +Y +++  SD+G   +  T  +H+ + I    ++ P+F    Y+             + P+    +         + A+D D+ KNG++ YS  IP G          GG++ + ++L ++  GSY + V A+D GVP  S
Sbjct:  417 DVNDNSPAFTSNAYTANISE---LAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSG----LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS-DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDAD--EGTNAVISYDIIGGNNNGNF------SIDSSTGVISTLASLDHEVEEFF----------SLIISAKDGGNKYAAKTAVVNVTVL--NKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF-STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSSYVTHV--------LASQPLSYQFFY--------VVAVDQDSGKNGQLFYS--IPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFS 1031          

HSP 4 Score: 148.673 bits (374), Expect = 5.642e-36
Identity = 169/642 (26.32%), Postives = 276/642 (42.99%), Query Frame = 3
Query:  714 AIDNDVTEKNRKILYELHQ-NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKI--EAIDPDKTARLSYRLDNS---VKLAIR------RLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESN---DFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDL--MWPHKGYFDITPNGTIYAKVSFDRE----KEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIK-VSQTLSRSDIGSYRIHVIASDNGVP 2570
            A+D D + KN ++ Y + Q NEE  F +    K     + + K+L    + ++ +I+ A + G+    + + +   + D ND+   F  +T+   + EN+   T +  +   A+D  +T  + Y L +S     + +R      R+ L +EE  +I N G +  I Q      +    +      + + VTD+ND  P        +T+ E  + G+ V +IK  D D  + N K       G    + F           S+  E+    T DRE            ++  +       +NA L  T  + + + D ND RPVF ES Y +   E+  I + +  + A+DKD GQN  I Y I   N    F ++S +G +   K  D E    Y +TI AQDHG   L++TV V + + D NDN P L  +   ++    NV+ G P+G   A D D   N  I F +    P K +   +    I    + D E      D + + +  +D G   K  T   + +++ D NDNSP F+ PP   +  ++                      ++TI A D D + NGK++YS  I  G   YF +    G+++ + Q      I  Y++ + ASD G P
Sbjct:  970 AVDQD-SGKNGQLFYSIPQGNEEGLFGIFPGGK-----LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREE--LIKNTGSNVYIMQAEAMYNDTT--IKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD-NAKFFYSLVSGTGMDKFFI---------NSSTGELHLSKTLDRE----------TTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP-LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSP-KLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN---------------------VMTITAEDPDRNSNGKVTYS--IISGNNGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQP 1554          

HSP 5 Score: 132.109 bits (331), Expect = 6.885e-31
Identity = 158/644 (24.53%), Postives = 271/644 (42.08%), Query Frame = 3
Query:  393 KSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYEL--HQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFD-GVYAASTT--ICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFH---PDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDH--------YVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDF--SVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMW-PHKGYFDITPN-GTIYAKVSFDREKED-RYCMRLRISDNGKENKQETYVHLCIKILDVN 2252
            ++  + Y       +F++  +SG ITT+  +D EE+  N  +N    Q            +  + I+T      D NDN PVF         SE++ L    ++  +A+D D  + N K  Y L      ++FF   I+S TG+  + + K LD E+ S++ ++++A +       S   I+  V D ND  P F +S Y + I E+  + + +  + A D D  +   + Y + N     +  +F V+   G +I+ + LD+E  Q++   +   D G+   S+T  + + V D+ND  P     P  LT++EN+ +G  VG+   SDRD+             G N    F+ +   P  + +  S   EI +    D E              L++ +   G+   +L+   +++V + D NDN P F            N     +  + A D D   N ++TY I+  N+       G+ N      + +M H        Y +TI+A D G PS  T   V++         P   SS+D+  SV EN+      +  L A     + NG I + L     KG F++  + G +      DRE     + + +   D    + + +   + I + DVN
Sbjct: 1081 RTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVT----DLNDNAPVFSRAVYAITVSELS-LPGSPVFRIKAMDADEGD-NAKFFYSLVSGTGMDKFF---INSSTGE--LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG---NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDT-------------GTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSF----QLVVMATDQGS--PKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-----VMTITAEDPDRNSNGKVTYSIISGNN-------GYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTF-SSADYQGSVTENKVAGTSVVTVLAAYPQS-SLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 108.997 bits (271), Expect = 9.454e-24
Identity = 173/754 (22.94%), Postives = 319/754 (42.31%), Query Frame = 3
Query:  429 NKYFSLTEKSGTITTKSTID--LEE-----ICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGL-DYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHIN-PSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEI-KSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND-FKIDSVSGWINAMKIFDREEM----DHYVVTIKAQDHGNPSLNTTVK-----VNITIGDRNDNPPQLISSSDFSVEENR-NVSLGPIGYLKAKDDDIAENGEIRFDLM--WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            N  FS+   +G I+T +++D  +EE     I   +  N  A +   T  VNV           TV    ++ DN+PVF ++       E N+ +   +    A   D   KN  I Y +   +     L +DS  G   + +  ++D E ++ + + + A    +K   +Q  +  EVLD NDN P F+ S+ ++ I     +   +Y   A+D D  K   + Y+L ++ +     L++    G I L R L D +  Q  + V+    G     +T+ I +T        + IN P K T+       ++V  +  S   S +    +   + D   N Q F   P  +   E  +F I      + R+  L  + +      ++  +DG        + +  +++ I+D ND+R +F  + +     EN+     +  ++A   D  +   I Y ++ S   F +D  SG I      DREE+       V  ++A+   N   +TT+K     V +T+ D NDN P + S + +++  +  ++   P+  +KA D D  +N +  + L+       +F  +  G ++   + DRE    Y + ++ +D    N   T   + I + D ND  P F E  Y                 + ++   + G +++ + A D D  +NG I YS+     +   F+++   G + V+++L       Y + + A D+G+ PLS    + +N+ D+
Sbjct:  681 NGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAK---TAVVNV-----------TVL---NKADNLPVFLYEMYNFTVYE-NVPKGTLVGRVYATTKD---KNGSISYAIVSGDPTNLFL-VDSTGG--IIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE---GLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT--------LSINHPPKFTLS------SYVTHVLASQPLSYQFF-YVVAVDQDSGKNGQLFYSIPQGN---EEGLFGIFPGGKLYIRKSLL--QALKGSYDLIVRATDG---GVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYN---DTTIKRDKAIVIVTVTDLNDNAP-VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYST-AKIEITVGDSNDQRPVFPESDYT----------------VNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG-NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDV 1362          
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 175.637 bits (444), Expect = 5.666e-45
Identity = 204/757 (26.95%), Postives = 323/757 (42.67%), Query Frame = 3
Query:  429 NKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDEN----SFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQ-NEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMK--EKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATD---KDEGQNSRITY---DILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLMWPHK-GYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGK---ENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD-----IKVLLINLADIPP 2621
            N  F++   +G I T+   D E+    N             T++V D      S L     V +  DENDN P F  K  T    E N      +    A D D +  N  + Y +H  N ++ F +  DS      + + K LD E+  N+T++L   + G+   E   ++V+   V   N++ P F    Y  +IPEN PL T+I ++ A++ D +  AR  Y + ++   A  ++FLV + G I L R LDYE  + + F  E++                                  EN+ SGT V  +   DRD   +NG++  Y           T       T  S    +      DRE              L++  DG    +   T +  + V + D NDN PVFT   Y +   E   I   I +V A D   KDEG N+ I Y   D + S  F I+  +G I   +  D EE   Y   + A D G   L  +  V ITI D NDN P  + +  + V+   NV++G P+  + A D D + NG++ F ++  +  G F I  N G +    S D E    Y + ++ +D G     + Q   +H  + ++++NDNSP F +  Y  S D          T +        G +++ + A DLD+  NGK+ +S+ +       F +D++ G +  +++L   D+  Y + + A+D G PPL+      + V ++N+ D  P
Sbjct:  154 NGSFTIDNSTGEIMTRKEFDFEKTERYN------------LTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYE-NFTVGTVVLRVTAHDKD-SGPNAMLKYSIHSGNTDDAFVIIADSGD----ISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDA---ASSKVFLVNQTGDITLARELDYETRRRYEF--EMY----------------------------------ENVTSGTQVLTLFAHDRDE-GINGQVFYY---------IVTSSVKGVFTTNSTTGVVSLTAELDRESVYQ-------YNMLVVAQDG---GSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTR-YYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLH--VSVVNINDNSPVFSQKMYSASIDE--------NTTV--------GHVILRVTASDLDSSLNGKVLFSI-LEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          

HSP 2 Score: 132.88 bits (333), Expect = 1.965e-31
Identity = 95/339 (28.02%), Postives = 167/339 (49.26%), Query Frame = 3
Query: 1644 PVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDIL----ESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPI-GYLKAKDDDIAENGEIRFDLM-WPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQE-TYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYE--IPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLN 2630
            P+F +++Y+    E+  +   +  VLA D+D   N+R+TY I+    ES+ F ID+++G + + K FD E    Y  +++A+D G+P  +    +++ I D NDN P +    ++    + N  LG I   +KA D D   N ++ + +    + G F I    G I  +  FD EK +RY + + +SD G        + ++ I ++D NDN P+F +  Y                    ++YE    G +++ + A D D+  N  + YS+         F I  D G+I + + L +  I +Y + +I +D G+PPL  IK +++N+  I  G+N
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRP-IFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRY------------------TATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIH-SGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNV--IVSGVN 317          

HSP 3 Score: 125.946 bits (315), Expect = 2.587e-29
Identity = 174/720 (24.17%), Postives = 290/720 (40.28%), Query Frame = 3
Query:  741 NRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFD-GVYAAST----TICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHP---DPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKI----------------------------DSVSGWINAMKIF--DREE-----MDHYVVT---------------------------------IKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP-IGYLKAKDDDIAENG---EIRF---DLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSR-DNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLG--VPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSD-----IKVLLINLADIPP 2621
            N ++ Y +     E     ID+ TG   V   K  D E+Q  ++  + A + G   + +   I  ++ D NDN P F    Y   + ENTPL T + +++A+D D T  A L Y + N          +    G I+  +  D+E  + +   + V D GV A S+     + I V D ND  P         T+ EN   GT V ++   D+DS             G N +  ++ H    D +    ++  +I      D+E   N        T +LI +D  G    +      ++V++  VN++ P F    YN    EN  +   I +V A + D    +R  Y I ++   K+                            ++V+     + +F  DR+E     + +Y+VT                                 + AQD G+P    +  V + + D NDNPP + ++  ++++ +   S+G  I  + A D D  + G   EIR+   D +   K   + T  G I  K + D E+   Y   +  SD G E +      + I I+DVNDN P F+   Y +   +N+A                  G  +  + A DLD+  NGK+ +S+   LG      F ID++ G +  +++L   D+  Y + + A+D G PPL+      + V ++N+ D  P
Sbjct:   35 NARVTYSIVSFSTESDYFVIDNITG--VVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNG--SFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDS-------------GPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIEN-------YTLVLIVTD-MGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPP-VFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDT-TGQITIKQAVDYEERSSYSFEVFASDGG-EARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVA-----------------IGTPVTQVTASDLDSSLNGKVLFSI---LGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 706          

HSP 4 Score: 98.9821 bits (245), Expect = 6.597e-21
Identity = 110/416 (26.44%), Postives = 183/416 (43.99%), Query Frame = 3
Query:  963 PFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQE--EGWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFT-LSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVK--VNITIGDRNDNPPQLISSSDFSVEENRNVSLG-PIGYLKAKDDDIAENGEIRFDLM-WPHKGYFDITPNGTIYAKVSFDREKEDRY 2165
            P FNQ+ Y   IPE+  +   +  + A D D    AR++Y +   V  +    + V +   G +  ++  DYE  +M+ F V   D    + +A  TI +++TD ND  P       +  + EN   GT V ++K  D+DS   N  +     +G NN          S T +++  EI +R  FD   F   ER +     L I     G   A  ++ F  + +++ D NDN P F +  Y     EN  +   + +V A DKD G N+ + Y I   N    F I + SG I+  K  D+E +++Y + +   D G P L +  +  VN+ +   N++ P+ ++   ++     N+ LG  I  ++A +DD++      + +        F +   G I      D E   RY
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSI---VSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTS-NADLIYSIQNGNNN---------GSFTIDNSTGEIMTRKEFD---FEKTERYN-----LTISVSDTGV-PALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEF-YNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRY 393          
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 261.536 bits (667), Expect = 1.158e-71
Identity = 236/781 (30.22%), Postives = 360/781 (46.09%), Query Frame = 3
Query:  330 TTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCK----ADQPTMTCTVNVWDENSFLAI----ITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEE--EFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTAR--LSYRLDNSVKLAIRRLFLVQEEGWIILNRGL-DYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLIS--------GTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDI-TPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPR-YFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPP 2573
            T IGS + DL         L  S  L YK    + Y  +  K+G I TT+  ID E + D     C+     D+  +   V++ D    + +    I  +    D NDN P F     T    E N        +P A+D D +  N    Y L    +  + F L +  D     P V+V+ NLD E + ++ + +   + G   + S  +++  V D NDN P F ++ Y   +PEN+P   ++ ++ A D D  A   + Y L  +    ++RL  +     II  +GL D E D +  F V   D      ++   + I + D ND  P I I    L I +N ++        GT V  +++SDRD  E N  + C     +    PF   P    ++ +N  + K +        L+ ERI   R  ++    G    N  L+ T +L V + D+NDN P F+ ++  + F E+N     +  V+ATD D G N+ + Y I+ES+    F+I+S +G I      DRE+++ Y   + A D G PS   T  V I + DRNDN P+ ++S   FSV EN    L P+G +   D D  EN ++    + P  G F I    GTI + +SFDREKE  Y  RL+  D G +  + +YV + I +LD NDN+P   +P    S      P++ P TP+E+            +KA D+DA  N ++ Y+  I  G P   F+I  + GEIK++Q  +    G +R+ V  SD G PP
Sbjct:   53 TLIGSLAADLG--------LPDSGHL-YKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSD-----CRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPE-NTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD-TVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGE-NAVVTCVVAGDV----PFQLRP---ASESAN--DRKRKYFLQTTTLLDYERIKDYRIEIVAVDSG----NPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENM-PPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAG-DPPRSSYVGVTINVLDENDNAPYVTKPAN--SSYTHLKPSSPPDTPVEV------------VKAEDIDAGVNAELYYT--ITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPP 783          
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 261.536 bits (667), Expect = 5.764e-71
Identity = 236/787 (29.99%), Postives = 362/787 (46.00%), Query Frame = 3
Query:  315 ETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCK----ADQPTMTCTVNVWDENSFLAI----ITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEE--EFFRLNI--DSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTAR--LSYRLDNSVKLAIRRLFLVQEEGWIILNRGL-DYEIDQMHLFVVEVFD---GVYAASTTICIKVTDINDETPNIHINPSKLTIKENLIS--------GTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKI--PLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPP 2573
            E    T IGS + DL         L  S  L YK    + Y  +  K+G I TT+  ID E + D     C+     D+  +   V++ D    + +    I  +    D NDN P F     T    E N        +P A+D D +  N    Y L    +  + F L +  D     P V+V+ NLD E + ++ + +   + G   + S  +++  V D NDN P F ++ Y   +PEN+P   ++ ++ A D D  A   + Y L  +    ++RL  +     II  +GL D E D +  F V   D      ++   + I + D ND  P I I    L I +N ++        GT V  +++SDRD  E N  + C     +    PF   P    ++ +N  + K +        L+ ERI   R  ++    G    N  L+ T +L V + D+NDN P F+ ++  + F E+N     +  V+ATD D G N+ + Y I+ES+    F+I+S +G I      DRE+++ Y   + A D G PS   T  V I + DRNDN P+ ++S   FSV EN    L P+G +   D D  EN ++    + P  G F I    GTI + +SFDREKE  Y  RL+  D G +  + +YV + I +LD NDN+P   +P    S      P++ P TP+E+            +KA D+DA  N ++ Y++    P G+   F+I  + GEIK++Q  +    G +R+ V  SD G PP
Sbjct:   48 EQPPNTLIGSLAADLG--------LPDSGHL-YKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSD-----CRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPE-NTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD-TVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGE-NAVVTCV----VAGDVPFQLRP---ASESAN--DRKRKYFLQTTTLLDYERIKDYRIEIVAVDSG----NPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENM-PPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAG-DPPRSSYVGVTINVLDENDNAPYVTKPAN--SSYTHLKPSSPPDTPVEV------------VKAEDIDAGVNAELYYTITGGNPHGL---FQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPP 783          
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 257.684 bits (657), Expect = 1.580e-70
Identity = 237/779 (30.42%), Postives = 355/779 (45.57%), Query Frame = 3
Query:  330 TTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTC----TVNVWD--ENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEE--FFRLNI-DSKTGK-PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHLFVVEVFDGVYAAS--TTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPP 2573
            T IGS + D          L  S  L YK      Y  +  K+G I TT+  ID E + D     C++      C     V+V D  +N    +I      +D NDN P FP    T    E N +      +P A D D +E+N    Y L    +    F L + D + GK P ++VL NLD E + ++ + ++A + G  ++ SQ +++  V D NDN P F   +Y   + EN+P+  ++ +++A D D      + Y L  +V    + L + +  G I +   LD  EI+ +  +VV    G    S  T + I+VTD ND  P + I    L         I E++  GT V  +++SD+D  E N  + C     +    PF   P    T ++     K +        L+ ER+   R  ++    G    N  L+ T +L V + DVNDN PVF+ +I+ + F E N     I  V ATD D G N+ + Y+I+  +     F+ID  +G + A    DRE  + Y   + A D G+P    T  V I + D NDN P+ ++S   FSV EN    L P+G +   D D  EN  +   +  P  G F +    GTI + +SFDREKE  Y  RL+  D G E  + +YV + I +LD NDN P   +P     R              +LS    P   +  ++A DLD+  N  + +S  I  G P + F I    GEI +++ ++R   G +R+ V  SD G PP
Sbjct:   36 TLIGSLAAD--------HGLPDSGHL-YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRD-----CRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPE-NTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGE-NAVVTCV----VAGDVPFQLRPASDSTSDN-----KRKYFLQTTTPLDYERVKEYRVEIVAVDSG----NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMP-PLSPVGMVTVLDMDKGENAHVHLSV-EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR--------------QLSPVASPDSHVDVVEAEDLDSGPNADLVFS--IAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPP 765          

HSP 2 Score: 132.88 bits (333), Expect = 6.484e-31
Identity = 163/610 (26.72%), Postives = 260/610 (42.62%), Query Frame = 3
Query:  930 KFEVLDFNDNEPFFNQSTYVITIPENT--------PLSTNIYKIEAIDPDKTARLSYRLDNSVKLA-IRRLFLVQEEGW----IILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFH----PDPS---ITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVF----------TESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKI----DSVSG-----WINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSV---EENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            + EV D NDN P F  S   I++PENT        PL+T+       D ++     Y L      A +  L +  + G     +I+   LD E+   +   ++  DG      +   + + VTD ND +P       +  + EN   G  V Q+K  D D +  NG+I             ++ H    P P    I + + I  +K     DREE      I+ +   ++    G    +++  +T    + + D NDN P            +E I NI   E+  +   +  V  +DKDEG+N+ +T  +     F++    DS S      ++      D E +  Y V I A D GNP+L++T  + + + D NDN P + S + F V   EEN+      I  + A D D   N E+ ++++     KG F+I PN G + A+   DRE ++RY  R+  +D G    + T   + IK+LD NDN P+FM   Y  S  +N+      P +P+ +            +  +D+D  +N  +  S++   G    F +    G I  S +  R    SY   + A D G PP S    + IN+ D
Sbjct:  119 RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDR------DSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD-MGPNGEI------------EYSLHQAVDPVPKLLRIDRTTGIIYVKG--PLDREE------INSLSFYVVARDKGPQPKSSKTFVT----IEVTDQNDNAPAVEIRGIGLVTHSEGIANI--SEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSP-VFSPTIFEVDFAEENQPGET--ILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTAT-VVIKVLDCNDNDPKFMLSGYSFSVLENMP-----PLSPVGM------------VTVLDMDKGENAHVHLSVEPDGG---KFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLD 671          

HSP 3 Score: 95.5153 bits (236), Expect = 2.094e-19
Identity = 137/525 (26.10%), Postives = 206/525 (39.24%), Query Frame = 3
Query:  432 KYFSLTEKSGTITTKSTIDLEEICDNN---EANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFK---FKTHRESEINLLRDR----KIYLPQAIDNDVTEKNRKILYELHQNEEEF-FRLNIDSKTG---KPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHA---HIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITI 1928
            K   +   +G I  K  +D EEI   +    A  K  QP  + T        F+ I  T     D+NDN P    +     TH E   N+  D      + L Q  D D  E    ++  +   +  F  R   DS +    K F+     LD E    + V + A + G     S   +K +V D NDN P F+ + + +   E       I  + A D D    A L Y +       I+ LF +    G +     LD E  + + F V   D    V+  + T+ IKV D ND  P   ++    ++ EN+   + VG + + D D  E        EPDG                 ++    I S I+FDRE+    E  +  R   L   DG G       +  T++VL  D NDN PV T+   N  F + + + +   H+  V A D D G N+ + + I   N    F+I   SG I   K   R+    + + ++  D G P  + T  V+I +
Sbjct:  292 KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKT--------FVTIEVT-----DQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD--EGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSY--IKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK------------FVVQNGTGTILSSISFDREK----ESSYTFR---LKAVDG-GEPPRSSYVGVTINVL--DENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 4 Score: 90.1225 bits (222), Expect = 1.131e-17
Identity = 97/361 (26.87%), Postives = 154/361 (42.66%), Query Frame = 3
Query: 1620 IEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFK-------IDSVSGWINAMKIF---DREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDLMW-----PHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQ-ETYVHLCIKILDVNDNSP--QFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIP-GQILVTIKAIDLDADKNGKISYSLK--IPLGVPRYFEIDRDGGEIKVSQTLSRSD---IGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            ++D+NDN P F  S+  I   EN  + A     LATD+D  +N    Y +    D          D   G +  + +    DRE  D Y +TIKA D GNP   +   + + + D NDN P+    S +  V EN      P+G+    +KA D D+  NGEI + L       P     D T  G IY K   DRE+ +     +   D G + K  +T+V   I++ D NDN+P  +      +   + IA  +            ++P G  +  ++  D D  +N  ++  +   +P  +    +   D       QT +  D   +  YR+ ++A D+G P LS    L + + D+
Sbjct:  122 VQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENS-----PVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRT-TGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFV--TIEVTDQNDNAPAVEIRGIGLVTHSEGIANISE-----------DMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDV 463          
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 258.07 bits (658), Expect = 1.706e-70
Identity = 205/718 (28.55%), Postives = 345/718 (48.05%), Query Frame = 3
Query:  468 TTKSTIDLEEICDNN---EANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGK--PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLF-LVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYA-ASTTICIKVTDINDETPNIH----INPSKLTI--KENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDI-LESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVP 2570
            TT + ID E++C  +   +A C  +   +         N +  +I    + +D NDN P+FP         E N L + +  +P A D D T  N    YEL   +  F    +++  G+  P ++V +NLD E +  + + ++  + G  +K S  +++  V D NDN+P F ++   + IPEN+P+ T++ +++A D D    A + Y     V  A +RLF L    G I + R LD E   +H   V   DG  + A  T+ I VTD+ND  PNI     I+P   T+   E     T +  I +SD+D+ ++NGK+ C+    +    PF      ++     + E  + + ++  +  N +         ++ SD   +    L  T  + V +ED NDN P+FT+ +  +  MENN     +  + ATD+D G+N+ I Y +   ++ F +D  +G + A ++FDRE+ D ++ T+ A+D+G P L     V +T+ D NDN P+   +   F V EN       +G +   D D  EN  I   ++  ++ +     +G I + VSFDRE++  Y   +R  D+G+     +   + I ++DVNDN+P  + P           P+N     + LS   IPG ++  + A+D D   N ++ Y++ +       F ID   G I + +  + +DIG +R+ V  SD G P
Sbjct:   87 TTSNRIDREKLCPGSSFEDAECSFEIEVVVL------PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPE-NTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDT-DINGKVICF----IEKDVPFHLK---AVYDNQYLLETSALLDYEGTKEYNFK---------IVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLP-KYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRP-PCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLS--SIPGSVVAEVFAVDSDTGMNAELKYTI-VSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 258.455 bits (659), Expect = 6.195e-70
Identity = 238/784 (30.36%), Postives = 356/784 (45.41%), Query Frame = 3
Query:  315 ETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTI-TTKSTIDLEEICDNNEANCKADQPTMTC----TVNVWD--ENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEE--FFRLNI-DSKTGK-PFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPD--KTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDY-EIDQMHLFVVEVFDGVYAAS--TTICIKVTDINDETPNIHINPSKLT--------IKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESND----FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQ-LISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDIT-PNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVP-RYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPP 2573
            E    T IGS + D          L  S  L YK      Y  +  K+G I TT+  ID E + D     C++      C     V+V D  +N    +I      +D NDN P FP    T    E N +      +P A D D +E+N    Y L    +    F L + D + GK P ++VL NLD E + ++ + ++A + G  ++ SQ +++  V D NDN P F   +Y   + EN+P+  ++ +++A D D      + Y L  +V    + L + +  G I +   LD  EI+ +  +VV    G    S  T + I+VTD ND  P + I    L         I E++  GT V  +++SD+D  E N  + C     +    PF   P    T ++     K +        L+ ER+   R  ++    G    N  L+ T +L V + DVNDN PVF+ +I+ + F E N     I  V ATD D G N+ + Y+I+  +     F+ID  +G + A    DRE  + Y   + A D G+P    T  V I + D NDN P+ ++S   FSV EN    L P+G +   D D  EN  +   +  P  G F +    GTI + +SFDREKE  Y  RL+  D G E  + +YV + I +LD NDN P   +P     R              +LS    P   +  ++A DLD+  N  + +S  I  G P + F I    GEI +++ ++R   G +R+ V  SD G PP
Sbjct:  108 EQPPNTLIGSLAAD--------HGLPDSGHL-YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRD-----CRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPE-NTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGE-NAVVTCV----VAGDVPFQLRPASDSTSDN-----KRKYFLQTTTPLDYERVKEYRVEIVAVDSG----NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMP-PLSPVGMVTVLDMDKGENAHVHLSV-EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR--------------QLSPVASPDSHVDVVEAEDLDSGPNADLVFS--IAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPP 842          

HSP 2 Score: 134.035 bits (336), Expect = 4.041e-31
Identity = 165/612 (26.96%), Postives = 261/612 (42.65%), Query Frame = 3
Query:  930 KFEVLDFNDNEPFFNQSTYVITIPENT--------PLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQ---EEGW----IILNRGLDYEIDQMHLFVVEVFDGVYA---ASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFH----PDPS---ITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVF----------TESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKI----DSVSG-----WINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSV---EENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPH--KGYFDITPN-GTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLS-RDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLAD 2612
            + EV D NDN P F  S   I++PENT        PL+T+       D ++     Y L      A   LF +Q   + G     +I+   LD E+   +   ++  DG      +   + + VTD ND +P       +  + EN   G  V Q+K  D D +  NG+I             ++ H    P P    I + + I  +K     DREE      I+ +   ++    G    +++  +T    + + D NDN P            +E I NI   E+  +   +  V  +DKDEG+N+ +T  +     F++    DS S      ++      D E +  Y V I A D GNP+L++T  + + + D NDN P + S + F V   EEN+      I  + A D D   N E+ ++++     KG F+I PN G + A+   DRE ++RY  R+  +D G    + T   + IK+LD NDN P+FM   Y  S  +N+      P +P+ +            +  +D+D  +N  +  S++   G    F +    G I  S +  R    SY   + A D G PP S    + IN+ D
Sbjct:  196 RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDR------DSERNGVADYALTAGPDAAT--LFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD-MGPNGEI------------EYSLHQAVDPVPKLLRIDRTTGIIYVKG--PLDREE------INSLSFYVVARDKGPQPKSSKTFVT----IEVTDQNDNAPAVEIRGIGLVTHSEGIANI--SEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSP-VFSPTIFEVDFAEENQPGET--ILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTAT-VVIKVLDCNDNDPKFMLSGYSFSVLENMP-----PLSPVGM------------VTVLDMDKGENAHVHLSVEPDGG---KFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLD 748          

HSP 3 Score: 96.6709 bits (239), Expect = 1.067e-19
Identity = 137/525 (26.10%), Postives = 206/525 (39.24%), Query Frame = 3
Query:  432 KYFSLTEKSGTITTKSTIDLEEICDNN---EANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFK---FKTHRESEINLLRD----RKIYLPQAIDNDVTEKNRKILYELHQNEEEF-FRLNIDSKTG---KPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKT--ARLSYRLDNSVKLAIRRLFLVQEE-GWIILNRGLDYEIDQMHLFVVEVFDG---VYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHA---HIHQVLATDKDEGQNSRITYDILESND---FKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITI 1928
            K   +   +G I  K  +D EEI   +    A  K  QP  + T        F+ I  T     D+NDN P    +     TH E   N+  D      + L Q  D D  E    ++  +   +  F  R   DS +    K F+     LD E    + V + A + G     S   +K +V D NDN P F+ + + +   E       I  + A D D    A L Y +       I+ LF +    G +     LD E  + + F V   D    V+  + T+ IKV D ND  P   ++    ++ EN+   + VG + + D D  E        EPDG                 ++    I S I+FDRE+    E  +  R   L   DG G       +  T++VL  D NDN PV T+   N  F + + + +   H+  V A D D G N+ + + I   N    F+I   SG I   K   R+    + + ++  D G P  + T  V+I +
Sbjct:  369 KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKT--------FVTIEVT-----DQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD--EGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSY--IKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK------------FVVQNGTGTILSSISFDREK----ESSYTFR---LKAVDG-GEPPRSSYVGVTINVL--DENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 4 Score: 90.5077 bits (223), Expect = 9.621e-18
Identity = 97/361 (26.87%), Postives = 154/361 (42.66%), Query Frame = 3
Query: 1620 IEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFK-------IDSVSGWINAMKIF---DREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSS-DFSVEENRNVSLGPIGY----LKAKDDDIAENGEIRFDLMW-----PHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQ-ETYVHLCIKILDVNDNSP--QFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIP-GQILVTIKAIDLDADKNGKISYSLK--IPLGVPRYFEIDRDGGEIKVSQTLSRSD---IGSYRIHVIASDNGVPPLSDIKVLLINLADI 2615
            ++D+NDN P F  S+  I   EN  + A     LATD+D  +N    Y +    D          D   G +  + +    DRE  D Y +TIKA D GNP   +   + + + D NDN P+    S +  V EN      P+G+    +KA D D+  NGEI + L       P     D T  G IY K   DRE+ +     +   D G + K  +T+V   I++ D NDN+P  +      +   + IA  +            ++P G  +  ++  D D  +N  ++  +   +P  +    +   D       QT +  D   +  YR+ ++A D+G P LS    L + + D+
Sbjct:  199 VQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENS-----PVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRT-TGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFV--TIEVTDQNDNAPAVEIRGIGLVTHSEGIANISE-----------DMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDV 540          
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Match: SMESG000036217.1 (SMESG000036217.1)

HSP 1 Score: 2211.42 bits (5729), Expect = 0.000e+0
Identity = 1105/1108 (99.73%), Postives = 1107/1108 (99.91%), Query Frame = 3
Query:  228 MFFGFXXXXXXXXXXXXXXENYQTSFIVYETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFSRGQRYESSFDNQSKNLDHLNDLELLSNLDKQYGDFHPNLSDEFENRTLIIPSSIYEQTNYRIYPSPSLKERNFHLWPQNENIIGLNPNRTIVQDTGHRLHPEINYGTLQSFSLNRMPNRSAPLCIHNRCISPYNNNNDTLLSTINDEHQXXXXXXXXXXXIVMSLTANSRYNANNGIKKVNQIYSKTVHTCNKFQEPSKDSLTTVGEEKDPQSSFEDQINHSNAAENEKEDLTLLCDKINDLFFNNVA 3551
            MFFGFSIILLINLSVVLTIENYQTSFIVYETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKE+KSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQ+KISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFSRGQRYESSFDNQSKN DHLNDLELLSNLDKQYGDFHPNLSDEFENRTLIIPSSIYEQTNYRIYPSPSLKERNFHLWPQNENIIGLNPNRTIVQDTGHRLHPEINYGTLQSFSLNRMPNRSAPLCIHNRCISPYNNNNDTLLSTINDEHQSDSGRGGSDDDIVMSLTANSRYNANNGIKKVNQIYSKTVHTCNKFQEPSKDSLTTVGEEKDPQSSFEDQINHSNAAENEKEDLTLLCDKINDLFFNNVA
Sbjct:    1 MFFGFSIILLINLSVVLTIENYQTSFIVYETSVKTTIGSFSTDLSYQFFRSKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKERKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQVKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFSRGQRYESSFDNQSKNHDHLNDLELLSNLDKQYGDFHPNLSDEFENRTLIIPSSIYEQTNYRIYPSPSLKERNFHLWPQNENIIGLNPNRTIVQDTGHRLHPEINYGTLQSFSLNRMPNRSAPLCIHNRCISPYNNNNDTLLSTINDEHQSDSGRGGSDDDIVMSLTANSRYNANNGIKKVNQIYSKTVHTCNKFQEPSKDSLTTVGEEKDPQSSFEDQINHSNAAENEKEDLTLLCDKINDLFFNNVA 1108          
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 330/844 (39.10%), Postives = 499/844 (59.12%), Query Frame = 3
Query:  285 ENYQTSFIVYE-TSVKTTIGSFSTDLSYQFFRSK---RLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC-DNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIIL-NRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHG--TNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVS-LGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFG-STNNVLIVVVLSGISAILVVVLITVISCMLNPCRN 2786
            E +  ++ + E T+V+T IG+ S DL Y  F++    ++F +  + Y     + YF L+ K+G +  KS ID++EIC  +++  CK+D  ++   VN+W     +A+I  V    D NDN P FP    T   +EIN    RKI+LPQAID D++EK  KI Y L     +F  L +     KP++ +LK+ D E   ++T +L+AWN  M + ++ + +  EVLDFNDNEP F  S   + I ENTPL++ I+++ A D DKTA+++Y +D+S    +R +F V+  G + L ++ LDYE    +   V V DG+Y+ +  + I + ++NDE P   +NPS L + E    G  +GQ+ I D D   VNGKI C EP  ++  Q   FH   +   + N++EIK++ ++DRE    +        A+LIC+DG G  + + +LT T  +SV +ED+NDN P F   +Y+    EN+   A   QV A DKD G N+ IT+ +L++ DFKID++SGWI+A   FDRE  ++Y++ +  +D G+P L++T  VNITI D NDN P+L  + D ++ EN+ V+ L  +  L  +D D  ENG + F  +WP+   F +T NG+I+    FDRE +DRYC+ +R+ D+G + +  +   +CIKILD NDN P    P  LL  DNI GPT+AP  PI LS+YE PG  LVTI+A D D   NG + +SL  PLG+P+ F+I  + G++ ++QTLS  DIG +R+ +   D G P L   +V +I + D PP         +  P    ++     N+L+V++LS +S IL+V+LIT I C+L PCR+
Sbjct:   25 ERFSLTYTIQENTAVETLIGTVSVDL-YDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICVKSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDF-ELQV-GHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIICNEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSLLDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMPKLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPS-----SEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRD 860          
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 330/844 (39.10%), Postives = 499/844 (59.12%), Query Frame = 3
Query:  285 ENYQTSFIVYE-TSVKTTIGSFSTDLSYQFFRSK---RLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC-DNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIIL-NRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHG--TNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVS-LGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFG-STNNVLIVVVLSGISAILVVVLITVISCMLNPCRN 2786
            E +  ++ + E T+V+T IG+ S DL Y  F++    ++F +  + Y     + YF L+ K+G +  KS ID++EIC  +++  CK+D  ++   VN+W     +A+I  V    D NDN P FP    T   +EIN    RKI+LPQAID D++EK  KI Y L     +F  L +     KP++ +LK+ D E   ++T +L+AWN  M + ++ + +  EVLDFNDNEP F  S   + I ENTPL++ I+++ A D DKTA+++Y +D+S    +R +F V+  G + L ++ LDYE    +   V V DG+Y+ +  + I + ++NDE P   +NPS L + E    G  +GQ+ I D D   VNGKI C EP  ++  Q   FH   +   + N++EIK++ ++DRE    +        A+LIC+DG G  + + +LT T  +SV +ED+NDN P F   +Y+    EN+   A   QV A DKD G N+ IT+ +L++ DFKID++SGWI+A   FDRE  ++Y++ +  +D G+P L++T  VNITI D NDN P+L  + D ++ EN+ V+ L  +  L  +D D  ENG + F  +WP+   F +T NG+I+    FDRE +DRYC+ +R+ D+G + +  +   +CIKILD NDN P    P  LL  DNI GPT+AP  PI LS+YE PG  LVTI+A D D   NG + +SL  PLG+P+ F+I  + G++ ++QTLS  DIG +R+ +   D G P L   +V +I + D PP         +  P    ++     N+L+V++LS +S IL+V+LIT I C+L PCR+
Sbjct:   25 ERFSLTYTIQENTAVETLIGTVSVDL-YDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICVKSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDF-ELQV-GHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIICNEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSLLDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMPKLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPS-----SEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRD 860          
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 330/844 (39.10%), Postives = 499/844 (59.12%), Query Frame = 3
Query:  285 ENYQTSFIVYE-TSVKTTIGSFSTDLSYQFFRSK---RLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC-DNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIIL-NRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHG--TNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVS-LGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFG-STNNVLIVVVLSGISAILVVVLITVISCMLNPCRN 2786
            E +  ++ + E T+V+T IG+ S DL Y  F++    ++F +  + Y     + YF L+ K+G +  KS ID++EIC  +++  CK+D  ++   VN+W     +A+I  V    D NDN P FP    T   +EIN    RKI+LPQAID D++EK  KI Y L     +F  L +     KP++ +LK+ D E   ++T +L+AWN  M + ++ + +  EVLDFNDNEP F  S   + I ENTPL++ I+++ A D DKTA+++Y +D+S    +R +F V+  G + L ++ LDYE    +   V V DG+Y+ +  + I + ++NDE P   +NPS L + E    G  +GQ+ I D D   VNGKI C EP  ++  Q   FH   +   + N++EIK++ ++DRE    +        A+LIC+DG G  + + +LT T  +SV +ED+NDN P F   +Y+    EN+   A   QV A DKD G N+ IT+ +L++ DFKID++SGWI+A   FDRE  ++Y++ +  +D G+P L++T  VNITI D NDN P+L  + D ++ EN+ V+ L  +  L  +D D  ENG + F  +WP+   F +T NG+I+    FDRE +DRYC+ +R+ D+G + +  +   +CIKILD NDN P    P  LL  DNI GPT+AP  PI LS+YE PG  LVTI+A D D   NG + +SL  PLG+P+ F+I  + G++ ++QTLS  DIG +R+ +   D G P L   +V +I + D PP         +  P    ++     N+L+V++LS +S IL+V+LIT I C+L PCR+
Sbjct:   34 ERFSLTYTIQENTAVETLIGTVSVDL-YDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICVKSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDF-ELQV-GHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIICNEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSLLDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMPKLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPS-----SEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRD 869          
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 331/854 (38.76%), Postives = 500/854 (58.55%), Query Frame = 3
Query:  285 ENYQTSFIVYE-TSVKTTIGSFSTDLSYQFFRSK---RLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEIC-DNNEANCKADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIIL-NRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHG--TNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVT----------IKAQDHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVS-LGPIGYLKAKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAPTTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFG-STNNVLIVVVLSGISAILVVVLITVISCMLNPCRN 2786
            E +  ++ + E T+V+T IG+ S DL Y  F++    ++F +  + Y     + YF L+ K+G +  KS ID++EIC  +++  CK+D  ++   VN+W     +A+I  V    D NDN P FP    T   +EIN    RKI+LPQAID D++EK  KI Y L     +F  L +     KP++ +LK+ D E   ++T +L+AWN  M + ++ + +  EVLDFNDNEP F  S   + I ENTPL++ I+++ A D DKTA+++Y +D+S    +R +F V+  G + L ++ LDYE    +   V V DG+Y+ +  + I + ++NDE P   +NPS L + E    G  +GQ+ I D D   VNGKI C EP  ++  Q   FH   +   + N++EIK++ ++DRE    +        A+LIC+DG G  + + +LT T  +SV +ED+NDN P F   +Y+    EN+   A   QV A DKD G N+ IT+ +L++ DFKID++SGWI+A   FDRE  ++Y+V+          +  +D G+P L++T  VNITI D NDN P+L  + D ++ EN+ V+ L  +  L  +D D  ENG + F  +WP+   F +T NG+I+    FDRE +DRYC+ +R+ D+G + +  +   +CIKILD NDN P    P  LL  DNI GPT+AP  PI LS+YE PG  LVTI+A D D   NG + +SL  PLG+P+ F+I  + G++ ++QTLS  DIG +R+ +   D G P L   +V +I + D PP         +  P    ++     N+L+V++LS +S IL+V+LIT I C+L PCR+
Sbjct:   25 ERFSLTYTIQENTAVETLIGTVSVDL-YDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICVKSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDF-ELQV-GHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIICNEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSLLDNEDFKIDAISGWISAKHTFDRETKNYYLVSRRDNNYTFINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMPKLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPS-----SEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRD 870          
The following BLAST results are available for this feature:
BLAST of Protocadherin gamma-B5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y3.594e-7527.45protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.655e-7527.45protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.904e-7527.45protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.904e-7527.45protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.909e-7427.37protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh-36.121e-4127.19Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
fmi-11.374e-3927.11FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.666e-3426.84FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-14.655e-3126.05CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-14.583e-2824.86Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.269e-4926.35gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.269e-4926.35gene:FBgn0284247 transcript:FBtr0343249[more]
kug6.886e-4626.44gene:FBgn0261574 transcript:FBtr0346077[more]
kug6.886e-4626.44gene:FBgn0261574 transcript:FBtr0332721[more]
kug7.373e-4626.44gene:FBgn0261574 transcript:FBtr0332722[more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh97.440e-7328.85protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh91.035e-7228.85protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh91.035e-7228.85protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.11.845e-7228.85pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh1a3.192e-7229.51protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa7.822e-7228.65VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
pcdh171.718e-6528.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.325e-6528.92protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.460e-6528.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.490e-6528.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x2.191e-7428.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x2.534e-7428.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x6.629e-7428.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x9.984e-7428.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x9.984e-7428.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZA8|PC11Y_HUMAN1.877e-7327.37Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA4.847e-7327.23Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR5.023e-7327.23Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q9BZA7|PC11X_HUMAN1.559e-7227.11Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6X862|PC11X_GORGO2.883e-7227.47Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YQG73.194e-12631.40Protocadherin gamma-B5 OS=Fasciola gigantica OX=46... [more]
A0A4E0RUL61.556e-12431.06Protocadherin gamma-B5 OS=Fasciola hepatica OX=619... [more]
A0A4S2K5U72.271e-12230.57Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7GEZ63.916e-11931.59Protocadherin alpha-2 OS=Clonorchis sinensis OX=79... [more]
A0A4E0RI731.818e-11729.43Protocadherin gamma-B5 OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.011e-7230.15protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a6.397e-7230.15protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh114.410e-6927.74protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.502e-6827.74protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh96.845e-6827.81protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh116.707e-5628.20protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000006996.12.993e-5327.08pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.11.345e-4926.36pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.19.046e-4426.44protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000004042.12.062e-4126.15pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.606e-5627.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392301.977e-4926.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303642.530e-4927.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354125.459e-4528.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333595.666e-4526.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin gamma-B5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.158e-7130.22protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b5.764e-7129.99protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a1.580e-7030.42protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh91.706e-7028.55protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a6.195e-7030.36protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin gamma-B5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036217.10.000e+099.73SMESG000036217.1[more]
SMESG000016762.10.000e+039.10SMESG000016762.1[more]
SMESG000016762.10.000e+039.10SMESG000016762.1[more]
SMESG000016762.10.000e+039.10SMESG000016762.1[more]
SMESG000016762.10.000e+038.76SMESG000016762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007727 ID=SMED30007727|Name=Protocadherin gamma-B5|organism=Schmidtea mediterranea sexual|type=transcript|length=3898bp
CCGATCTGACGTGCTCGTAGAAATATGTTGGGGAAATTAATTTAATTTCA
TTGGAACAACAAAAACTAATGCTTAACAAACGAGCGAAAATTTTAAAATC
TTACAAAGACAATATATCAGCCTGTGATTGCATTATCCCATTGAACTGTG
CACCAATAATTGATAAGGTTTATCAAAAACCTATTATAAAATAGTCGGCA
AAAAACTCAAAATTAAATTTAATAATTATGTTTTTCGGATTTTCAATCAT
ATTACTGATAAACTTATCAGTAGTGCTCACAATAGAAAATTATCAAACCA
GCTTTATTGTGTATGAGACTTCTGTGAAAACCACAATTGGATCTTTTTCG
ACAGATTTGTCGTATCAGTTTTTCCGTTCGAAACGATTGTTTAAGAGTAC
TCAATTGAGATACAAATTCAGCAAGGAAAACAAATATTTTTCATTGACGG
AAAAATCCGGAACGATTACAACAAAATCAACAATTGATCTGGAGGAAATT
TGCGACAACAATGAGGCCAACTGCAAAGCGGATCAACCGACAATGACGTG
CACAGTCAACGTTTGGGATGAGAACTCATTTCTTGCGATCATTACAACGG
TTTTCTTGTTTGAAGACGAAAACGACAATGTTCCCGTTTTTCCTTTCAAA
TTCAAAACCCACCGAGAAAGCGAAATTAATCTGTTGAGAGATCGGAAAAT
CTATTTGCCACAAGCAATAGACAACGATGTTACAGAGAAAAACCGAAAAA
TTCTGTACGAACTCCATCAAAACGAGGAAGAGTTTTTTCGGTTGAATATT
GACTCAAAAACTGGAAAACCCTTTGTTGTTGTGTTGAAAAACTTGGACGC
CGAATCTCAATCTAATCATACGGTGATTTTAGAAGCTTGGAATGAAGGGA
TGAAAGAGAAGAAATCGCAAATTGTTATCAAATTCGAAGTTCTAGATTTT
AATGACAATGAGCCGTTTTTCAACCAGTCTACATATGTCATCACAATTCC
TGAGAACACTCCTTTATCAACAAATATTTATAAAATTGAAGCCATTGATC
CTGACAAAACTGCAAGATTATCATACAGGTTAGACAATTCTGTGAAGCTG
GCCATCAGACGTTTATTCCTCGTTCAAGAAGAAGGGTGGATTATTTTGAA
TCGAGGCCTTGATTATGAAATAGACCAAATGCACTTGTTTGTCGTAGAAG
TATTTGATGGAGTCTATGCTGCCAGTACAACGATCTGCATAAAGGTCACT
GATATTAATGATGAAACTCCAAACATACATATAAATCCTTCAAAACTGAC
AATAAAAGAAAATTTAATTTCTGGGACTTTTGTTGGTCAAATTAAAATAT
CAGATCGTGACAGTGTTGAGGTAAATGGAAAAATTTGTTGTTATGAACCA
GATGGAATGAATAATCTTCAACCTTTCACCTTTCATCCAGATCCGTCAAT
AACGCAAGAATCAAATATATTTGAAATTAAATCTCGGATCACATTTGATC
GGGAAGAGTTTTTGAATAACGAAAGAATTCATCCAATTCGCACGGCGTTG
TTAATTTGCTCGGATGGCCATGGAACAAATAACGCTCAACTAACAATAAC
GTTTACATTATCTGTTTTGATTGAAGATGTAAACGACAACAGACCTGTTT
TTACTGAATCAATCTATAATATATTTTTCATGGAAAATAATCATATACAT
GCTCATATTCACCAAGTACTTGCTACAGATAAAGATGAAGGCCAAAATTC
TAGAATAACTTACGATATTTTAGAGTCCAACGATTTCAAGATAGACTCAG
TTTCTGGATGGATAAATGCAATGAAAATATTTGATCGGGAAGAAATGGAT
CACTATGTAGTCACAATTAAAGCTCAAGATCACGGAAATCCTTCTTTAAA
TACAACGGTGAAGGTAAATATAACGATTGGAGATCGAAACGACAACCCCC
CTCAACTAATTTCATCGTCAGATTTCAGTGTAGAAGAAAACAGGAATGTA
TCATTGGGACCAATAGGATATTTAAAAGCCAAAGATGATGATATTGCCGA
GAATGGAGAAATAAGATTTGATTTAATGTGGCCACACAAAGGATATTTTG
ATATCACACCAAATGGAACAATATATGCTAAAGTTTCCTTTGATAGGGAA
AAAGAGGATAGGTATTGCATGAGACTAAGAATCAGTGACAATGGAAAAGA
GAATAAACAAGAAACATATGTTCACTTGTGTATTAAGATTCTTGATGTCA
ATGACAATTCTCCTCAATTCATGGAGCCCCCATATTTACTGTCTAGAGAC
AATATTGCGGGTCCAACAAATGCCCCAACAACTCCAATTGAATTGTCAAT
TTATGAAATTCCTGGACAAATACTTGTTACAATTAAAGCTATAGATTTAG
ATGCTGACAAAAATGGAAAGATTTCATATTCTTTAAAAATACCGTTAGGA
GTGCCGAGATATTTTGAAATAGATCGCGATGGAGGAGAGATTAAGGTTTC
TCAAACTTTATCTCGTAGTGACATTGGTTCTTATCGTATTCATGTCATAG
CGTCAGATAATGGCGTCCCACCTCTTAGTGATATAAAGGTGCTGCTTATT
AATTTGGCTGATATACCTCCCGGTCTTAACAACCAGAAAGGTAGCGATAT
CAATAGCCCAAAAACATGGCAGATGTTTGGATCAACAAATAATGTACTCA
TTGTTGTTGTTTTGTCAGGAATAAGTGCCATTCTCGTAGTAGTATTGATA
ACAGTTATTTCATGCATGTTAAACCCATGTCGAAATCACAATAGTCACAT
ATTTTCAAGGGGTCAAAGGTATGAATCGTCGTTTGATAATCAGAGTAAAA
ATCTTGATCATTTAAATGATCTAGAACTGTTGTCAAATTTAGATAAACAA
TATGGAGACTTTCATCCTAATTTGTCAGATGAATTTGAAAACAGAACTTT
AATTATTCCTAGCAGCATTTACGAACAAACAAATTATCGAATCTATCCAT
CTCCATCATTAAAAGAAAGAAACTTTCATCTATGGCCCCAAAATGAAAAT
ATAATTGGTCTTAATCCCAACCGAACAATCGTTCAAGACACGGGGCACAG
ACTGCACCCAGAAATCAATTACGGCACTTTGCAAAGTTTCTCCCTTAACA
GAATGCCCAACCGATCTGCACCTTTATGCATTCATAATAGATGCATTTCC
CCATACAATAATAACAATGACACTCTTCTTTCAACAATAAACGACGAACA
CCAGTCTGACAGTGGTCGTGGGGGTAGCGATGACGATATTGTCATGAGTC
TTACTGCCAATAGTCGTTACAATGCTAATAATGGAATAAAAAAAGTCAAT
CAAATATATAGCAAAACCGTGCATACTTGCAATAAATTTCAAGAGCCATC
TAAAGATTCTTTGACAACTGTTGGTGAGGAAAAAGACCCGCAGAGCTCAT
TCGAAGACCAAATTAATCATTCTAATGCCGCGGAAAATGAGAAAGAAGAT
TTAACATTACTTTGTGACAAAATAAACGATTTGTTTTTCAACAATGTTGC
TTGATCCACATTTTTTGATTGCATGAATCTGTGAATATCCTGTAAATATC
TTTTGTCTATTTGATTTTCTTATGCTTATTTTTTATGTAAAAATTTGTTT
TTGTGGACAATTTATTTCATTAACGACAAAAATATTAAATTAATTTAATT
ATTAAATGTAAAAATACTACTCATTTCAAATCTTTCAGGAAATGCCTTAC
TGGATTTGGGTCCCTTACAAAACAGTAAATGTATGTAAAACGTTATTTAA
TGAGTATTTTAGGAGAAGAAAGACTAAATAATGTAACCATTCTGTATATA
CAGCATAAAATTGTAAAATAAATTGACATTTTGCCAAAAATATCGACG
back to top

protein sequence of SMED30007727-orf-1

>SMED30007727-orf-1 ID=SMED30007727-orf-1|Name=SMED30007727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1109bp
MFFGFSIILLINLSVVLTIENYQTSFIVYETSVKTTIGSFSTDLSYQFFR
SKRLFKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCK
ADQPTMTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEI
NLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFV
VVLKNLDAESQSNHTVILEAWNEGMKEKKSQIVIKFEVLDFNDNEPFFNQ
STYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQ
EEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNI
HINPSKLTIKENLISGTFVGQIKISDRDSVEVNGKICCYEPDGMNNLQPF
TFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGT
NNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLAT
DKDEGQNSRITYDILESNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQ
DHGNPSLNTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGPIGYLK
AKDDDIAENGEIRFDLMWPHKGYFDITPNGTIYAKVSFDREKEDRYCMRL
RISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAP
TTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLKIPLGVPRYFEIDR
DGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGL
NNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNP
CRNHNSHIFSRGQRYESSFDNQSKNLDHLNDLELLSNLDKQYGDFHPNLS
DEFENRTLIIPSSIYEQTNYRIYPSPSLKERNFHLWPQNENIIGLNPNRT
IVQDTGHRLHPEINYGTLQSFSLNRMPNRSAPLCIHNRCISPYNNNNDTL
LSTINDEHQSDSGRGGSDDDIVMSLTANSRYNANNGIKKVNQIYSKTVHT
CNKFQEPSKDSLTTVGEEKDPQSSFEDQINHSNAAENEKEDLTLLCDKIN
DLFFNNVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 473..486
score: 34.46
coord: 525..551
score: 27.01
coord: 69..88
score: 24.95
coord: 663..680
score: 42.09
coord: 454..473
score: 42.8
coord: 248..277
score: 32.59
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 599..679
e-value: 5.1E-13
score: 59.2
coord: 372..473
e-value: 0.079
score: 15.1
coord: 161..246
e-value: 1.4E-9
score: 47.8
coord: 719..798
e-value: 1.6E-13
score: 60.9
coord: 49..136
e-value: 1.9
score: 0.9
coord: 270..348
e-value: 4.1E-10
score: 49.6
coord: 497..575
e-value: 1.2E-27
score: 107.8
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 156..238
e-value: 1.7E-7
score: 31.6
coord: 710..793
e-value: 5.3E-12
score: 46.0
coord: 480..567
e-value: 7.6E-21
score: 74.4
coord: 583..671
e-value: 5.3E-8
score: 33.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 577..678
e-value: 4.9E-18
score: 67.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 245..345
e-value: 8.7E-21
score: 76.5
coord: 471..576
e-value: 1.2E-29
score: 105.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 679..794
e-value: 2.4E-17
score: 65.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 26..122
e-value: 2.7E-8
score: 35.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 132..244
e-value: 3.2E-14
score: 55.3
coord: 346..470
e-value: 1.9E-10
score: 43.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1058..1078
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 20..576
coord: 535..1002
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 163..248
score: 16.272
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 476..577
score: 26.093
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 351..475
score: 13.597
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 712..813
score: 17.061
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 577..681
score: 20.371
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 20..138
score: 11.208
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 249..350
score: 19.45
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 252..345
e-value: 3.11689E-17
score: 75.8129
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 151..244
e-value: 3.43376E-11
score: 58.8641
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 479..573
e-value: 6.16244E-28
score: 106.629
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 703..796
e-value: 5.92753E-20
score: 83.9021
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 583..677
e-value: 1.04022E-14
score: 68.8793
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.871
NoneNo IPR availableTMHMMTMhelixcoord: 823..845
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 29..97
e-value: 1.2E-4
score: 21.8
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 565..575
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 463..473
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 669..679
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 571..681
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 242..342
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 343..467
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 669..796
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 463..584
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 132..248