Flotillin-1

Overview
NameFlotillin-1
Smed IDSMED30007718
Length (bp)1571
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Flotillin-1 (SMED30007718) t-SNE clustered cells

Violin plots show distribution of expression levels for Flotillin-1 (SMED30007718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flotillin-1 (SMED30007718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flotillin-1 (SMED30007718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007718SMESG000063612.1 Contig1040uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007718SMESG000063612.1 Contig1040newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007718SMESG000020047.1 Contig1040uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007718SMESG000020047.1 Contig1040newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30007718SMESG000063612.1 SmedASXL_017826SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000063612.1 Contig37188uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000063612.1 Contig37188newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000063612.1 Contig1040uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000063612.1 Contig1040newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000020047.1 Contig1040uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007718SMESG000020047.1 Contig1040newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30007718SMESG000063612.1 dd_Smed_v6_1887_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007718SMESG000063612.1 dd_Smed_v4_1887_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 406.371 bits (1043), Expect = 1.001e-137
Identity = 210/411 (51.09%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+ +++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 406.371 bits (1043), Expect = 1.001e-137
Identity = 210/411 (51.09%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+ +++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 406.371 bits (1043), Expect = 1.001e-137
Identity = 210/411 (51.09%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+ +++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 406.371 bits (1043), Expect = 1.001e-137
Identity = 210/411 (51.09%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+ +++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 406.371 bits (1043), Expect = 1.001e-137
Identity = 210/411 (51.09%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+ +++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087351)

HSP 1 Score: 427.943 bits (1099), Expect = 1.424e-146
Identity = 241/415 (58.07%), Postives = 319/415 (76.87%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW   Q+ Q++SLN  T+ + SP +YT  GV ++VTG+AQ+K++G+N  MLL ACEQFLGK + +I+ I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL  MGI+VVSYTIKD+ DE+GYL++LG  RTA+V RDARIGEAEA  +A IK+A A++ +M A+  N+T IAKA RDF+L+KA +D EV T +A AEMAY+LQ AKT Q I EE   + VIER   I VQE E+ R ER+L+A+I+  A AEK++M+KLAEA K ++V EAEAE+E+I+++GEAEAFAI    KA+A QM MKAEA++EY +AA +EM+L  LP +AAEVA PL+  +KITMVS+G GDIG +KLTGEV+ ++N + + V  ++
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNIT 415          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087352)

HSP 1 Score: 421.779 bits (1083), Expect = 4.496e-144
Identity = 241/419 (57.52%), Postives = 319/419 (76.13%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQ----GYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW   Q+ Q++SLN  T+ + SP +YT  GV ++VTG+AQ+K++G+N  MLL ACEQFLGK + +I+ I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL  MGI+VVSYTIKD+ DE+    GYL++LG  RTA+V RDARIGEAEA  +A IK+A A++ +M A+  N+T IAKA RDF+L+KA +D EV T +A AEMAY+LQ AKT Q I EE   + VIER   I VQE E+ R ER+L+A+I+  A AEK++M+KLAEA K ++V EAEAE+E+I+++GEAEAFAI    KA+A QM MKAEA++EY +AA +EM+L  LP +AAEVA PL+  +KITMVS+G GDIG +KLTGEV+ ++N + + V  ++
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGDSKGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNIT 419          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 280.796 bits (717), Expect = 3.741e-89
Identity = 177/418 (42.34%), Postives = 265/418 (63.40%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T+GPNE L+VSG C G  K   I+GG  + W  V   Q+LSLNV T+  +   + T  GV LTVTGVAQ KI  K   +L  A EQFLGK   +I   +  TLE H RAI+G +TVEE+Y+DR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+ +TA V RDA  G AEA RDA I++A+ +++ M  K + +T I    R ++LQKA FD+E++T +A +++AY+LQ AK  Q I  E   I+V+ER  +I+++  EV+R +R+L  ++K  A AE +++Q LA+A + + +  A AE+E I+  G AEA AIE+VGKA+A +M MKA  +K+Y  AA + +VL  LP +AAEVA PL    +I ++       G   +T +V  ++  L  ++N ++  ++  +
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKV 416          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073950)

HSP 1 Score: 280.796 bits (717), Expect = 3.741e-89
Identity = 177/418 (42.34%), Postives = 265/418 (63.40%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T+GPNE L+VSG C G  K   I+GG  + W  V   Q+LSLNV T+  +   + T  GV LTVTGVAQ KI  K   +L  A EQFLGK   +I   +  TLE H RAI+G +TVEE+Y+DR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+ +TA V RDA  G AEA RDA I++A+ +++ M  K + +T I    R ++LQKA FD+E++T +A +++AY+LQ AK  Q I  E   I+V+ER  +I+++  EV+R +R+L  ++K  A AE +++Q LA+A + + +  A AE+E I+  G AEA AIE+VGKA+A +M MKA  +K+Y  AA + +VL  LP +AAEVA PL    +I ++       G   +T +V  ++  L  ++N ++  ++  +
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKV 416          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 280.411 bits (716), Expect = 6.809e-89
Identity = 177/418 (42.34%), Postives = 265/418 (63.40%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T+GPNE L+VSG C G  K   I+GG  + W  V   Q+LSLNV T+  +   + T  GV LTVTGVAQ KI  K   +L  A EQFLGK   +I   +  TLE H RAI+G +TVEE+Y+DR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+ +TA V RDA  G AEA RDA I++A+ +++ M  K + +T I    R ++LQKA FD+E++T +A +++AY+LQ AK  Q I  E   I+V+ER  +I+++  EV+R +R+L  ++K  A AE +++Q LA+A + + +  A AE+E I+  G AEA AIE+VGKA+A +M MKA  +K+Y  AA + +VL  LP +AAEVA PL    +I ++       G   +T +V  ++  L  ++N ++  ++  +
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKV 416          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 416.387 bits (1069), Expect = 5.824e-142
Identity = 219/411 (53.28%), Postives = 312/411 (75.91%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSGC    PLMI GG+ FV   +Q+ Q+++LN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ F+GK + +I++I   TLE HQRAI+  +TVEEIYQDRKKFSE+VF+V+S+DL+ MGI VVSYT+KD+ D+Q YL +LG+ RTAQV RDARIGEA+  RDA I++A A Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A I+  A AE+Y+++KLAEA + +L+ EAEAE+E+I++KGEAEAFA+E  G+A+A QM  KAEA+K Y++ A ++M+L  LP +A E+++PL   QK+TMVS+G  ++G +KLTGEV+D++  L  AV K++
Sbjct:    2 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVIPCIQQIQRITLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFMGKSEGEIANIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLSSLGKARTAQVQRDARIGEAQFKRDAVIREAHAMQEKVSAQYKNEIEMAKAQRDFELKKAAYDVEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVQVVERTQQIMLQEQEITRREKELEAKIRKPAEAERYRIEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKGYKEGAMVDMLLEKLPLMAEEISKPLCAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPGAVEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 415.231 bits (1066), Expect = 1.984e-141
Identity = 216/411 (52.55%), Postives = 313/411 (76.16%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+MI GG+ FV+  VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK D +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA+  RDA I++A A Q ++ A+  N   +AKA RD++L+KAI+D EV T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +K  A AE+Y+++KLAEA + +L+ EAEAE+E+I+++GEAEA+A+E  G+A+A QM  KAEA++ Y++ A ++M+L  LP +A E+++PL+   K+TMVS+G  +IG +KLTGEV+D++  L + + K++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 414.846 bits (1065), Expect = 3.579e-141
Identity = 216/411 (52.55%), Postives = 313/411 (76.16%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+MI GG+ FV+  VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK D +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA+  RDA I++A A Q ++ A+  N   +AKA RD++L+KAI+D EV T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +K  A AE+Y+++KLAEA + +L+ EAEAE+E+I+++GEAEA+A+E  G+A+A QM  KAEA++ Y++ A ++M+L  LP +A E+++PL+   K+TMVS+G  +IG +KLTGEV+D++  L + + K++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 283.493 bits (724), Expect = 4.193e-90
Identity = 182/418 (43.54%), Postives = 277/418 (66.27%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLGK--PLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G       +GG  + W  +   QK++L + T+      + T  GVA+TVTGVAQ+K+   N  +L  ACEQFLGK   +I  ++  TLE H R+I+G +TVE+IYQDR +F++ V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+++TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ ++QKA F++EV+T +A A++AY+LQ AK  Q I  E   I+V++R+ +I ++E E+ R +++L A+++  A AE ++M++LAEA K K V  A+AE+E IK  GEAEA +IE VGKA+A +M +KAEA+++Y +AAK  +VL  LP +A +VA PL    +I ++S   GD G  ++TGEV  ++  L  +VN ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTDN-ELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVILS---GDGG--RVTGEVNRLLAELPVSVNALTGVDLSKI 417          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 270.781 bits (691), Expect = 3.620e-85
Identity = 179/412 (43.45%), Postives = 276/412 (66.99%), Query Frame = 2
Query:   53 VTSGPNEVLVVSGCCLGK--PLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            +T GPNE LVVSG C G      ++GG  + W  +   Q+++L + T+      + T  GVA+TVTGVAQ+K+   ++ +L  ACEQFLGK   +I  +V  TLE H R+I+G +TVE+IYQDR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ +LQKA F++EV+T +A +++AY+LQ AK  Q I  E   I+V++R+ +I ++E E++R E++L A++K  A AE Y+M++LAE  K + V  A+AE+E I+  GEAEA +I  VGKA+A +M +KAEA+++Y +AAK  +VL  LP +A +V+ PL    +I ++S G+G    S++TGEV  ++  L  +VN ++
Sbjct:    5 LTVGPNEALVVSGACCGSDAKTYVVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVM-TDKDLLAIACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELELQKAAFNQEVNTKKAESQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEREIERTEKELIATVKRPAEAEAYKMEQLAEGYKMQKVLTAQAEAEKIRKIGEAEAISISSVGKAEAERMRLKAEAYQQYGEAAKTALVLDALPKIAGKVSAPLARTNEIVILS-GDG----SRVTGEVNRLLAELPVSVNALT 410          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 382.489 bits (981), Expect = 2.607e-128
Identity = 214/416 (51.44%), Postives = 312/416 (75.00%), Query Frame = 2
Query:   35 KLSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            K +MP +    +   + SG C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK +++++ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEA A +DA IK+AQA Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +++AY+LQ AKT Q I E+   + V+ER  +IQ+Q+ E+ R E++L+A IK  A AE+Y+++KLAEA + KL+ EAEAE+E I++KGEA A+A+E+  +ADA QM  KAEA++EY+ AA ++M+L  LP +A  +++P+T  +KI M+S+G  ++G SK+TGEV+D++N L D V K++
Sbjct:    4 KCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLT 416          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 382.104 bits (980), Expect = 2.721e-128
Identity = 214/416 (51.44%), Postives = 312/416 (75.00%), Query Frame = 2
Query:   35 KLSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            K +MP +    +   + SG C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK +++++ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEA A +DA IK+AQA Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +++AY+LQ AKT Q I E+   + V+ER  +IQ+Q+ E+ R E++L+A IK  A AE+Y+++KLAEA + KL+ EAEAE+E I++KGEA A+A+E+  +ADA QM  KAEA++EY+ AA ++M+L  LP +A  +++P+T  +KI M+S+G  ++G SK+TGEV+D++N L D V K++
Sbjct:    4 KCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLT 416          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 380.563 bits (976), Expect = 1.796e-127
Identity = 214/416 (51.44%), Postives = 312/416 (75.00%), Query Frame = 2
Query:   35 KLSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            K +MP +    +   + SG C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK +++++ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEA A +DA IK+AQA Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +++AY+LQ AKT Q I E+   + V+ER  +IQ+Q+ E+ R E++L+A IK  A AE+Y+++KLAEA + KL+ EAEAE+E I++KGEA A+A+E+  +ADA QM  KAEA++EY+ AA ++M+L  LP +A  +++P+T  +KI M+S+G  ++G SK+TGEV+D++N L D V K++
Sbjct:    4 KCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLT 416          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 378.637 bits (971), Expect = 3.987e-127
Identity = 212/402 (52.74%), Postives = 306/402 (76.12%), Query Frame = 2
Query:   80 VVSGC-CLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            V S C C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK +++++ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEA A +DA IK+AQA Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +++AY+LQ AKT Q I E+   + V+ER  +IQ+Q+ E+ R E++L+A IK  A AE+Y+++KLAEA + KL+ EAEAE+E I++KGEA A+A+E+  +ADA QM  KAEA++EY+ AA ++M+L  LP +A  +++P+T  +KI M+S+G  ++G SK+TGEV+D++N L D V K++
Sbjct:    2 VFSLCFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLT 403          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 376.711 bits (966), Expect = 3.978e-126
Identity = 209/396 (52.78%), Postives = 303/396 (76.52%), Query Frame = 2
Query:   95 CLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK +++++ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEA A +DA IK+AQA Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +++AY+LQ AKT Q I E+   + V+ER  +IQ+Q+ E+ R E++L+A IK  A AE+Y+++KLAEA + KL+ EAEAE+E I++KGEA A+A+E+  +ADA QM  KAEA++EY+ AA ++M+L  LP +A  +++P+T  +KI M+S+G  ++G SK+TGEV+D++N L D V K++
Sbjct:    7 CRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLT 402          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 408.297 bits (1048), Expect = 1.040e-138
Identity = 211/411 (51.34%), Postives = 316/411 (76.89%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K +L+ +AEAE+E+++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D+++ L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLT 412          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 328.176 bits (840), Expect = 5.340e-108
Identity = 183/411 (44.53%), Postives = 280/411 (68.13%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ                                                EIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K +L+ +AEAE+E+++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D+++ L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ------------------------------------------------EIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLT 364          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 281.567 bits (719), Expect = 3.046e-89
Identity = 182/418 (43.54%), Postives = 273/418 (65.31%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLGKPL--MIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G      + GG  + W  +   Q+LSL V TI+     I T  GV L VTGVAQ+KI    + +L  ACEQFLGK   DI ++V  TLE H R+I+G +TVE+IYQDR +F++ V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  +  K   +T IA + R F+LQK+ F +EV+   A A++AY+LQ A+  Q I +E   I+V++R+ +I V+  E+ R +++L A+++  A AE +++Q++AE  K K V  A+AE+E I+  GEAEA  IE +GKA+A +M +KAEA+++Y  AAK+ +VL  LP +AA+++ PLT   +I ++S   GD   SK+T EV  ++  L  +V+ ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVKIM-TEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLS---GD--NSKVTSEVNRLLAELPASVHALTGVDLSKI 417          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 279.641 bits (714), Expect = 1.552e-88
Identity = 180/418 (43.06%), Postives = 274/418 (65.55%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLGKPL--MIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G      + GG  + W  +   Q++SL + T+      + T  GVALTVTGVAQ+KI    + +L  ACEQFLGK   DI ++V  TLE H R+I+G +TVE+IYQDR +F++ V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  +  K   +T IA + R F+LQK+ F +EV+   A A++AY+LQ A+  Q I +E   I+V++R+ +I V+  E+ R +++L A+++  A AE +++Q++AE  K K V  A+AE+E I+  GEAEA  IE +GKA+A +M +KAEA+++Y  AAK+ +VL  LP +AA+++ PLT   +I ++S   GD   SK+T EV  ++  L  +V+ ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKI-MTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLS---GD--NSKVTSEVNRLLAELPASVHALTGVDLSKI 417          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 239.965 bits (611), Expect = 2.188e-76
Identity = 111/185 (60.00%), Postives = 146/185 (78.92%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRD 604
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RD
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRD 186          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O61491|FLOT1_DROME (Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 1.427e-145
Identity = 241/415 (58.07%), Postives = 319/415 (76.87%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW   Q+ Q++SLN  T+ + SP +YT  GV ++VTG+AQ+K++G+N  MLL ACEQFLGK + +I+ I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL  MGI+VVSYTIKD+ DE+GYL++LG  RTA+V RDARIGEAEA  +A IK+A A++ +M A+  N+T IAKA RDF+L+KA +D EV T +A AEMAY+LQ AKT Q I EE   + VIER   I VQE E+ R ER+L+A+I+  A AEK++M+KLAEA K ++V EAEAE+E+I+++GEAEAFAI    KA+A QM MKAEA++EY +AA +EM+L  LP +AAEVA PL+  +KITMVS+G GDIG +KLTGEV+ ++N + + V  ++
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNIT 415          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q7YR41|FLOT1_PANTR (Flotillin-1 OS=Pan troglodytes OX=9598 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 4.606e-138
Identity = 211/411 (51.34%), Postives = 316/411 (76.89%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+E+++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q5TM70|FLOT1_MACMU (Flotillin-1 OS=Macaca mulatta OX=9544 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 4.606e-138
Identity = 211/411 (51.34%), Postives = 316/411 (76.89%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+E+++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D++  L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLT 412          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O08917|FLOT1_MOUSE (Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 7.275e-138
Identity = 211/411 (51.34%), Postives = 316/411 (76.89%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K +L+ +AEAE+E+++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D+++ L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLT 412          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q08DN8|FLOT1_BOVIN (Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 7.428e-138
Identity = 211/411 (51.34%), Postives = 316/411 (76.89%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+M+ GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK + +I+ I   TLE HQRAIM  MTVEEIY+DR+KFSE+VF+V+S+DL+ MGISVVSYT+KDI D+Q YL +LG+ RTAQV +DARIGEAEA RDA I++A+A+Q ++ A+  +   +AKA RD++L+KA +D EV+T  A A++AY+LQ AKT Q I E+   + V+ER  ++ VQE E+ R E++L+A ++  A AE+Y++++LAEA K++L+ +AEAE+E ++++GEAEAFAI    +A+A QM  KAEA++ Y++AA+++M+L  LP +A E++ PLT+  KIT+VS+G G +G +K+TGEV+D+++ L ++V +++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAEAVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGAMGAAKVTGEVLDILSRLPESVERLT 412          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A068CQN6 (Flotillin-1 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 355/420 (84.52%), Postives = 399/420 (95.00%), Query Frame = 2
Query:   44 MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            MPFV SGPNEVLVVSGCCLGKPLMIIGGKKFVW G Q YQKLSLNVKTI+IVSPKIYTKLGVALTVTGVAQIKIEG+NRHMLL+ACEQFLGK+D +IS+IV+ TLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRV+S+DLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEA RDAEIKKA+AQQA+MH+KLAN+TAIAKA+RD++LQKA+FD+EVH+ EAIA+MAY+LQEAKTNQ+IMEETK IDVIER+C+I+VQELEV R+ + L+A+IKN+A AEKY+M+KLAEA K ++VNE+EA SE+IKLKGEAEAFAIE VGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLP++AAE+AQPLTNCQKITMVSNG+G+IGVSKL GEVI+VI  LSDAVNKMSR EMK++
Sbjct:    1 MPFVISGPNEVLVVSGCCLGKPLMIIGGKKFVWSGFQTYQKLSLNVKTIVIVSPKIYTKLGVALTVTGVAQIKIEGRNRHMLLSACEQFLGKQDLEISNIVKETLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVASSDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEAIRDAEIKKARAQQAKMHSKLANDTAIAKADRDYKLQKAVFDREVHSAEAIAQMAYRLQEAKTNQMIMEETKEIDVIERQCKIRVQELEVLRVVKNLEATIKNEASAEKYRMEKLAEAEKIQIVNESEALSESIKLKGEAEAFAIETVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPNMAAEIAQPLTNCQKITMVSNGDGEIGVSKLAGEVINVIKTLSDAVNKMSRDEMKTV 420          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1B6G9M7 (PHB domain-containing protein OS=Cuerna arida OX=1464854 GN=g.32683 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 5.369e-158
Identity = 246/423 (58.16%), Postives = 330/423 (78.01%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSE-MKSI 1303
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW  +Q  Q++SLN  T+ + SP +YT  GV ++VTG+AQ+KI+G+N  MLLAACEQFLGK DD+I  I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL+ MGI+VVSYT+KDI DE+GYLK+LG  RTA+V RDARIGEAEA RDA+IK+A A++ +M ++  N+T IAKA RDF+L+KA +D EV T +A AEMAY+LQ AKT Q IMEE   I V+ER   I VQ+ E++R ER+L++ ++  A AEKY+++KLAEA + ++V EAEAE+E+++L+GEAEAFA++   KA+A QMT KAEA+KEY +AA +EM+L  LP +AAEVA PL+  +KITMVS+G+G+IG +KLTGEV+ ++  + + V  M+  + MKS+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYTKPLLVPGGRAFVWPSIQCVQRISLNTMTLQVDSPTVYTSQGVPISVTGIAQVKIQGQNEEMLLAACEQFLGKSDDEIQHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKSLGMARTAEVKRDARIGEAEARRDAQIKEAMAEEERMASRFLNDTEIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIMEEQMQIKVVERTQEIAVQDQEIQRKERELESMVRRPAEAEKYRLEKLAEANRLRVVLEAEAEAESLRLRGEAEAFAVQAKAKAEAEQMTKKAEAFKEYREAAMVEMLLDTLPKIAAEVAAPLSQAKKITMVSSGQGEIGAAKLTGEVLQIVTKVPEMVKNMTGVDIMKSV 423          
BLAST of Flotillin-1 vs. TrEMBL
Match: E0VW73 (Flotillin-1, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8239365 PE=3 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 3.719e-156
Identity = 241/415 (58.07%), Postives = 321/415 (77.35%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW G+Q  Q++SLN  T+ + SP +YT  GV ++VTG+AQ+KI+G+N  ML AACEQFLGK +++I +I   TLE HQRAIMG MTVEEIY+DRKKFS+ VF V+S+DL+ MGI+VVSYT+KDI DE+GYLK+LG+ RTA+V RDARIGEAEA RDA+IK+A A++ +M A+  N+T IAKA RDF+L+KA++D EV T  A AEMA+ LQ AKT Q I EE   I V+ER   I VQE E+ R ER+L+A+++  A AEKY+++KLAEA + +++ EAEAESE I+++GEAEAFAI+   KA+A QM  KAEAW EY +AA IEM+L +LP +AAEVA PL+  +KITMVS+G  ++G +KLTGE++ +++ + D V  M+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYNKPLLVPGGRAFVWPGIQEVQRISLNTMTLQVESPTVYTSQGVPISVTGIAQVKIQGQNEEMLTAACEQFLGKSENEIQNIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKHVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKSLGKARTAEVKRDARIGEAEARRDAQIKEAIAEEERMAARFLNDTEIAKAQRDFELKKAVYDVEVQTKNAEAEMAFALQAAKTKQRIKEEQMQIKVVERSQEIAVQEQEILRRERELEATVRRPAEAEKYRLEKLAEANRNRIILEAEAESEAIRVRGEAEAFAIQAKAKAEAEQMAKKAEAWSEYREAAMIEMLLDVLPKIAAEVAAPLSQAKKITMVSSGGSEVGAAKLTGEIMSIVSRVPDVVKSMT 415          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A482XPC3 (PHB domain-containing protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR012218 PE=3 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 1.614e-155
Identity = 242/415 (58.31%), Postives = 321/415 (77.35%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LVVSGCC  KPL++ GG+ FVW  +Q  Q++SLN  T+ + SP +YT  GV ++VTG+AQ+KI+G+N  MLLAACEQFLGK D +I +I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL+ MGI+VVSYT+KDI DE+GYLK+LG  RTA+V RDARIGEAEA RDA IK+A A++ QM ++  N+T IAKA RDF+L+KA +D EV T +A AEMAY+LQ AKT Q I EE   I V+ER  +I VQ+ E++R +R+L A+I+  A AEKY+++KLAEA + ++V EAEAE+E+++++GEAEAFA+E   +ADA QM  KAEAW+EY  AA I+M+L  LP +AAEVA PL+  +KITMV +G G++G +KLTGEV+D++  + D V  M+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYNKPLLVPGGRAFVWPTIQCVQRISLNTMTLQVDSPTVYTSQGVPISVTGIAQVKIQGQNEEMLLAACEQFLGKTDAEIQNIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKSLGMARTAEVKRDARIGEAEARRDARIKEAIAEEEQMASRYLNDTEIAKAQRDFELKKAAYDMEVQTKKAEAEMAYELQAAKTKQRIKEEQMQIKVVERTQQIAVQDQEIQRRQRELDATIRRPAEAEKYRLEKLAEANRKRVVMEAEAEAESLRVRGEAEAFAVEAKARADAEQMMKKAEAWREYHDAAVIDMLLETLPKIAAEVAAPLSQAKKITMVQSGSGEVGAAKLTGEVLDIVAKVPDLVKNMT 415          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A4Y5WTR9 (Flotillin-like protein OS=Coleomegilla maculata OX=279632 PE=2 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 1.791e-154
Identity = 241/415 (58.07%), Postives = 318/415 (76.63%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  FVT GPNE LV+SGCC  KPL++ GG+ F+W  VQ+ Q++SLN  T+I+ SP +YT  GV ++VTG+AQ+KI+G+N  MLLAACEQFLGK + +I  I   TLE HQRAIMG MTVEEIY+DRKKFS++VF V+S+DL+ MGI+VVSYT+KDI DE+GYLK+LG  RTA+V RDARIGEAEA  DA IK+A A++ +M +   N+T IAKA RDF+L+KA +D EV T  A AEMAY+LQ AKT Q I EE   I V+ER  +I VQE E+ R ER+L+A+I+  A AEK++++KLAEA   K++ EAEA++E ++L+GEAEA+AIE   +A+A QM  KAEAWKEY++AA I+M L +LP +AAEVA PL+  +KITMVS G GD+G +KLTGEV+D++  +   V  M+
Sbjct:    1 MTWGFVTCGPNEALVISGCCYSKPLLVPGGRAFIWPAVQQIQRISLNTMTLIVDSPTVYTSQGVPISVTGIAQVKIQGQNEEMLLAACEQFLGKPEAEIQHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKSLGMARTAEVKRDARIGEAEARADATIKEAIAEEQRMASVFLNDTEIAKARRDFELKKAAYDVEVQTKNAEAEMAYELQAAKTKQRIKEEQMQIQVVERTQQINVQEQEIARRERELEATIRRPAEAEKFRLEKLAEANHKKVLLEAEADAEAVRLRGEAEAYAIEAKAQAEAEQMAKKAEAWKEYKEAAMIDMFLDVLPKVAAEVAAPLSQAKKITMVSTGSGDVGAAKLTGEVLDIVTKMPMLVKSMT 415          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 414.461 bits (1064), Expect = 3.030e-141
Identity = 216/411 (52.55%), Postives = 312/411 (75.91%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSGC    P+MI GG+ FV   +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML  AC+ FLGK + +IS I   TLE HQRAI+  +TVEEIYQDRKKFSE+VF+V+S+DL+ MGI VVSYT+KD+ D+Q YL++LG+ RTAQV RDARIGEA+  RD+ I++A A Q ++ A+  N   +AKA RD++L+KA +D E++T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +K  A AEKY+++KLAEA + +L+ EAEAE+E+I++KGEAEAFA+E  G+A+A QM  KAEA+K+Y++ A ++M+L  LP +A E+++PL+  QK+TMVS+G  ++G +KLTGEV+D++  L   + K++
Sbjct:    2 FYTCGPNEAMVVSGCGRSPPIMISGGRVFVLPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFLGKTETEISQIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLQSLGKARTAQVQRDARIGEAQYKRDSVIREAHAMQEKVSAQYVNEIEMAKAQRDYELKKAAYDIEINTKKAESEMAYQLQVAKTKQRIEEEKMQVMVVERTQQITLQEQEISRKEKELEAKVKKPAEAEKYRLEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKQYKEGAMVDMLLEKLPLMAEEISKPLSAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPATIEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 408.683 bits (1049), Expect = 5.934e-139
Identity = 214/411 (52.07%), Postives = 312/411 (75.91%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   P+MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ F+GK + +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA   RDA I++A A Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +K  A AE+Y+++KLAEA + +L+ EAEAE+E+I+++GEAEAFA+E  G+A+A QM  KAEA+++Y++ A ++M+L  LP +A E+++PL+   K+TMVS+G  ++G +KLTGEV+D++  L + + K++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 378.637 bits (971), Expect = 1.678e-127
Identity = 202/390 (51.79%), Postives = 298/390 (76.41%), Query Frame = 2
Query:  113 MIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            MI GG+ FV   VQ+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ F+GK + +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA   RDA I++A A Q ++ A+  N   +AKA RDF+L+KA +D EV+T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +K  A AE+Y+++KLAEA + +L+ EAEAE+E+I+++GEAEAFA+E  G+A+A QM  KAEA+++Y++ A ++M+L  LP +A E+++PL+   K+TMVS+G  ++G +KLTGEV+D++  L + + K++
Sbjct:    1 MISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLT 390          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 293.123 bits (749), Expect = 8.452e-94
Identity = 190/418 (45.45%), Postives = 275/418 (65.79%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G  +    +GG  + W  +   QKLSL V TI+     I T  GV L VTGVAQ+K+   ++ +L  ACEQFLGK   +I  +V  TLE H R+I+G +TVE+IYQDR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ ++QKA F++EV+  +A A++AY+LQ AK  Q I  E   I+V++R+ +I ++E E+ R +++L A++K  A AE Y+MQ+LAE  K K V  A+AE+E IK  GEAEA +IE VGKA+A +M MKAEA+ +Y +AAK  +VL  LP +A +VA PL    +I ++S GEG    S++TGEV  ++  L  +VN ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKLSLEVMTILCRCENIETSEGVPLDVTGVAQVKVM-TDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVILS-GEG----SRVTGEVNRLLAELPVSVNALTGVDLTKI 417          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 289.271 bits (739), Expect = 2.403e-92
Identity = 187/418 (44.74%), Postives = 276/418 (66.03%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G  +    +GG  + W  +   QK++L + T+      + T  GVALTVTGVAQ+K+   ++ +L  ACEQFLGK   +I  +V  TLE H R+I+G +TVE+IYQDR +F+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ ++QKA F++EV+  +A A++AY+LQ AK  Q I  E   I+V++R+ +I ++E E+ R +++L A++K  A AE Y+MQ+LAE  K K V  A+AE+E IK  GEAEA +IE VGKA+A +M MKAEA+ +Y +AAK  +VL  LP +A +VA PL    +I ++S GEG    S++TGEV  ++  L  +VN ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKITLEIMTLQPKCEDVETAEGVALTVTGVAQVKVM-TDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVILS-GEG----SRVTGEVNRLLAELPVSVNALTGVDLTKI 417          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 394.815 bits (1013), Expect = 2.878e-134
Identity = 218/399 (54.64%), Postives = 306/399 (76.69%), Query Frame = 2
Query:   86 SGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
             GC    P+ I GG+ FVW  +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ FLGK D++IS I   TLE HQRAIMG MTVEEIY+DRKKFS+EVFRV+S+DL+ MGISVVSYT+KD+ D++ YLK+LG+ RTAQV RDARIGEAE  RDA IK+A A + ++ A+  N   IAKA  +F+L+ A +D EV+T +A A++AY+LQ AKT Q I EE   I V+ER  +I VQE E+ R E++L A IK  A AEKY+++KLAEA + +++ EAEAE+E+IK+KGEAEA+AIE   KA+A QM  KA+A+K+YE+AA ++++L  LP +A EV+QPL+  +K+TM+S+G G++G SKLT EV+D+++ L ++V +++
Sbjct:    5 PGCGRSPPITITGGRVFVWPIIQQLQRISLNTMTLNVRSEKVYTRQGVPISVTGIAQVKIQGQNKDMLAAACQMFLGKGDEEISQIALETLEGHQRAIMGNMTVEEIYKDRKKFSQEVFRVASSDLLNMGISVVSYTLKDVRDDEDYLKSLGKARTAQVQRDARIGEAEMKRDAGIKEAMAVEQKVAAQYLNEIEIAKAQLEFELKTAAYDMEVNTQKAQADLAYQLQVAKTKQKIEEEKMQILVVERTQQILVQEQEILRREKELDAKIKKPAEAEKYRLEKLAEAGRARVIMEAEAEAESIKIKGEAEAYAIEAKAKAEAEQMLQKAQAFKDYEEAAMVDLLLETLPKIATEVSQPLSKARKVTMISSGGGEVGASKLTSEVLDIMSKLPESVERLT 403          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 272.707 bits (696), Expect = 1.335e-86
Identity = 183/411 (44.53%), Postives = 273/411 (66.42%), Query Frame = 2
Query:   56 TSGPNEVLVVSG--CCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            T GPNE LVVSG  C   +   + GG  +VW  V + Q++SL + T+      + T  GVALTVTGVAQ+K+   ++ +L  ACEQFLG+  D+I  +V  TLE H R+I+G +TVE +YQDR +F++ V  V+S D+  MGI ++S+TIKD+ D+  YL +LG+T+ A V RDA IG A+A RDA I++A+ ++  M  K   +T IA + R++++QKA F++E  T +A A++AY+LQ AK  Q I +E   I+V++R  +I V+E E++R ER+L A+++  A AE +++Q++AE  K K V  A+A++E IK  G+AEA AIE +G+A+A +M +KAEA+K+Y KAA I MVL  LP +AAEVA PL    +I ++S GEG+    + T EV  ++  L   V  ++
Sbjct:    6 TVGPNEALVVSGGWCGADEKKYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVTGVAQVKVM-TDKDLLAVACEQFLGRTVDEIKSVVLQTLEGHLRSILGTLTVEAVYQDRDQFAQLVREVASPDVGRMGIEILSFTIKDVYDKVEYLASLGKTQAALVKRDAEIGVAQAERDAGIREAECKKNMMDVKFNADTKIANSKREYEMQKAFFNQESQTKKAEAQLAYELQAAKEQQKIRQEECQIEVVQRRKQIDVEEREIQRTERELIATVRCPAQAEAFRVQQIAEGDKIKRVLAAQADAERIKKIGDAEAAAIEAIGRAEAEEMRLKAEAYKQYGKAAIISMVLDALPKIAAEVAAPLQKIDEIVILS-GEGN----RTTTEVTRLLAELPTTVQALT 410          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 427.172 bits (1097), Expect = 1.215e-146
Identity = 234/411 (56.93%), Postives = 314/411 (76.40%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSGC   +P ++ GG+ FVW   Q+ Q++SLN  T+ + SP++YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+QFLGK  +    I   TLE HQRAIMG MTVEEIY+DRKKFS+ VF V+S+DL+ MGIS+VSYTIKDI DE+GYL ALG +RTAQV RDARIGEAEA RD+ IK+A A++A++ AK  N+T IAKA RDF+L+KA +D EV T  A ++MAY LQ A T Q I EE   I V+ER  +I+VQE E+ R ER+L+A+++  A AEKY+++KLAEA + +++ EAEA+SE IK+KG+AEAFAIE   KA+A QM  KA+AWKEY +AA ++MVL  +P +AAE+A PL+   KITMVSNG+G++G SK+TGE++D++  L  AV  ++
Sbjct:    4 FNTCGPNEAMVVSGCFHARPALVSGGRIFVWPVFQKLQRISLNTMTLNVESPRVYTRHGVPISVTGIAQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEEIYRDRKKFSKSVFEVASSDLVNMGISIVSYTIKDIRDEEGYLHALGMSRTAQVKRDARIGEAEAKRDSGIKEAIAEEARLKAKYENDTQIAKAKRDFELKKAGYDIEVQTKNATSQMAYNLQAAVTKQKIKEEEMQIKVVERGQQIKVQEQEIARRERELEATVRQPAEAEKYRLEKLAEANRNRVILEAEAQSEAIKVKGDAEAFAIEAKAKAEAEQMAKKADAWKEYREAAIVDMVLETMPKIAAEIAAPLSQVNKITMVSNGKGEVGASKVTGEILDIVAKLPKAVEALT 414          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 296.59 bits (758), Expect = 1.028e-95
Identity = 184/418 (44.02%), Postives = 270/418 (64.59%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLGKPL--MIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G      +IGG  F W  V   Q +SL V T+      + T  GVA+TVTGVAQ+K+  + R +L  ACEQFLGK    I  +V  TLE H RAI+G ++VEEIY+DR+ F+  V  V+S D+  MGI ++S+TIKDI D   YL +LG+T+TA+V RDA IG AEA RDA I++A+ ++ +M       T IA ++R++Q+QKA +D+EV+T +A AE++Y+LQ  K  Q I  E   I+V+ER  +I+VQE E++R E++L A +K  A AE Y+++ LA+  +T+ V  A+A++E IKL G +EA AIE +GKA+A +M  KA A+K Y  AA   ++L  LP +AAEVA PL    +I ++ N +G+     ++GE+  ++  L  A+  ++ +++  +
Sbjct:    6 TVGPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVTGVAQVKVMTEPR-LLKTACEQFLGKTTRQIESVVLQTLEGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDVVYETQTNIADSSREYQMQKAAYDQEVNTRKAEAELSYELQGNKEKQKIRSEEIQIEVVERRKQIEVQEKEIQRKEKELIAEVKRPAEAESYKVETLAQGKRTQTVFLAQADAERIKLIGSSEASAIEAIGKAEAERMRQKAAAYKMYGDAAMTALILEALPKVAAEVAAPLAKTGEIVII-NDDGN----SVSGELSKLLGQLPPAIQALTGTDLSGV 417          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO25979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD74])

HSP 1 Score: 67.3958 bits (163), Expect = 2.026e-14
Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2
Query:  413 DRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRD 604
            DR+ F+  V  V+S D+  MGI ++S+TIKDI D   YL +LG+T+TA+V RDA IG AEA RD
Sbjct:    1 DREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRD 64          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 417.542 bits (1072), Expect = 2.032e-142
Identity = 216/411 (52.55%), Postives = 315/411 (76.64%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSG C   PLMI GG+ FV+  +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ F+GK + +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA   RDA I++A A Q ++ A+  N+  +AKA RD++L+KA +D EV+T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +Q+ E+ R E++L+A +K  A AE+Y+ +KLAEA + K++ EAEAE+E+I++KGEAEA+AIE +G+A+A QM  KAEA+++Y+  A ++M++  LP +A E+++PL+   KITMVS+G G+IG +KL+GEV+D++  L +AV K++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPLMIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLT 412          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1b (flotillin-1 [Source:NCBI gene;Acc:101157726])

HSP 1 Score: 410.609 bits (1054), Expect = 3.555e-139
Identity = 214/411 (52.07%), Postives = 313/411 (76.16%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F T GPNE +VVSGC    PLMI GG+ FV+  +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML  AC+ F+GK + +IS+I   TLE HQRAI+  +TVEEIYQDRKKFSE+VF+V+S+DL+ MGI VVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA+  RD+ IK+A+A Q ++ A+  N   +AKA RD++L+KA +DKEV+  +A +EMAY+LQ AKT Q I EE   + V+ER  +I +QE E+ R E++L+A +   A AE+Y+++KLAEA + +L+ EAEAE+E+IK+KGEAEAFA+E  G+A+A QM  KAEA+K+Y++ A ++++L  LP +A  +++PL++ QKITMVS+G  ++G +KL GEV+D++  +  A+ K++
Sbjct:   40 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVFPCIQKIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFMGKSEREISEIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLNSLGKARTAQVQKDARIGEAQYKRDSVIKEARAMQEKVSAQYKNEIEMAKAQRDYELKKAAYDKEVNAKKAESEMAYQLQVAKTKQCIEEEKMQVLVVERTQQIMLQEQEIIRKEKELEAKVMKPADAERYRLEKLAEAQRAQLIMEAEAEAESIKMKGEAEAFAMEAKGRAEAEQMAKKAEAFKQYKEGAMVDLLLEKLPLMAEAISEPLSHAQKITMVSSGGSEVGAAKLAGEVLDIMTRVPSALEKLT 450          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 385.956 bits (990), Expect = 1.980e-130
Identity = 203/390 (52.05%), Postives = 301/390 (77.18%), Query Frame = 2
Query:  113 MIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            MI GG+ FV+  +Q+ Q++SLN  T+ + S K+YT+ GV ++VTG+AQ+KI+G+N+ ML AAC+ F+GK + +I+ I   TLE HQRAI+  +TVEEIY+DRKKFSE+VF+V+S+DL+ MGISVVSYT+KD+ D+Q YL +LG+ RTAQV +DARIGEA   RDA I++A A Q ++ A+  N+  +AKA RD++L+KA +D EV+T +A +EMAY+LQ AKT Q I EE   + V+ER  +I +Q+ E+ R E++L+A +K  A AE+Y+ +KLAEA + K++ EAEAE+E+I++KGEAEA+AIE +G+A+A QM  KAEA+++Y+  A ++M++  LP +A E+++PL+   KITMVS+G G+IG +KL+GEV+D++  L +AV K++
Sbjct:    1 MIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLT 390          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 297.36 bits (760), Expect = 1.366e-95
Identity = 188/411 (45.74%), Postives = 275/411 (66.91%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            T GPNE LVVSG C G  +   ++GG  + W  +   Q++SL V TI+     I T  GV L VTGVAQ+K+    R +L  ACEQFLGK   +I  ++  TLE H RAI+G +TVE+IYQDR KF+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ ++QKA F++EV+T +A A++AY+LQ AK  Q I  E   I+V++R+ +I ++E E+ R E++L A++K  A AE Y+MQ+LAE  K K V  A+AE+E I+  GEAEA +IE VGKA+A +M +KAEA+++Y +AAK  +VL  LP +A +VA PL+   +I ++S G+G    S++TGEV  ++  L  +VN ++
Sbjct:    6 TVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVTGVAQVKVM-TERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVILS-GDG----SRVTGEVNRLLAELPVSVNALT 410          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 293.508 bits (750), Expect = 5.134e-94
Identity = 186/418 (44.50%), Postives = 279/418 (66.75%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLG--KPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            T GPNE LVVSG C G  +   ++GG  + W  +   Q+++L + T+      + T  GVA+TVTGVAQ+K+    R +L  ACEQFLGK   +I  ++  TLE H RAI+G +TVE+IYQDR KF+  V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+T+TA V RDA IG AEA RDA I++A+ ++  M  K   +T +A + R+ ++QKA F++EV+T +A A++AY+LQ AK  Q I  E   I+V++R+ +I ++E E+ R E++L A++K  A AE Y+MQ+LAE  K K V  A+AE+E I+  GEAEA +IE VGKA+A +M +KAEA+++Y +AAK  +VL  LP +A +VA PL+   +I ++S G+G    S++TGEV  ++  L  +VN ++  ++  I
Sbjct:    6 TVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVM-TERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVILS-GDG----SRVTGEVNRLLAELPVSVNALTGVDLMKI 417          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000063612.1 (SMESG000063612.1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 417/420 (99.29%), Postives = 418/420 (99.52%), Query Frame = 2
Query:   44 MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 1303
            MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVW GVQ YQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQMHAKLANNTAIAKA+RDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI
Sbjct:    1 MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWSGVQTYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQMHAKLANNTAIAKADRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMSRSEMKSI 420          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000062944.1 (SMESG000062944.1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.985e-152
Identity = 234/411 (56.93%), Postives = 314/411 (76.40%), Query Frame = 2
Query:   50 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            F+  GPNE +VVSGC   KP+MI GG+KFVW  + + QK+SLN  T+II SP+IYT+LGV +TVTGVAQIKI G ++ ML  ACEQFLGK +D+I DI + TLEAHQRAIMG MTVEEIY+DRKKFS  VF V+S+D++ MGISVVSYT+KDI D++GYLKALG+ RTAQV RDARIGEAEA +D+ IK+A A+Q +  A+ +N+  IAK++RD++L+KA F+KEV T  A ++ +Y +Q AKT Q I EE   I VIER  +I+V+ LE+ R ++ L+A+++  A AEKY+++KL EA   ++  EAEAE+E IKLKG AEA AI +  +ADA QM +KAEAW+EY++AA++ M L MLP LAAEVA P++NC KI+M+  G G+IG SKLT E+++++  L   +  ++
Sbjct:    5 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILLRAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTTEILEIMEKLPGVIQSIT 415          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 434.106 bits (1115), Expect = 5.915e-149
Identity = 238/415 (57.35%), Postives = 317/415 (76.39%), Query Frame = 2
Query:   38 LSMPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            ++  F T GPNE +V+SG   GKP +I GG+ FV   +QR  ++SLN+ T+ I SP+IYT+LGV +TVTGVAQ+KI+  N+ ML  ACEQFLG+    I D+ + TLE HQRAIMG MTVEEIY DRKKFS+ VF V+S+DL+ MGISVVSYT+KDI D++GYLK+LG  RTAQV RD RIGEAEA RDA IK+A+A++AQ+ +KLAN T IA+A RDFQL+KA +DKE+ T +A ++++Y LQ A T Q I EE   I V+ER  ++++QELE++R +++L+A ++  A AE Y++QK+AEA K +++ EAE ESETI+L GEA AFAIE + KA+A Q+  KAEAWK+Y  AAK+EM L+ LP LAAEVA PL++C KITMVS+G GD+G +K+TGEVI ++  L + V  M+
Sbjct:    1 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQVKIQSSNKEMLATACEQFLGRSVHQIMDVAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMT 415          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000064151.1 (SMESG000064151.1)

HSP 1 Score: 416.772 bits (1070), Expect = 2.502e-142
Identity = 230/413 (55.69%), Postives = 304/413 (73.61%), Query Frame = 2
Query:   44 MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            MPF T GPNE+LVVSG    +PLM+ GG+KFV+   Q+ Q+LSLN+ TI++ SP IYTKLG+ LT TGVAQ+KI       L  AC  +L  K + I+DI + TLE HQRAIMG+MTVEEIYQDRKKF+  VF V+S DL  MG+ VVSYTIK++SDE+GYL +LG +RT+QV RDARIGEAEA RDA +K+A A++ +  ++L N T IA+A RDF ++KA ++KE+ T +A  E+AY+LQ AKT Q IM E   I V+ERE  I VQ+LE++R ER+L ++++ Q  AEKY+M+K+A A K + V EAEA +ET KL+GEAEAFAI    KA+A QM  KAE+WKEY +AAK+E+ LS LP +AAEVA PLT+  KITMVSN    IG++K++ E++ V++ +   V  M+
Sbjct:    1 MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGLMTVEEIYQDRKKFANAVFEVASRDLFQMGLQVVSYTIKELSDEEGYLNSLGMSRTSQVKRDARIGEAEARRDASVKQAAAEKLETISQLENKTKIAQAERDFSIKKAEYEKEIKTRQAETELAYRLQAAKTRQQIMLEEMQIKVVEREQMITVQDLEIQRRERELDSTVRKQVEAEKYKMEKIAYAEKIRAVREAEASAETTKLRGEAEAFAILEKAKAEAEQMAKKAESWKEYTEAAKLELFLSTLPKIAAEVANPLTSVSKITMVSNDNSPIGITKISDEILSVMDRIPKLVQNMT 413          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000024114.1 (SMESG000024114.1)

HSP 1 Score: 298.516 bits (763), Expect = 5.471e-96
Identity = 183/411 (44.53%), Postives = 267/411 (64.96%), Query Frame = 2
Query:   56 TSGPNEVLVVSGCCLGKPLM--IIGGKKFVWRGVQRYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDXXXXXXXXXXXXXXXXXXNNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMXXXXXXXXXXXXXXXMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 1282
            T GPNE L +SG C G   M  IIGG  + W  V + QK+SL V T+      + TK GV LTVTGVAQ+K+  +   +L  ACEQFLG++  +I + +  TL+ H RAI+G +TVE IYQDR +F+ +V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+ +TA V RDA IG AEA RDA I++A+ ++A+M  +   +T IA A R +QLQKA FD EV    A AE+A++LQ AK  Q I  E   I+V+ER+  I+++E E+ R E++L+ ++K  A AE ++ + LA+A +TK V  A+ E+E+I+LKG AEA ++  +GKA+A +M +KA A+ +Y  AA + +VL  LP +AAE+  PL    +I ++  G G    S LTGE+  ++ NL  AV  M+
Sbjct:    6 TVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEP-SLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVIL--GSGSDSKSDLTGEITRLLGNLPPAVQAMT 413          
The following BLAST results are available for this feature:
BLAST of Flotillin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT11.001e-13751.09flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.001e-13751.09flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.001e-13751.09flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.001e-13751.09flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.001e-13751.09flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo11.424e-14658.07gene:FBgn0024754 transcript:FBtr0087351[more]
Flo14.496e-14457.52gene:FBgn0024754 transcript:FBtr0087352[more]
Flo23.741e-8942.34gene:FBgn0264078 transcript:FBtr0073952[more]
Flo23.741e-8942.34gene:FBgn0264078 transcript:FBtr0073950[more]
Flo26.809e-8942.34gene:FBgn0264078 transcript:FBtr0330217[more]
back to top
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b5.824e-14253.28flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot1a1.984e-14152.55flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a3.579e-14152.55flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot2a4.193e-9043.54flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot2b3.620e-8543.45flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot12.607e-12851.44flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot12.721e-12851.44flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot11.796e-12751.44flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot13.987e-12752.74flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot13.978e-12652.78flotillin 1 [Source:NCBI gene;Acc:733927][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot11.040e-13851.34flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot15.340e-10844.53flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot23.046e-8943.54flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot21.552e-8843.06flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot12.188e-7660.00flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
back to top
BLAST of Flotillin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61491|FLOT1_DROME1.427e-14558.07Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|Q7YR41|FLOT1_PANTR4.606e-13851.34Flotillin-1 OS=Pan troglodytes OX=9598 GN=FLOT1 PE... [more]
sp|Q5TM70|FLOT1_MACMU4.606e-13851.34Flotillin-1 OS=Macaca mulatta OX=9544 GN=FLOT1 PE=... [more]
sp|O08917|FLOT1_MOUSE7.275e-13851.34Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1... [more]
sp|Q08DN8|FLOT1_BOVIN7.428e-13851.34Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV... [more]
back to top
BLAST of Flotillin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068CQN60.000e+084.52Flotillin-1 OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A1B6G9M75.369e-15858.16PHB domain-containing protein OS=Cuerna arida OX=1... [more]
E0VW733.719e-15658.07Flotillin-1, putative OS=Pediculus humanus subsp. ... [more]
A0A482XPC31.614e-15558.31PHB domain-containing protein OS=Laodelphax striat... [more]
A0A4Y5WTR91.791e-15458.07Flotillin-like protein OS=Coleomegilla maculata OX... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b3.030e-14152.55flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
flot1a5.934e-13952.07flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot1a1.678e-12751.79flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot2a8.452e-9445.45flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2a2.403e-9244.74flotillin 2 [Source:NCBI gene;Acc:103045282][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot1b2.878e-13454.64flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a1.335e-8644.53flotillin 2a [Source:NCBI gene;Acc:245698][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471821.215e-14656.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376881.028e-9544.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259792.026e-1454.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a2.032e-14252.55flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1b3.555e-13952.07flotillin-1 [Source:NCBI gene;Acc:101157726][more]
flot1a1.980e-13052.05flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot2a1.366e-9545.74flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a5.134e-9444.50flotillin 2 [Source:NCBI gene;Acc:101169802][more]
back to top
BLAST of Flotillin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063612.10.000e+099.29SMESG000063612.1[more]
SMESG000062944.11.985e-15256.93SMESG000062944.1[more]
SMESG000004975.15.915e-14957.35SMESG000004975.1[more]
SMESG000064151.12.502e-14255.69SMESG000064151.1[more]
SMESG000024114.15.471e-9644.53SMESG000024114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007718 ID=SMED30007718|Name=Flotillin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1571bp
GAGATTTGTTTATCCATATTAATTTTTTTAATTAAAATTATCTATGCCTT
TTGTGACTTCAGGACCAAATGAAGTTTTGGTTGTATCAGGATGCTGTTTA
GGGAAGCCTCTAATGATAATTGGTGGCAAAAAGTTTGTTTGGAGAGGCGT
TCAAAGATACCAAAAGCTGTCACTAAATGTGAAAACTATTATTATTGTTA
GTCCTAAAATATACACGAAATTGGGTGTTGCACTAACAGTTACTGGAGTT
GCTCAAATAAAAATTGAAGGAAAAAACCGACATATGCTATTAGCCGCATG
TGAACAGTTTTTGGGAAAGAAAGATGATGATATTTCTGACATTGTTAGAG
CAACTTTGGAAGCTCATCAAAGAGCAATAATGGGAATTATGACGGTTGAA
GAAATTTATCAAGATCGCAAAAAGTTTTCGGAAGAAGTTTTTCGAGTTTC
GTCCACAGATTTGATGGGAATGGGAATTAGTGTTGTCAGTTACACAATTA
AAGATATTTCCGATGAACAAGGATATTTAAAAGCACTCGGTCAAACTCGA
ACTGCTCAAGTCATTCGAGATGCCAGAATTGGCGAAGCTGAAGCTACTCG
AGATGCAGAGATAAAGAAAGCACAAGCTCAACAAGCTCAAATGCATGCAA
AACTGGCTAATAATACTGCAATAGCAAAAGCAAACAGAGATTTTCAATTA
CAGAAAGCAATTTTCGATAAGGAAGTTCACACGAATGAGGCAATTGCTGA
AATGGCCTATAAATTACAAGAAGCGAAGACCAATCAATTGATAATGGAAG
AAACGAAGCATATCGATGTCATCGAAAGGGAGTGCCGCATTCAAGTCCAG
GAACTGGAAGTGAAGCGATTGGAAAGGCAATTGCAAGCGTCGATAAAAAA
TCAAGCACTAGCAGAAAAGTATCAAATGCAAAAGCTTGCAGAAGCAATGA
AAACCAAACTAGTTAACGAAGCGGAGGCAGAATCGGAAACGATAAAGCTG
AAAGGAGAAGCGGAAGCGTTTGCAATTGAAATTGTCGGCAAAGCTGATGC
AGCTCAAATGACGATGAAAGCGGAAGCTTGGAAGGAATATGAGAAAGCAG
CAAAAATCGAAATGGTGCTGTCAATGTTGCCTTCACTTGCTGCCGAAGTG
GCCCAGCCGCTGACGAATTGCCAGAAGATTACAATGGTATCTAATGGTGA
AGGTGACATCGGGGTTTCCAAACTGACTGGGGAAGTAATCGATGTCATCA
ACAATCTATCTGATGCCGTTAACAAGATGTCGCGCAGTGAAATGAAGAGC
ATTTAAAATCTTTTCCTACCGAAATAGAACAATAAATTAATTGATTTTGT
CTCTATTTCACAAAAAGAATGTAGTTGATGTGTTGCACTTTTTGATAAAT
ATTATTGATTGATTGCTGAATAGAATTTTTCTTATGACTTTTGCAGTATG
AAGTGCGCTGTTGATGATTATTAAATGTGAATGTGCAGCTTTTAGTTGTT
AGTCAATCAAACAGATTGGACAGTGAGAAATTTATTATTGATTATTTTAT
ATTTTATACCTTCGCGCTGCC
back to top

protein sequence of SMED30007718-orf-1

>SMED30007718-orf-1 ID=SMED30007718-orf-1|Name=SMED30007718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWRGVQRYQKLSLNVKTII
IVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDI
VRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSY
TIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQM
HAKLANNTAIAKANRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLI
MEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAE
AMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYE
KAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVID
VINNLSDAVNKMSRSEMKSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0042470melanosome
GO:0045121membrane raft
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
GO:0016600flotillin complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
IPR031905Flotillin_C
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 259..286
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 42..159
e-value: 8.8E-35
score: 121.4
NoneNo IPR availablePANTHERPTHR13806:SF16FLOTILLIN-1coord: 2..417
NoneNo IPR availableCDDcd03399SPFH_flotillincoord: 31..176
e-value: 3.36538E-57
score: 182.704
IPR031905Flotillin, C-terminal domainPFAMPF15975Flotcoord: 311..386
e-value: 1.1E-6
score: 28.9
IPR001107Band 7 domainPFAMPF01145Band_7coord: 7..185
e-value: 1.6E-16
score: 60.8
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 2..417
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 36..176