Spo11

Overview
NameSpo11
Smed IDSMED30007726
Length (bp)1079
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spo11 (SMED30007726) t-SNE clustered cells

Violin plots show distribution of expression levels for Spo11 (SMED30007726) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007726

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30007726h1SMcG0014589 dd_Smed_v4_43889_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30007726h1SMcG0014589 dd_Smed_v4_43889_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spo11 vs. Ensembl Human
Match: SPO11 (SPO11 initiator of meiotic double stranded breaks [Source:HGNC Symbol;Acc:HGNC:11250])

HSP 1 Score: 147.517 bits (371), Expect = 1.399e-40
Identity = 93/278 (33.45%), Postives = 150/278 (53.96%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGI------------QNEKFYMTDSDVKLQV 986
            L ILS++++L+  N  +TKR+I+Y + +LF NQ  +D II  IS  + +SR  ++I ++SK LI G++         ++C      + + S                        +G++  KF+L+VEKDATFQ L+D NFC+  +P I+IT KG PDLN R L+     T  ++PVF LVDADP G+ I C +KYGS   S  +A+   + +  ++ +GLL +D+++L   K+ ++ L+  D+  L  I            + E   M DS +K ++
Sbjct:   77 LKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNI----------------------QGIRNAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADPHGIEIMCIYKYGSMSMS-FEAHHLTVPA--IRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEI 328          
BLAST of Spo11 vs. Ensembl Human
Match: SPO11 (SPO11 initiator of meiotic double stranded breaks [Source:HGNC Symbol;Acc:HGNC:11250])

HSP 1 Score: 142.895 bits (359), Expect = 1.027e-38
Identity = 93/282 (32.98%), Postives = 151/282 (53.55%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGI------------QNEKFYMTDSDVKLQV 986
            L ILS++++L+  N  +TKR+I+Y + +LF NQ  +D II  IS  + +SR  ++I ++SK LI G++         ++C      + + S                        +G++ +    KF+L+VEKDATFQ L+D NFC+  +P I+IT KG PDLN R L+     T  ++PVF LVDADP G+ I C +KYGS   S  +A+   + +  ++ +GLL +D+++L   K+ ++ L+  D+  L  I            + E   M DS +K ++
Sbjct:   77 LKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNI----------------------QGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADPHGIEIMCIYKYGSMSMS-FEAHHLTVPA--IRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEI 332          
BLAST of Spo11 vs. Ensembl Human
Match: SPO11 (SPO11 initiator of meiotic double stranded breaks [Source:HGNC Symbol;Acc:HGNC:11250])

HSP 1 Score: 142.895 bits (359), Expect = 1.768e-38
Identity = 93/282 (32.98%), Postives = 151/282 (53.55%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGI------------QNEKFYMTDSDVKLQV 986
            L ILS++++L+  N  +TKR+I+Y + +LF NQ  +D II  IS  + +SR  ++I ++SK LI G++         ++C      + + S                        +G++ +    KF+L+VEKDATFQ L+D NFC+  +P I+IT KG PDLN R L+     T  ++PVF LVDADP G+ I C +KYGS   S  +A+   + +  ++ +GLL +D+++L   K+ ++ L+  D+  L  I            + E   M DS +K ++
Sbjct:  115 LKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNI----------------------QGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADPHGIEIMCIYKYGSMSMS-FEAHHLTVPA--IRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEI 370          
BLAST of Spo11 vs. Ensembl Human
Match: SPO11 (SPO11 initiator of meiotic double stranded breaks [Source:HGNC Symbol;Acc:HGNC:11250])

HSP 1 Score: 132.88 bits (333), Expect = 7.752e-36
Identity = 76/200 (38.00%), Postives = 114/200 (57.00%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI--KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGS 782
            L ILS++++L+  N  +TKR+I+Y + +LF NQ  +D II  IS  + +SR  ++I ++SK LI G++         ++C      + + S                        +G+++   KF+L+VEKDATFQ L+D NFC+  +P I+IT KG PDLN R L+     T  ++PVF LVDADP G+ I C +KYGS
Sbjct:   93 LKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNI----------------------QGIRITDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADPHGIEIMCIYKYGS 269          
BLAST of Spo11 vs. Ensembl Human
Match: SPO11 (SPO11 initiator of meiotic double stranded breaks [Source:HGNC Symbol;Acc:HGNC:11250])

HSP 1 Score: 70.8626 bits (172), Expect = 1.522e-14
Identity = 38/75 (50.67%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  552 KFILVVEKDATFQNLIDRNFCSLFNPSILITA-----------KGFPDLNCRFLLNSRDSTIINIPVFCLVDADP 743
            KF+L+VEKDATFQ L+D NFC+  +P I+IT+           KG PDLN R L+     T  ++PVF LVDADP
Sbjct:   48 KFVLIVEKDATFQRLLDDNFCNKLSPCIMITSTPVFQHLKSKGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADP 121          
BLAST of Spo11 vs. Ensembl Celegans
Match: spo-11 (Meiotic recombination protein spo-11 [Source:UniProtKB/Swiss-Prot;Acc:Q22236])

HSP 1 Score: 106.686 bits (265), Expect = 9.076e-26
Identity = 78/258 (30.23%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  168 KRKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDV--------MLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPAD 917
            K K   +L  L  V+ LL  + +STKR ++Y +  ++ NQKYLD  I+ I + +  SR  +NI +  + +I G +        +++ RV E          + ++    FS                     +    FILVVEKD TFQ L+D NF ++F   IL T+KG+PD+  R +L    S     P++ L DADP G+ IY ++KYG  K    +     + +  ++ IGL  TD  +    +++ L L   D
Sbjct:   42 KGKLDRDLHCLHQVYDLLENDKRSTKRELYYEHKAVYGNQKYLDSSIKSICELLNESRANLNILSCGRGIIRGAITFLVENVGVIDARVQE----------VLITDALLFSNI-------------------ISEADFILVVEKDTTFQKLMDENFQAMFPRGILATSKGYPDIATRNVLKML-SEKRKFPIYGLFDADPHGIEIYLTYKYGPTK-EFAEGRGAFVPT--IEWIGLFPTDFHRFTIDQSQCLPLVRTD 266          
BLAST of Spo11 vs. Ensembl Celegans
Match: spo-11 (Meiotic recombination protein spo-11 [Source:UniProtKB/Swiss-Prot;Acc:Q22236])

HSP 1 Score: 107.071 bits (266), Expect = 1.132e-25
Identity = 78/258 (30.23%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  168 KRKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDV--------MLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPAD 917
            K K   +L  L  V+ LL  + +STKR ++Y +  ++ NQKYLD  I+ I + +  SR  +NI +  + +I G +        +++ RV E          + ++    FS                     +    FILVVEKD TFQ L+D NF ++F   IL T+KG+PD+  R +L    S     P++ L DADP G+ IY ++KYG  K    +     + +  ++ IGL  TD  +    +++ L L   D
Sbjct:   89 KGKLDRDLHCLHQVYDLLENDKRSTKRELYYEHKAVYGNQKYLDSSIKSICELLNESRANLNILSCGRGIIRGAITFLVENVGVIDARVQE----------VLITDALLFSNI-------------------ISEADFILVVEKDTTFQKLMDENFQAMFPRGILATSKGYPDIATRNVLKML-SEKRKFPIYGLFDADPHGIEIYLTYKYGPTK-EFAEGRGAFVPT--IEWIGLFPTDFHRFTIDQSQCLPLVRTD 313          
BLAST of Spo11 vs. Ensembl Fly
Match: mei-W68 (gene:FBgn0002716 transcript:FBtr0086461)

HSP 1 Score: 75.0998 bits (183), Expect = 6.951e-15
Identity = 63/228 (27.63%), Postives = 111/228 (48.68%), Query Frame = 3
Query:  195 ILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPS-ILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKL 875
            +LS VH+L ++    T R ++Y N  L  +Q  +      + + +  S + + I A+SK L+ GD+ L          L ++  +  SS +    +                     L +F+L+VEK++ F++L+ RN    F    ILIT KG+PD   R +++ R +    +  + LVDADPFG+ I   +++GSK  S   ++Q +  +  ++ IGL  ++I  L
Sbjct:   60 MLSRVHRLQVRGGSFTVRGLYYDNPLLVRSQSRIAEARLDVCRMLRTSPLSLGILAASKGLVAGDLRL----------LMTNGDVLDSSLYGGPLTLPTDPEKIDRIET--------LAEFVLIVEKESVFESLLSRNVFGTFERRFILITGKGYPDCCTRRIVH-RLTEENQLAAYILVDADPFGVEIMLVYRHGSKSMSF--SSQGLT-TPALRWIGLHPSEIPAL 265          
BLAST of Spo11 vs. Ensembl Zebrafish
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:ZFIN;Acc:ZDB-GENE-040426-1900])

HSP 1 Score: 135.191 bits (339), Expect = 6.494e-36
Identity = 92/292 (31.51%), Postives = 155/292 (53.08%), Query Frame = 3
Query:  123 FIIIDLLNPNNKHLIKRKTASE----LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSH---------NGIN--LSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
             ++ D ++P   H  K  +A++    L ILSI+++L+  +  +TKR+I+Y + +LF +Q+ LD I++ IS  + + R  ++I A+SK  I GD+         + C SS          NGI   +SS                              KFIL+VEKDATFQ L+D +FC+  +P I+IT KG PD+N R ++  +    +++PVF LVDADP G+ I C +KYGS   +  +A+   + S  +  +GLL +DI++ +     ++  + AD+R +  +++  +
Sbjct:   76 LVLKDDVSPKYLHCGKPTSATKFALILKILSIIYKLVQSDSYATKRDIYYNDPQLFGSQRMLDSIVDDISCMLKVPRRSLHILATSKGFISGDLCYLEEDGTKVDCNSSSTAVSVSSNVNGIRNIVSSA-----------------------------KFILIVEKDATFQRLLDDDFCARLSPCIIITGKGVPDVNSRLMVR-KLWDALHVPVFALVDADPHGIEIMCIYKYGSVSMA-FEAHSLTVPS--VLWLGLLPSDIQRYRVPDEALIPFAKADERKISSLRSRSY 334          
BLAST of Spo11 vs. Ensembl Xenopus
Match: spo11 (SPO11 meiotic protein covalently bound to DSB [Source:NCBI gene;Acc:493562])

HSP 1 Score: 155.606 bits (392), Expect = 3.036e-43
Identity = 91/265 (34.34%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L +LS++++L+  +  +TKR+I+Y +++L+ +Q  +D I+  +S  + + RI ++I ++SK  + GD+         ++C  S +G+                      ++ + +EG++ +    KFIL++EKDATFQ L+D NFC+   P ILIT KG PDLN R LL  +     +IP+F LVDADP+G+ I C +KYGS   S  +A+   + +  +  +GLL +D+E+L   K+ ++ LSP D+R L+ IQ   +
Sbjct:  109 QKFALMLKVLSVIYKLVQTDTYATKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGSSSGV----------------------LVPINVEGIRHLSTQAKFILIIEKDATFQRLLDDNFCARSGPCILITGKGVPDLNTR-LLTRKLWDSFHIPIFTLVDADPYGIEIMCIYKYGSISMS-YEAHHLTVPA--IAWLGLLPSDLERLFIPKDVLIPLSPLDRRKLLSIQKRPY 347          
BLAST of Spo11 vs. Ensembl Xenopus
Match: spo11 (SPO11 meiotic protein covalently bound to DSB [Source:NCBI gene;Acc:493562])

HSP 1 Score: 150.214 bits (378), Expect = 2.280e-41
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L +LS++++L+  +  +TKR+I+Y +++L+ +Q  +D I+  +S  + + RI ++I ++SK  + GD+         ++C  S + + L    T +                         KFIL++EKDATFQ L+D NFC+   P ILIT KG PDLN R LL  +     +IP+F LVDADP+G+ I C +KYGS   S  +A+   + +  +  +GLL +D+E+L   K+ ++ LSP D+R L+ IQ   +
Sbjct:  108 QKFALMLKVLSVIYKLVQTDTYATKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGS-SSVTLKDLSTQA-------------------------KFILIIEKDATFQRLLDDNFCARSGPCILITGKGVPDLNTR-LLTRKLWDSFHIPIFTLVDADPYGIEIMCIYKYGSISMS-YEAHHLTVPA--IAWLGLLPSDLERLFIPKDVLIPLSPLDRRKLLSIQKRPY 338          
BLAST of Spo11 vs. Ensembl Xenopus
Match: spo11 (SPO11 meiotic protein covalently bound to DSB [Source:NCBI gene;Acc:493562])

HSP 1 Score: 117.857 bits (294), Expect = 2.067e-29
Identity = 68/197 (34.52%), Postives = 114/197 (57.87%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFG 749
            +K A  L +LS++++L+  +  +TKR+I+Y +++L+ +Q  +D I+  +S  + + RI ++I ++SK  + GD+         ++C  S +G+                      ++ + +EG++ +    KFIL++EKDATFQ L+D NFC+   P ILIT KG PDLN R LL  +     +IP+F LVDADP+G
Sbjct:  109 QKFALMLKVLSVIYKLVQTDTYATKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGSSSGV----------------------LVPINVEGIRHLSTQAKFILIIEKDATFQRLLDDNFCARSGPCILITGKGVPDLNTR-LLTRKLWDSFHIPIFTLVDADPYG 282          
BLAST of Spo11 vs. Ensembl Xenopus
Match: spo11 (SPO11 meiotic protein covalently bound to DSB [Source:NCBI gene;Acc:493562])

HSP 1 Score: 77.7962 bits (190), Expect = 9.003e-16
Identity = 42/104 (40.38%), Postives = 64/104 (61.54%), Query Frame = 3
Query:  642 TAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            + KG PDLN R LL  +     +IP+F LVDADP+G+ I C +KYGS   S  +A+   + +  +  +GLL +D+E+L   K+ ++ LSP D+R L+ IQ   +
Sbjct:  122 SGKGVPDLNTR-LLTRKLWDSFHIPIFTLVDADPYGIEIMCIYKYGSISMS-YEAHHLTVPA--IAWLGLLPSDLERLFIPKDVLIPLSPLDRRKLLSIQKRPY 221          

HSP 2 Score: 53.9138 bits (128), Expect = 1.213e-7
Identity = 26/92 (28.26%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNG 446
            +K A  L +LS++++L+  +  +TKR+I+Y +++L+ +Q  +D I+  +S  + + RI ++I ++SK  + GD+         ++C  S +G
Sbjct:   32 QKFALMLKVLSVIYKLVQTDTYATKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGSSSG 123          
BLAST of Spo11 vs. Ensembl Mouse
Match: Spo11 (SPO11 meiotic protein covalently bound to DSB [Source:MGI Symbol;Acc:MGI:1349669])

HSP 1 Score: 146.362 bits (368), Expect = 2.650e-40
Identity = 88/261 (33.72%), Postives = 138/261 (52.87%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L +LS++++L+  +  +TKR+I+Y + +LF NQ  +D  I+ IS  + + R  +++ ++SK LI G++         + C  S     + +     Q                        KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP+G+ I C +KYGS   S    N  I     ++ +GLL +DI++L   K+ ++ L+  D+  L  I    +
Sbjct:   71 KKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDA------------------KFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDT-FHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTI---PTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPY 309          
BLAST of Spo11 vs. Ensembl Mouse
Match: Spo11 (SPO11 meiotic protein covalently bound to DSB [Source:MGI Symbol;Acc:MGI:1349669])

HSP 1 Score: 146.747 bits (369), Expect = 4.706e-40
Identity = 86/250 (34.40%), Postives = 135/250 (54.00%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADK 920
            +K A  L +LS++++L+  +  +TKR+I+Y + +LF NQ  +D  I+ IS  + + R  +++ ++SK LI G++         + C  S     + +     Q                        KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP+G+ I C +KYGS   S    N  I     ++ +GLL +DI++L   K+ ++ L+  D+
Sbjct:  109 KKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDA------------------KFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDT-FHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTI---PTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQ 336          
BLAST of Spo11 vs. Ensembl Mouse
Match: Spo11 (SPO11 meiotic protein covalently bound to DSB [Source:MGI Symbol;Acc:MGI:1349669])

HSP 1 Score: 137.502 bits (345), Expect = 7.342e-37
Identity = 88/274 (32.12%), Postives = 138/274 (50.36%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKR-------------NIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L +LS++++L+  +  +TKR             +I+Y + +LF NQ  +D  I+ IS  + + R  +++ ++SK LI G++         + C  S     + +     Q                        KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP+G+ I C +KYGS   S    N  I     ++ +GLL +DI++L   K+ ++ L+  D+  L  I    +
Sbjct:   71 KKFALILKVLSMIYKLIQSDTYATKRSNAHSVLTLHLHRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDA------------------KFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDT-FHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTI---PTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPY 322          
BLAST of Spo11 vs. UniProt/SwissProt
Match: sp|Q9WTK8|SPO11_MOUSE (Meiotic recombination protein SPO11 OS=Mus musculus OX=10090 GN=Spo11 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 3.292e-39
Identity = 86/250 (34.40%), Postives = 135/250 (54.00%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADK 920
            +K A  L +LS++++L+  +  +TKR+I+Y + +LF NQ  +D  I+ IS  + + R  +++ ++SK LI G++         + C  S     + +     Q                        KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP+G+ I C +KYGS   S    N  I     ++ +GLL +DI++L   K+ ++ L+  D+
Sbjct:  109 KKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDA------------------KFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDT-FHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTI---PTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQ 336          
BLAST of Spo11 vs. UniProt/SwissProt
Match: sp|Q9Y5K1|SPO11_HUMAN (Meiotic recombination protein SPO11 OS=Homo sapiens OX=9606 GN=SPO11 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.490e-38
Identity = 93/282 (32.98%), Postives = 151/282 (53.55%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGI------------QNEKFYMTDSDVKLQV 986
            L ILS++++L+  N  +TKR+I+Y + +LF NQ  +D II  IS  + +SR  ++I ++SK LI G++         ++C      + + S                        +G++ +    KF+L+VEKDATFQ L+D NFC+  +P I+IT KG PDLN R L+     T  ++PVF LVDADP G+ I C +KYGS   S  +A+   + +  ++ +GLL +D+++L   K+ ++ L+  D+  L  I            + E   M DS +K ++
Sbjct:  115 LKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNI----------------------QGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDT-FHVPVFTLVDADPHGIEIMCIYKYGSMSMS-FEAHHLTVPA--IRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEI 370          
BLAST of Spo11 vs. UniProt/SwissProt
Match: sp|P40384|SPO11_SCHPO (Meiotic recombination protein rec12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rec12 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 1.174e-25
Identity = 75/237 (31.65%), Postives = 117/237 (49.37%), Query Frame = 3
Query:  195 ILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTL 905
            +L  VH+ +I +   TKR+I+Y +++LF  Q  +D ++  IS  IG SR ++N+EAS+K L++G + +          L +   I  +     S      +                  K++LV+EK+A FQ L +         +I++TAKGFPDL  R  L      + +   F + D DP GL IY  FKYGS  +S    +Q  +R  N++L+G L  DI    F KN+  +L
Sbjct:   77 VLDCVHEAVISDTVITKRDIYYRDVDLFKRQTVVDELLGDISNTIGCSRSDLNVEASAKGLVFGSIHI---------ALENGTVITATKPLLISHHRISSITSTA--------------KWVLVIEKEAVFQTLTEEALAD----TIIVTAKGFPDLMTRKFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFKYGSNAYSHEPHSQ--LR--NLQLLGPLYEDI----FNKNQEFSL 278          
BLAST of Spo11 vs. UniProt/SwissProt
Match: sp|Q9LZ03|TOP6A_ARATH (DNA topoisomerase 6 subunit A OS=Arabidopsis thaliana OX=3702 GN=TOP6A PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.740e-25
Identity = 74/261 (28.35%), Postives = 133/261 (50.96%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            RKT     IL+++HQL ++N+  TKR++FY +++LF +Q   D +++ +S  +G +R  +N+ A+ K ++ G ++ +    + I C     G     G     +      ++   +            FIL+VEKDA +  L +  F + F P I++TAKG PD+  R  L  +    + +PV  LVD+DP+GL I   +  GSK  S   AN   + + ++K +G+  +D++K +  +   L ++  D +    +  E F
Sbjct:  141 RKTTITTRILALIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVSCMLGCTRSSLNVIAAEKGVVVGRLIFSDN-GDMIDCTKMGMG-----GKAIPPNIDRVGDMQSDAM------------FILLVEKDAAYMRLAEDRFYNRF-PCIIVTAKGQPDVATRLFLR-KMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSAN---LTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDF 378          
BLAST of Spo11 vs. UniProt/SwissProt
Match: sp|Q22236|SPO11_CAEEL (Meiotic recombination protein spo-11 OS=Caenorhabditis elegans OX=6239 GN=spo-11 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.440e-24
Identity = 78/258 (30.23%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  168 KRKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDV--------MLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPAD 917
            K K   +L  L  V+ LL  + +STKR ++Y +  ++ NQKYLD  I+ I + +  SR  +NI +  + +I G +        +++ RV E          + ++    FS                     +    FILVVEKD TFQ L+D NF ++F   IL T+KG+PD+  R +L    S     P++ L DADP G+ IY ++KYG  K    +     + +  ++ IGL  TD  +    +++ L L   D
Sbjct:   89 KGKLDRDLHCLHQVYDLLENDKRSTKRELYYEHKAVYGNQKYLDSSIKSICELLNESRANLNILSCGRGIIRGAITFLVENVGVIDARVQE----------VLITDALLFSNI-------------------ISEADFILVVEKDTTFQKLMDENFQAMFPRGILATSKGYPDIATRNVLKML-SEKRKFPIYGLFDADPHGIEIYLTYKYGPTK-EFAEGRGAFVPT--IEWIGLFPTDFHRFTIDQSQCLPLVRTD 313          
BLAST of Spo11 vs. TrEMBL
Match: A0A0A0V782 (Spo11 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 282/303 (93.07%), Postives = 284/303 (93.73%), Query Frame = 3
Query:   78 MKSSAISSIEKYFLDFIIIDLLNPNNKHLIKRKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV 986
            M SSAISSIEKYFLDFIIIDLLNPNNKHLIKRKTASELCILSI+HQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQ                  +GLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV
Sbjct:    1 MNSSAISSIEKYFLDFIIIDLLNPNNKHLIKRKTASELCILSIIHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQ------------------KGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV 285          
BLAST of Spo11 vs. TrEMBL
Match: A0A5G3IN32 (TP6A_N domain-containing protein OS=Xenopus tropicalis OX=8364 GN=spo11 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.767e-40
Identity = 91/265 (34.34%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L +LS++++L+  +  +TKR+I+Y +++L+ +Q  +D I+  +S  + + RI ++I ++SK  + GD+         ++C  S +G+                      ++ + +EG++ +    KFIL++EKDATFQ L+D NFC+   P ILIT KG PDLN R LL  +     +IP+F LVDADP+G+ I C +KYGS   S  +A+   + +  +  +GLL +D+E+L   K+ ++ LSP D+R L+ IQ   +
Sbjct:  109 QKFALMLKVLSVIYKLVQTDTYATKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGSSSGV----------------------LVPINVEGIRHLSTQAKFILIIEKDATFQRLLDDNFCARSGPCILITGKGVPDLNTR-LLTRKLWDSFHIPIFTLVDADPYGIEIMCIYKYGSISMS-YEAHHLTVPA--IAWLGLLPSDLERLFIPKDVLIPLSPLDRRKLLSIQKRPY 347          
BLAST of Spo11 vs. TrEMBL
Match: A0A3L7HCK6 (SPO11 (Fragment) OS=Cricetulus griseus OX=10029 GN=CgPICR_012794 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.713e-39
Identity = 94/265 (35.47%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +K A  L ILS++++L+  N  +TKR+IFY N +LF NQ  +D II+ IS  + + R  +++ ++SK LI G++         + C  S     + S                        +G++ +    KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP G+ I C +KYGS   S  +A+   + +  ++ +GLL +DI++L   K+ ++ L+  D+R L  I    +
Sbjct:   27 KKFALILKILSMIYKLVQSNTYATKRDIFYTNSQLFGNQASVDNIIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYVEEDGTRVQCTCSATATAVPSNI----------------------QGIRNLITDAKFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGIPDLNTRLLVKKLWDT-FHIPVFTLVDADPHGIEILCVYKYGSMSMS-FEAHSLTVPT--IRWLGLLPSDIQRLNIPKDSLIPLTKHDQRKLDSILKRPY 265          
BLAST of Spo11 vs. TrEMBL
Match: A0A0G2K9V7 (SPO11, initiator of meiotic double stranded breaks OS=Rattus norvegicus OX=10116 GN=Spo11 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.917e-39
Identity = 92/261 (35.25%), Postives = 140/261 (53.64%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            RK A  L ILS++++L+  N  +TKR+I+Y   +LF NQ  +D II+ IS  + + R  +++ ++SK LI G++         + C+ S     + S     Q+                       KF+L+VEKDATFQ L+D NFCS  +P I++T KG PDLN R L+     T  +IPVF LVDADP+G+ I C +KYGS   S    N  +     ++ +GLL +DI++L   K+ ++ L+  D+  L  I    +
Sbjct:  109 RKFALILKILSMIYKLIQSNTYATKRDIYYTESQLFRNQAAVDSIIDDISCMLKVPRRSLHVISTSKGLIAGNLRYVEEDGTQVQCMCSATATAVPSNIQGMQNLVTDA------------------KFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGTPDLNTRLLVKKLWDT-FHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTV---PTIRWLGLLPSDIKRLNIPKDSLIPLTRRDQMKLDSILRRPY 347          
BLAST of Spo11 vs. TrEMBL
Match: A0A3Q3E875 (SPO11 initiator of meiotic double stranded breaks OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 6.808e-39
Identity = 93/257 (36.19%), Postives = 145/257 (56.42%), Query Frame = 3
Query:  174 KTASE----LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADK 920
            KTA+     L ILS+ + L+  N  +TKR+I+Y + +LF +QK +D I++ +S  + + R  + + A+SK LI GD+         I+C S+   + +SS                         G++ I    KFILVVEKDATFQ L+  +FC+  +P I+IT KGFPD+N R ++  +   ++++PVF LVDADP G+ I C +KYGS   S    +  I    N+  +GLL +D+E+LQ  +N ++ L+ AD+
Sbjct:   78 KTATTFSQILKILSVTYTLVQSNSYATKRDIYYNHPQLFGSQKIVDRIVDDVSCMLKIPRRSLRVLATSKGLISGDLCYMEEDGTRINCHSNSAAVAVSSNIA----------------------GIRNIVSSAKFILVVEKDATFQRLLQDDFCTKLSPLIMITGKGFPDVNSRLMVR-KLWDVLHVPVFTLVDADPHGIEIMCIYKYGSLAMSFEAQSLTI---PNVMWLGLLPSDLERLQVPRNALIPLTKADE 308          
BLAST of Spo11 vs. Ensembl Cavefish
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:NCBI gene;Acc:103026448])

HSP 1 Score: 137.502 bits (345), Expect = 9.759e-37
Identity = 83/255 (32.55%), Postives = 139/255 (54.51%), Query Frame = 3
Query:  189 LCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            L +LS++++L+  +  +TKR+++Y + +LF  Q+ LD I++ IS  + + R  +++ A+SK  I GD+         + C S+   + +SS  +                   I   +   KFILVVEKDATFQ L+D  FC+  +P I+IT KG PD+N R ++     T ++IPVF LVDADP G+ I C +KYGS   +    +   + +  +  +GLL +DIEK   Q + ++  +  D+  L+ ++   +
Sbjct:  103 LKVLSMIYRLVQTDSYATKRDMYYNDPQLFGTQRNLDLIVDDISCMLQVPRRSLHVLATSKGFISGDLCYLEADGTRVECHSTSMAVPVSSNVS------------------EITNIVSSAKFILVVEKDATFQRLLDDEFCTRLHPCIIITGKGMPDVNSRLMVRKLWDT-LHIPVFALVDADPHGIEIMCVYKYGSMSMAFEAYS---LTTPTVLWLGLLPSDIEKFGVQ-DALIPFTKRDESKLMSLKKRPY 334          
BLAST of Spo11 vs. Ensembl Sea Lamprey
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:ZFIN;Acc:ZDB-GENE-040426-1900])

HSP 1 Score: 107.842 bits (268), Expect = 2.689e-28
Identity = 57/134 (42.54%), Postives = 78/134 (58.21%), Query Frame = 3
Query:  552 KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKF 953
            +F+LVVEKDATFQ+L+D +FC  F+P I++T KG PDLN R L+     T  +IP   LVDADP G  I   +KYGS   S   AN  +     +  +G+L ++IE+       +L LS  D+R L G+    F
Sbjct:   12 RFVLVVEKDATFQHLLDDDFCKRFHPCIMVTGKGIPDLNTRLLVRKLWDT-FHIPTLALVDADPHGFEIMTIYKYGSLSMSFDAANLTV---PTLCWLGVLPSEIERWNIPTTVLLPLSDRDQRKLRGLLGRPF 141          
BLAST of Spo11 vs. Ensembl Yeast
Match: SPO11 (Meiosis-specific protein that initiates meiotic recombination; initiates meiotic recombination by catalyzing the formation of double-strand breaks in DNA via a transesterification reaction; required for homologous chromosome pairing and synaptonemal complex formation [Source:SGD;Acc:S000001014])

HSP 1 Score: 61.2326 bits (147), Expect = 6.311e-11
Identity = 81/302 (26.82%), Postives = 136/302 (45.03%), Query Frame = 3
Query:  171 RKTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLS-RIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFC--LVDADPFGLSIYCSFKYGSKKFSLL--DANQDIIR----------SHNMKLIGLLATDIEKLQFQKNEILTLSPAD--------KRILVGIQNEKFYMTDSDVKLQVINKIFSY 1007
            ++ A  L +L +V + L     +T R+IFY N+ELF  Q  +   ++ I     LS R  +NI  + K L+Y    ++   N     L+  N   +     F     L  F +   V+ L   G   +  I++VEK+A F  L++ N+  L   ++LIT KGFPD   R  L   +     +   C    DADP+G+SI  ++ + +++ + +   AN   IR           HN K I LL+ +       KN I +L+           K +++  Q E F+   +++  ++  +IF Y
Sbjct:  106 KRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDN----ILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKL---GTTSMCNIVIVEKEAVFTKLVN-NYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNERNAYICTMANYKGIRITQVLAQNNEVHN-KSIQLLSLNQRDYSLAKNLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMN-EIDARIFEY 397          
BLAST of Spo11 vs. Ensembl Nematostella
Match: EDO44118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWG7])

HSP 1 Score: 116.701 bits (291), Expect = 1.872e-29
Identity = 76/254 (29.92%), Postives = 127/254 (50.00%), Query Frame = 3
Query:  174 KTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFT-----FSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADK 920
            K A+ + ILSI   LL ++  +TKR+++Y +   F NQ  +D I++ +S  + + R  + I ASSK LI G V         + C     G+ +SS        +S +                       K +LVVEK+AT+  L+D       NP I+IT KG+PD+N R +++ R    +++PV  LVDADP G+ I   +KYGSK  S    N   +    ++ +G+  +++++L   ++  + L+  D+
Sbjct:  119 KFATTIRILSICQNLLQEDRFATKRDVYYTDTVFFGNQNVVDDIVDNLSCMLEVPRHSLRILASSKGLISGHVRYREYDGTYVDCTCLTRGVAVSSHVDGIYDLYSDA-----------------------KVVLVVEKEATYHRLLDDGLLEKLNPCIMITGKGYPDVNTRQMVH-RLWCTLHVPVMALVDADPHGIEILSVYKYGSKALSF---NVHDLTVPTIRWLGVWPSEVDRLSIPEHVRIPLTERDR 345          
BLAST of Spo11 vs. Ensembl Medaka
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:NCBI gene;Acc:100125486])

HSP 1 Score: 134.806 bits (338), Expect = 5.294e-36
Identity = 86/267 (32.21%), Postives = 144/267 (53.93%), Query Frame = 3
Query:  174 KTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMT 962
            K A  L ILS++++L+  N  +TKR+++Y N +LF +Q+ +D I++ IS  + +SR  +++ A+SK LI GD+           C    +G  +                     +   + G++ I    KF+++VEKDATFQ L++ +FC   +P I+IT KG PD+N R ++     T + IP+F LVDADP G  I C +KYGS   S  +A+   + S  +  +GLL +D+++L   K  +L L+  D+  L  +    ++ +
Sbjct:   75 KFAQILKILSVIYRLVQSNSYATKRDVYYNNTQLFGSQRSVDTIVDDISCMLKVSRRALHVMATSKGLIAGDL-----------CYLEEDGTRIDC-----------RSSSAAVSVSSNVSGIRNIVSSAKFVMIVEKDATFQRLLNDDFCRKLSPCIMITGKGVPDVNSRLMVKKLWDT-LQIPIFALVDADPHGFEIMCIYKYGSVAMS-FEAHSLTVPS--VMWLGLLPSDLQRLMVPKRSLLPLTRRDENKLNSLLKRPYFAS 315          
BLAST of Spo11 vs. Ensembl Medaka
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:NCBI gene;Acc:100125486])

HSP 1 Score: 134.035 bits (336), Expect = 8.959e-36
Identity = 85/265 (32.08%), Postives = 143/265 (53.96%), Query Frame = 3
Query:  180 ASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMT 962
            A  L ILS++++L+  N  +TKR+++Y N +LF +Q+ +D I++ IS  + +SR  +++ A+SK LI GD+           C    +G  +                     +   + G++ I    KF+++VEKDATFQ L++ +FC   +P I+IT KG PD+N R ++     T + IP+F LVDADP G  I C +KYGS   S  +A+   + S  +  +GLL +D+++L   K  +L L+  D+  L  +    ++ +
Sbjct:   68 AQILKILSVIYRLVQSNSYATKRDVYYNNTQLFGSQRSVDTIVDDISCMLKVSRRALHVMATSKGLIAGDL-----------CYLEEDGTRIDC-----------RSSSAAVSVSSNVSGIRNIVSSAKFVMIVEKDATFQRLLNDDFCRKLSPCIMITGKGVPDVNSRLMVKKLWDT-LQIPIFALVDADPHGFEIMCIYKYGSVAMS-FEAHSLTVPS--VMWLGLLPSDLQRLMVPKRSLLPLTRRDENKLNSLLKRPYFAS 306          
BLAST of Spo11 vs. Ensembl Medaka
Match: spo11 (SPO11 initiator of meiotic double stranded breaks [Source:NCBI gene;Acc:100125486])

HSP 1 Score: 134.806 bits (338), Expect = 9.882e-36
Identity = 86/267 (32.21%), Postives = 144/267 (53.93%), Query Frame = 3
Query:  174 KTASELCILSIVHQLLIKNMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLI----KFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMT 962
            K A  L ILS++++L+  N  +TKR+++Y N +LF +Q+ +D I++ IS  + +SR  +++ A+SK LI GD+           C    +G  +                     +   + G++ I    KF+++VEKDATFQ L++ +FC   +P I+IT KG PD+N R ++     T + IP+F LVDADP G  I C +KYGS   S  +A+   + S  +  +GLL +D+++L   K  +L L+  D+  L  +    ++ +
Sbjct:  113 KFAQILKILSVIYRLVQSNSYATKRDVYYNNTQLFGSQRSVDTIVDDISCMLKVSRRALHVMATSKGLIAGDL-----------CYLEEDGTRIDC-----------RSSSAAVSVSSNVSGIRNIVSSAKFVMIVEKDATFQRLLNDDFCRKLSPCIMITGKGVPDVNSRLMVKKLWDT-LQIPIFALVDADPHGFEIMCIYKYGSVAMS-FEAHSLTVPS--VMWLGLLPSDLQRLMVPKRSLLPLTRRDENKLNSLLKRPYFAS 353          
BLAST of Spo11 vs. Planmine SMEST
Match: SMESG000009092.1 (SMESG000009092.1)

HSP 1 Score: 439.884 bits (1130), Expect = 2.722e-156
Identity = 223/242 (92.15%), Postives = 224/242 (92.56%), Query Frame = 3
Query:  261 MNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSXXXXXXXXXXXXXXXXXEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV 986
            MNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQ                  +GLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV
Sbjct:    1 MNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSLIYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQ------------------KGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRFLLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRSHNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVKLQV 224          
The following BLAST results are available for this feature:
BLAST of Spo11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPO111.399e-4033.45SPO11 initiator of meiotic double stranded breaks ... [more]
SPO111.027e-3832.98SPO11 initiator of meiotic double stranded breaks ... [more]
SPO111.768e-3832.98SPO11 initiator of meiotic double stranded breaks ... [more]
SPO117.752e-3638.00SPO11 initiator of meiotic double stranded breaks ... [more]
SPO111.522e-1450.67SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spo-119.076e-2630.23Meiotic recombination protein spo-11 [Source:UniP... [more]
spo-111.132e-2530.23Meiotic recombination protein spo-11 [Source:UniP... [more]
back to top
BLAST of Spo11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mei-W686.951e-1527.63gene:FBgn0002716 transcript:FBtr0086461[more]
back to top
BLAST of Spo11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spo116.494e-3631.51SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spo113.036e-4334.34SPO11 meiotic protein covalently bound to DSB [Sou... [more]
spo112.280e-4134.48SPO11 meiotic protein covalently bound to DSB [Sou... [more]
spo112.067e-2934.52SPO11 meiotic protein covalently bound to DSB [Sou... [more]
spo119.003e-1640.38SPO11 meiotic protein covalently bound to DSB [Sou... [more]
back to top
BLAST of Spo11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Spo112.650e-4033.72SPO11 meiotic protein covalently bound to DSB [Sou... [more]
Spo114.706e-4034.40SPO11 meiotic protein covalently bound to DSB [Sou... [more]
Spo117.342e-3732.12SPO11 meiotic protein covalently bound to DSB [Sou... [more]
back to top
BLAST of Spo11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WTK8|SPO11_MOUSE3.292e-3934.40Meiotic recombination protein SPO11 OS=Mus musculu... [more]
sp|Q9Y5K1|SPO11_HUMAN8.490e-3832.98Meiotic recombination protein SPO11 OS=Homo sapien... [more]
sp|P40384|SPO11_SCHPO1.174e-2531.65Meiotic recombination protein rec12 OS=Schizosacch... [more]
sp|Q9LZ03|TOP6A_ARATH8.740e-2528.35DNA topoisomerase 6 subunit A OS=Arabidopsis thali... [more]
sp|Q22236|SPO11_CAEEL1.440e-2430.23Meiotic recombination protein spo-11 OS=Caenorhabd... [more]
back to top
BLAST of Spo11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A0V7820.000e+093.07Spo11 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A5G3IN324.767e-4034.34TP6A_N domain-containing protein OS=Xenopus tropic... [more]
A0A3L7HCK62.713e-3935.47SPO11 (Fragment) OS=Cricetulus griseus OX=10029 GN... [more]
A0A0G2K9V72.917e-3935.25SPO11, initiator of meiotic double stranded breaks... [more]
A0A3Q3E8756.808e-3936.19SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spo119.759e-3732.55SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spo112.689e-2842.54SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPO116.311e-1126.82Meiosis-specific protein that initiates meiotic re... [more]
back to top
BLAST of Spo11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO441181.872e-2929.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spo11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spo115.294e-3632.21SPO11 initiator of meiotic double stranded breaks ... [more]
spo118.959e-3632.08SPO11 initiator of meiotic double stranded breaks ... [more]
spo119.882e-3632.21SPO11 initiator of meiotic double stranded breaks ... [more]
back to top
BLAST of Spo11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009092.12.722e-15692.15SMESG000009092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007726 ID=SMED30007726|Name=Spo11|organism=Schmidtea mediterranea sexual|type=transcript|length=1079bp
AAGTTTTCTTTTCGAAAAAAGTTACTTAAATTTTCAAAGATTCTTAATTA
ATTTAGGTAATTAGATTTTTAATCTCCATGAAATCGTCTGCAATTTCATC
TATTGAAAAATATTTTCTGGATTTCATTATTATTGACTTGCTCAATCCAA
ACAATAAACATTTAATAAAACGAAAAACTGCATCAGAATTGTGCATTTTG
TCAATTGTTCATCAGTTACTGATAAAAAATATGAAATCTACAAAGAGGAA
TATTTTTTACATGAATATCGAATTGTTTGTTAATCAGAAATATTTGGATT
TTATTATTGAATGCATTTCGAAAAAAATTGGATTATCCCGTATTGAAATG
AACATCGAAGCTTCGAGTAAATCATTGATTTATGGAGATGTAATGTTGAA
TCATAGAGTCAATGAACCGATTCATTGTCTATCCTCACACAATGGCATCA
ATTTATCTAGCGGATTCACGTTTTCACAGAGTTATTATTTATACTTGTTC
ATACGCATCATTTTTGTTTTGTTTTTGATATTAGAAGGCTTGAAATTAAT
TAAATTTATTTTGGTCGTTGAAAAGGATGCAACATTTCAAAATTTGATTG
ATCGAAATTTTTGTAGTTTATTCAATCCCTCTATATTGATTACAGCTAAA
GGATTTCCCGATTTGAATTGCAGGTTCTTACTTAATTCTAGAGACTCAAC
TATTATAAATATCCCTGTATTTTGTTTGGTGGATGCAGATCCATTTGGAT
TATCAATTTACTGTTCGTTCAAATATGGTTCTAAAAAATTCTCTCTACTA
GATGCCAATCAAGATATAATTAGATCTCATAATATGAAACTTATTGGGCT
ACTTGCAACCGATATTGAAAAATTACAATTTCAAAAAAATGAAATATTGA
CTCTATCTCCTGCCGATAAAAGAATTTTGGTTGGAATACAAAATGAAAAA
TTTTACATGACCGATTCTGATGTAAAATTACAGGTTATTAATAAAATCTT
TTCTTATTAATCTAAAGTGGGGAAATATTTTGCTTATAAATTATATAATA
TGATTTTTATTGCTAAATAATCAACTTTA
back to top

protein sequence of SMED30007726-orf-1

>SMED30007726-orf-1 ID=SMED30007726-orf-1|Name=SMED30007726-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MKSSAISSIEKYFLDFIIIDLLNPNNKHLIKRKTASELCILSIVHQLLIK
NMKSTKRNIFYMNIELFVNQKYLDFIIECISKKIGLSRIEMNIEASSKSL
IYGDVMLNHRVNEPIHCLSSHNGINLSSGFTFSQSYYLYLFIRIIFVLFL
ILEGLKLIKFILVVEKDATFQNLIDRNFCSLFNPSILITAKGFPDLNCRF
LLNSRDSTIINIPVFCLVDADPFGLSIYCSFKYGSKKFSLLDANQDIIRS
HNMKLIGLLATDIEKLQFQKNEILTLSPADKRILVGIQNEKFYMTDSDVK
LQVINKIFSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016889endodeoxyribonuclease activity, producing 3'-phosphomonoesters
GO:0003677DNA binding
GO:0003824catalytic activity
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
Vocabulary: INTERPRO
TermDefinition
IPR034136TOPRIM_Topo6A/Spo11
IPR036078Spo11/TopoVI_A_sf
IPR002815Spo11/TopoVI_A
IPR013049Spo11/TopoVI_A_N
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0000737DNA catabolic process, endonucleolytic
GO:0006259DNA metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002815Spo11/DNA topoisomerase VI subunit APRINTSPR01550TOP6AFAMILYcoord: 161..178
score: 60.76
coord: 56..67
score: 41.67
coord: 186..207
score: 39.77
coord: 219..235
score: 57.72
IPR002815Spo11/DNA topoisomerase VI subunit APANTHERPTHR10848MEIOTIC RECOMBINATION PROTEIN SPO11coord: 33..293
IPR013049Spo11/DNA topoisomerase VI, subunit A, N-terminalPFAMPF04406TP6A_Ncoord: 33..93
e-value: 1.5E-13
score: 50.5
NoneNo IPR availableGENE3DG3DSA:3.40.1360.10coord: 151..307
e-value: 1.8E-39
score: 137.5
NoneNo IPR availablePANTHERPTHR10848:SF0MEIOTIC RECOMBINATION PROTEIN SPO11coord: 33..293
NoneNo IPR availableTMHMMTMhelixcoord: 135..152
IPR034136Topoisomerase 6 subunit A/Spo11, TOPRIM domainCDDcd00223TOPRIM_TopoIIB_SPOcoord: 159..303
e-value: 2.56552E-33
score: 118.126
IPR036078Spo11/DNA topoisomerase VI subunit A superfamilySUPERFAMILYSSF56726DNA topoisomerase IV, alpha subunitcoord: 32..296