DNA excision repair protein ERCC-6-like

Overview
NameDNA excision repair protein ERCC-6-like
Smed IDSMED30007712
Length (bp)3965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA excision repair protein ERCC-6-like (SMED30007712) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA excision repair protein ERCC-6-like (SMED30007712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA excision repair protein ERCC-6-like (SMED30007712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA excision repair protein ERCC-6-like (SMED30007712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007712SMESG000014388.1 SMESG000014389.1 SmedASXL_018185SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007712SMESG000014388.1 SMESG000014389.1 SmedASXL_018185SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007712SMESG000014389.1 Contig45750uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007712SMESG000014389.1 Contig45750newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007712SMESG000014389.1 Contig48950uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007712SMESG000014389.1 Contig48950newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30007712SMESG000014388.1 SMESG000014389.1 dd_Smed_v4_3110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 313/584 (53.60%), Postives = 417/584 (71.40%), Query Frame = 1
Query:  838 DDADYEEFCSRI-------IEHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXX--XXXXXXXGTASDTSIMFRGS 2535
            DD D + +  R+       ++ K + +    D  + D   E + GF V   ++ KL+ YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G NY    +GP +IVCP TVM QW+ EF  W P FRVA+LH TGS   K E+L+  +AH  G+LIT+YS + L    ++RYDW Y+ILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DFI+PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR K++V+  L LP K EQVLFC LT  Q++VY+ ++ S++  +I+ G+   F GL+ LRKICNHPDL +GGPK +   P         D+    +FG++ RSGKM+VV+ LL++W++   +VLLF+Q R ML IL+ F+  Q Y+   MDGTT I SR  ++ ++N+      F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+ DL +       D   +++TS +F G+
Sbjct:  454 DDGDEDYYKQRLRRWNKLRLQDKEKRLKLEDDSEESD--AEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVMHQWVKEFHTWWPPFRVAILHETGSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLIALRKICNHPDLFSGGPKNLKGLP--------DDELEEDQFGYWKRSGKMIVVESLLKIWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNED--TSIFVFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLTSPDASQSTETSAIFAGT 1025          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Match: ERCC6L (ERCC excision repair 6 like, spindle assembly checkpoint helicase [Source:HGNC Symbol;Acc:HGNC:20794])

HSP 1 Score: 338.191 bits (866), Expect = 3.929e-96
Identity = 193/556 (34.71%), Postives = 300/556 (53.96%), Query Frame = 1
Query:  943 NPGFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKL-GSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQ------------------------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVL--------------DHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            N G ++   + N+L+ +Q+ G+ +L  L+ +G  GGIL D+MGLGKT+Q+IAFL+G+  +   N+    VL++ P  ++  W+ EF  W P  RV   H  G   D+  R L  I    GV+ITTY  ++ +   L+ +      W Y+ILDE HKIK  + K   C +     +RL+++G+PIQNNL+ELWSL DF   G L G+L +F   +  PI +   + A+P +    ++ +  +   I  Y LRRTK +V+ +                        L RK + +++  L   Q E+YR++++    K+++   + P   L +L+K+C+HP L++    C+L              D P +    + TDD           SGKM+ + +LL+      H+ L+F+Q R +L I++R ++ + +    +DGT T +  R   ++ F  +  K+  +FLLTT+VGG+GL L  A RV++FDP WNP TD QA +R +RIGQ   VV+YRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:   83 NSGLLLYRELHNQLFEHQKEGIAFLYSLYRDGRKGGILADDMGLGKTVQIIAFLSGMFDASLVNH----VLLIMPTNLINTWVKEFIKWTPGMRVKTFH--GPSKDERTRNLNRIQQRNGVIITTYQMLINNWQQLSSFRGQEFVWDYVILDEAHKIKTSSTKSAICARAIPASNRLLLTGTPIQNNLQELWSLFDFACQGSLLGTLKTFKMEYENPITRAREKDATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPSLSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSARACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTL------MEESGKMIFLMDLLKRLRDEGHQTLVFSQSRQILNIIERLLKNRHFKTLRIDGTVTHLLEREKRINLFQQN--KDYSVFLLTTQVGGVGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVFKDSLIRQTTGEKKNP--FRYFSKQ 622          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Match: ERCC6L (ERCC excision repair 6 like, spindle assembly checkpoint helicase [Source:HGNC Symbol;Acc:HGNC:20794])

HSP 1 Score: 310.457 bits (794), Expect = 2.435e-87
Identity = 179/515 (34.76%), Postives = 274/515 (53.20%), Query Frame = 1
Query: 1063 MGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKL-GSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQ------------------------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVL--------------DHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            MGLGKT+Q+IAFL+G+  +   N+    VL++ P  ++  W+ EF  W P  RV   H  G   D+  R L  I    GV+ITTY  ++ +   L+ +      W Y+ILDE HKIK  + K   C +     +RL+++G+PIQNNL+ELWSL DF   G L G+L +F   +  PI +   + A+P +    ++ +  +   I  Y LRRTK +V+ +                        L RK + +++  L   Q E+YR++++    K+++   + P   L +L+K+C+HP L++    C+L              D P +    + TDD           SGKM+ + +LL+      H+ L+F+Q R +L I++R ++ + +    +DGT T +  R   ++ F  +  K+  +FLLTT+VGG+GL L  A RV++FDP WNP TD QA +R +RIGQ   VV+YRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:    1 MGLGKTVQIIAFLSGMFDASLVNH----VLLIMPTNLINTWVKEFIKWTPGMRVKTFH--GPSKDERTRNLNRIQQRNGVIITTYQMLINNWQQLSSFRGQEFVWDYVILDEAHKIKTSSTKSAICARAIPASNRLLLTGTPIQNNLQELWSLFDFACQGSLLGTLKTFKMEYENPITRAREKDATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPSLSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSARACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTL------MEESGKMIFLMDLLKRLRDEGHQTLVFSQSRQILNIIERLLKNRHFKTLRIDGTVTHLLEREKRINLFQQN--KDYSVFLLTTQVGGVGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVFKDSLIRQTTGEKKNP--FRYFSKQ 499          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Match: SMARCA1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:HGNC Symbol;Acc:HGNC:11097])

HSP 1 Score: 294.664 bits (753), Expect = 3.070e-82
Identity = 174/512 (33.98%), Postives = 265/512 (51.76%), Query Frame = 1
Query:  934 IEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLL----ESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
             E++P +V        L  YQ  G+ WL+ L++NG  GIL DEMGLGKT+Q IA L  L   +      GP +++ P + +  WM+EF+ W P  RV          DK  R      E +     V +T+Y  ++    +  ++ W+Y+++DE H+IKN  +K++   ++F++ +RL+++G+P+QNNL ELW+L++F+ P    S   F   F      G  +    L               +  +LLRR K +VE  LP K E  ++ GL+  Q E Y + L         +G+  ++    ++M LRK CNHP L  G   GP    D  I+                  S SGKMVV+ +LL        +VL+F+Q   +L IL+ +   +GY  C +DG T    R   ++ FN +P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ + V ++RL+   +VEE+I  R   K  L + +++  R
Sbjct:  171 FEVSPSYVKGGP----LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIP---GPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVG-----DKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHA------------VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIV------------------SNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREEAIEAFN-APNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGR 639          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Match: ERCC6L2 (ERCC excision repair 6 like 2 [Source:HGNC Symbol;Acc:HGNC:26922])

HSP 1 Score: 286.574 bits (732), Expect = 3.440e-82
Identity = 183/562 (32.56%), Postives = 287/562 (51.07%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIG--------------PV--------LIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQII---------AGQQ-----------------VPFPGLVMLRKICNHPDLVTGGPKCVLDHPILG------FAR-----EATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            G  +  +I   L  YQ+ G R+L   + +G G ILGD+MGLGKT+QVI+FLA +   KG   DI               P+        LIV P +V+  W DE   W   FRV +LH    G  K   L+        + +TTY ++ L    L   +W  +I+DE H+IKNP A+VT   K  +   R+ ++G+ +QNN+KELW ++D+  PG LGS   F + F+ P+  G    A+  ++ T  +    +   ++ + LRRTK  ++ QLP+K +++++C LT  Q  VY+  L +     I+         +GQ+                 +    L +L+K+ NH  L+           ++       F+R     + + D           SGKM V+++LL    + + KVLLF+    +L +L+++    G     +DG+T    R  IV +FN +  ++  I L++T  GGLGLN VGA+ V++FDP WNP  DLQA +RA+RIGQ R V + RL+  G+VEE +Y RQ++KQ L   ++ +   +R+F+
Sbjct:  112 GDSIPYTINRYLRDYQREGTRFLYGHYIHGGGCILGDDMGLGKTVQVISFLAAVLHKKGTREDIENNMPEFLLRSMKKEPLSSTAKKMFLIVAPLSVLYNWKDELDTWG-YFRVTVLH----GNRKDNELIRVKQRKCEIALTTYETLRLCLDELNSLEWSAVIVDEAHRIKNPKARVTEVMKALKCNVRIGLTGTILQNNMKELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQRLAKKMSGWFLRRTKTLIKDQLPKKEDRMVYCSLTDFQKAVYQTVLETEDVTLILQSSEPCTCRSGQKRRNCCYKTNSHGETVKTLYLSYLTVLQKVANHVALLQAASTSKQQETLIKRICDQVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHCRKNRDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNST--QDVNICLVSTMAGGLGLNFVGANVVVLFDPTWNPANDLQAIDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQIYKQQLHCVVVGSENAKRYFE 666          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Match: csb-1 (CSB (Cockayne Syndrome B) homolog [Source:UniProtKB/TrEMBL;Acc:Q93781])

HSP 1 Score: 347.051 bits (889), Expect = 1.087e-101
Identity = 199/559 (35.60%), Postives = 302/559 (54.03%), Query Frame = 1
Query:  835 VDDADYEEFCSRIIEHKNQLIAAAADQHQC--DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYD---IGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHA----------TGSGYDKPERLLESIAHHP--GVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRG-KHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRF 2451
            +DD D + F +RI + K +  +   D      +E  + +  + V + +WNKL+ +QQ GV WL +  D+ +GGIL DEMGLGKTIQ + FL  +  +   +Y    +   LIVC  +++ QW+ E   W P  RV LLH+           GS + K +R  +    +P   +++TTYS        + ++ WQ +ILDEGH I+N N K +   ++  T  R I++G+P QN L E W LVDF++PG+L   A+F +NF   I  G   + SP     AY C   +   +   +LRR + + +  LQLP K E VL C L+  Q  +Y EY  S Q  +II  +   F G+  L  ICNHP                G  R  +    S KFG    SGK+ +  +L   W++   ++V+LFTQ R ++ +++ F+ ++G    ++ G  +  +R  I+ KF D    +  +FL+TTR GGLGLNL  A++V++FDPDWNP  D QA+ R +R+GQ   V IYRLV +G++E+  + +QV K+ L  R+L N    +F
Sbjct:  143 LDDNDSKNFKARIDKLKPEATSELVDTRMVTSEEYGKSSKPWKVNAGVWNKLHKFQQEGVEWLQKKTDHRSGGILADEMGLGKTIQSVVFLRSIQETARTHYKTTGLDTALIVCHVSIIAQWIKELNQWFPKARVFLLHSHCSTGRQEDYVGSIFRKLQRRRK---EYPDGAIILTTYSLFTKLKKPIVKHLWQVVILDEGHYIRNENTKCSIAMRKLMTTQRFILTGTPFQNRLSEFWKLVDFVHPGRLSDSATFHRNFTHIINAGANLNCSPEAAAKAYECLVALHIAVKPLILRRLQEDHKEVLQLPEKQEIVLSCELSKRQRRLYMEYGNSHQVNEIIERRLKAFVGINHLTNICNHP----------------GIYRSLS--PASPKFGSIKDSGKVEMTFKLFDDWFKSPTNRVILFTQRRTVITMMEYFLAEKGIKCVSLTGADSAAARPKIIKKFEDDVSIK--VFLMTTRAGGLGLNLTCANKVIIFDPDWNPQADNQAKNRIYRMGQTNDVAIYRLVSNGTIEDLKFFKQVQKENLAARLLHNAEIDQF 678          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 294.664 bits (753), Expect = 2.787e-81
Identity = 172/488 (35.25%), Postives = 264/488 (54.10%), Query Frame = 1
Query:  982 LYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQ-FETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAY---RCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCK-QIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            L  YQ  G+ W++ L++N   GIL DEMGLGKTIQ I+ +  L   K  N   GP L++ P + +  W +EF  WAP     +   T     + E  +   A +  VL+TTY  ++    LL +  W+Y+I+DEGH++KN N K+T      F  +HRL+++G+P+QN L ELW+L++F+ P    S  +F Q F  P    G E     Q ET     R   V+R     +LLRR K EVE QLP KTE V+ C  +  Q  +YR          ++ +G +     +V LRK+CNHP L        ++     + +    +G          +GK+ ++  +L       H++L+F Q   M+ I + F+  + Y+   +DG+T    R  ++ +FN +P  + F+F+L+TR GGLGLNL  AD V++FD DWNP  D+QA++RA RIGQ ++V + RL+ + SVEEKI     +K  +  ++++
Sbjct:  533 LKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNN---GPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRVEGQIRKGAFN--VLMTTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTG-EKVELNQEETMLIIRRLHKVLRP----FLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQKGLLLDAKMSSGARSLMNTVVHLRKLCNHPFLFPN-----IEDSCRAYWKVNEVNGTDL----MRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFN-APNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDEKVIQ 1000          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 283.108 bits (723), Expect = 1.447e-77
Identity = 175/498 (35.14%), Postives = 254/498 (51.00%), Query Frame = 1
Query:  976 NKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDI-GPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG--------VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLAS--RQCKQIIAGQQVPFPGLVM-LRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELL-RLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            +KL  YQ  G+ W++     G   IL DEMGLGKTIQ I+ LA L       YD+ GP L+V P + M  W  EF  WAP   + +        D    ++       G         ++TTY  ++     L+  DW  +++DE H++KN  + +     QF   H+L+++G+P+QN+LKELW+L+ FI P K                   +E       E+ ++    +   +  +LLRR K +VE  LP KTEQ+L   +T HQ + Y+  L    R+  + + G    F  LVM L+K CNH  L         DH          DD           SGK++++ +LL RL  +G H+VL+F+Q  MML IL+ +++ + +    +DG+     R   +D +N +P    F FLL+TR GGLG+NL  AD V++FD DWNP  DLQA  RA RIGQ + V IYRLV  GSVEE+I  R   K  L + +++
Sbjct:  403 HKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFH----RYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRD----MIRQYEWFVGGTKKMKINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDC----------------WEEFETAHNESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGSINGFVNLVMELKKCCNHASLTRQ-----YDH--------IYDDAQGRLQQLLKSSGKLILLDKLLCRLKDKG-HRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYN-APGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQ 861          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 278.485 bits (711), Expect = 1.799e-77
Identity = 166/502 (33.07%), Postives = 260/502 (51.79%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAG----QQVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            ++  YQ  G+ WL  L  N   GIL DEMGLGKT+Q I+ +  +   K       P L++ P + ++ W +EF+ W P     +L    +  ++  R +  +     V  TTY  M+     L + +W+YII+DE H+IKN  +K++   ++  + +RL+++G+P+QNNL ELW+L++F+ P    S   F   F+   M G  +    L               +  +LLRR K++VE  L  K E  ++ GL+  Q E Y + L   +   II G    ++     ++M LRK  NHP L  G   GP    D  ++                    SGKMVV+ +LL  +     +VL+F+Q   ML +L+ F   + Y  C +DG+T    R   ++ +N +P  + FIF+LTTR GGLG+NL  AD V+++D DWNP +DLQA +RA RIGQ ++V ++RL+   +V+E+I  +   K  L N +++  R     KT
Sbjct:  131 EMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNK---ASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDV-ILPQKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLH------------KVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLM--KDIDIINGAGKVEKARLMNILMHLRKCVNHPYLFDGAEPGPPFTTDQHLV------------------DNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYN-APDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKT 595          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 282.337 bits (721), Expect = 5.276e-77
Identity = 174/492 (35.37%), Postives = 264/492 (53.66%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATG-SGYDKPERLLESIAHHP--GVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCK-QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAY---RCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCK-QIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            KL  YQ  G+ W++ L +N   GIL DEMGLGKTIQ IAF+  L   K  +   GP L++ P + +  W +EF  WA     A +H     G  +  ++ E I       VL+TT+  ++    LL +  W+Y+I+DEGH++KN + K+T     +F+ + RL+++G+P+QN L ELW+L++F+ P    S ++F Q F  P    G E     Q ET     R   V+R     +LLRR K EVE +LP K E V+ C ++  Q  +Y+          +   G +     ++ LRK+CNHP L            +    R   D         +  SGK+ ++  +L       H+VL+F Q   M+ I++ F+         +DG+T    R A++DKFN +P  E F+F+L+TR GGLGLNL  AD V++FD DWNP  D+QA++RA RIGQ  +V ++RL+ + SVEEKI     +K  +  ++++
Sbjct: 1200 KLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFITYLMEIKKTS---GPFLVIVPLSTVPNWQNEFDKWA-----ANVHLIAYKGPKETRKVFEPIIKSGKFNVLLTTFEYVIREKALLGKLRWKYMIIDEGHRLKNQHCKLTEMLNTRFQCQRRLLITGTPLQNKLPELWALLNFLLPSIFSSCSTFEQWFNAPFATTG-EKVELTQEETMLIIRRLHKVLR----PFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLYKHMQKGLLLDGKTNTGSKSLRNTMIHLRKLCNHPFLFEN---------VEESCRNFWDARFISAVDLYRVSGKLELLSRILPKLQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFN-APNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDEKVIQ 1668          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087841)

HSP 1 Score: 281.567 bits (719), Expect = 2.097e-78
Identity = 165/499 (33.07%), Postives = 264/499 (52.91%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAG----QQVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            ++  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q I+ L  L   K      GP +++ P + ++ W++EF+ W P  R   L       D     +  +   PG   V +T+Y   +    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELW+L++F+ P    S   F + F      G     + L               +  +LLRR KAEVE +L  K E  +F GL+  Q + Y + L   +   ++ G    +++    ++M LRK  NHP L  G   GP    D  ++                    SGKM ++ +LL        +VL+F+Q   ML IL+ +   + Y+ C +DG T    R+  + +FN D+  K  F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++RL+   +VEEKI  R   K  L   +++  R
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKN---QAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIG---DQDTRNTFIRDVLM-PGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHA------------VLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLL--KDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLV------------------YNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK--FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGR 584          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087842)

HSP 1 Score: 281.567 bits (719), Expect = 2.097e-78
Identity = 165/499 (33.07%), Postives = 264/499 (52.91%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAG----QQVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            ++  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q I+ L  L   K      GP +++ P + ++ W++EF+ W P  R   L       D     +  +   PG   V +T+Y   +    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELW+L++F+ P    S   F + F      G     + L               +  +LLRR KAEVE +L  K E  +F GL+  Q + Y + L   +   ++ G    +++    ++M LRK  NHP L  G   GP    D  ++                    SGKM ++ +LL        +VL+F+Q   ML IL+ +   + Y+ C +DG T    R+  + +FN D+  K  F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++RL+   +VEEKI  R   K  L   +++  R
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKN---QAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIG---DQDTRNTFIRDVLM-PGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHA------------VLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLL--KDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLV------------------YNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK--FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGR 584          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087843)

HSP 1 Score: 281.567 bits (719), Expect = 2.097e-78
Identity = 165/499 (33.07%), Postives = 264/499 (52.91%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAG----QQVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            ++  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q I+ L  L   K      GP +++ P + ++ W++EF+ W P  R   L       D     +  +   PG   V +T+Y   +    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELW+L++F+ P    S   F + F      G     + L               +  +LLRR KAEVE +L  K E  +F GL+  Q + Y + L   +   ++ G    +++    ++M LRK  NHP L  G   GP    D  ++                    SGKM ++ +LL        +VL+F+Q   ML IL+ +   + Y+ C +DG T    R+  + +FN D+  K  F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++RL+   +VEEKI  R   K  L   +++  R
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKN---QAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIG---DQDTRNTFIRDVLM-PGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHA------------VLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLL--KDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLV------------------YNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK--FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGR 584          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Match: okr (gene:FBgn0002989 transcript:FBtr0077673)

HSP 1 Score: 274.633 bits (701), Expect = 1.389e-77
Identity = 167/511 (32.68%), Postives = 270/511 (52.84%), Query Frame = 1
Query:  955 VVASSIWNKLYGYQQAGVRWLLQLHD----NGAGGILGDEMGLGKTIQVIAFLAGLSRS-KGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG-----VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIA-----GQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSR--SGKMVVVKELLR-LWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKN 2433
            VV   + N L  +Q+ GVR++ +  +    N  G I+ DEMGLGKT+Q +  +  L R        I   ++V P+++++ W  EF  W    R+  L   G   +   R LE  +         VL+ +Y +  ++  +L +Y+   +I DEGH++KN +          +T+ R+++SG+PIQN+L E +SLV+F+ P  LG+ A F +NF   I++G    ++  + + A      +   +++ ++RRT   +   LP K E V+   LT  Q E+Y  +L S Q ++ +A             +  L+KIC+HPDL+       L     GF         +YK    +   SGK +++  +L  +   G  KV+L +     L + ++   ++ Y    +DGT +I  R  +VD+FND P  ++F+F+L+++ GG GLNL+GA+R+ +FDPDWNP  D QA  R WR GQ +   IYRLV SGS+EEKI  RQ  K+ L++ I+ N
Sbjct:  147 VVDPLLSNILRPHQREGVRFMYECVEGKRGNFNGCIMADEMGLGKTLQCVTLVWTLLRQGPECKPTINKAIVVSPSSLVKNWEKEFTKWLH-GRLLCLPMEGGTKENTIRALEQFSMTSARLGTPVLLISYETFRIYAEILCKYEVGMVICDEGHRLKNSDNLTYQALMGLKTKRRVLLSGTPIQNDLTEYYSLVNFVNPEMLGTAAVFKRNFESAILRGQNTDSTEQERQRAIEKTQELIGLVDQCIIRRTNQILTKYLPVKFEMVICAKLTAIQLELYTNFLKSDQVRRSLADCNEKASLTALADITTLKKICSHPDLIYEK----LTAREKGFENSQNVLPSNYKPKDLNPELSGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDN 651          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075524)

HSP 1 Score: 275.789 bits (704), Expect = 5.048e-75
Identity = 171/496 (34.48%), Postives = 259/496 (52.22%), Query Frame = 1
Query:  982 LYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESI--AHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCK-QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLA--------SRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGH--FSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            L  YQ  G+ WL+ L++N   GIL DEMGLGKTIQ I+ +  L   K     +GP LI+ P + +  W+ EF  WAP   V     +  G     RLL++   A    VL+TTY  ++    +L +  W+Y+I+DEGH++KN + K+T      +   +RL+++G+P+QN L ELW+L++F+ P    S ++F Q F  P    G      L  E        +   +  +LLRR K EVE QLP K E ++ C ++  Q  +Y+   +        S + K    G +     +V LRK+CNHP +     +   DH            GH    G   +  SGK  ++  +L       H+VLLF Q    + I++ ++  + +    +DGTT    R  ++ KFN +   + F+FLL+TR GGLGLNL  AD V++FD DWNP  DLQA++RA RIGQ  +V + RL+   SVEE+I     +K  +  ++++
Sbjct:  769 LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKV---MGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQG----RRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTG--EKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDH----------TGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQ 1244          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 319/562 (56.76%), Postives = 407/562 (72.42%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSK----GGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            DD D E +  RI + K Q +     + +             DEG +I PGF     +W KL+ YQQ GVRW+ +LH   AGGILGDEMGLGKTIQ+IAFLAGLS SK    G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  I    G+LIT+YS + +    + RYDW Y+ILDEGHKI+NPNA VT  CKQF T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL TGGP+ +   P      + T++ H   FG++ RSGKM+VV+ LLRLW++  H+VLLFTQ R ML+IL+ F+++ G+S   MDGTT I SR  ++ +FN +  K+ F+F+LTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  429 DDGDIECYRQRIRKWKRQRLREKEAKREAGEEESDESDAEFDEGFKI-PGF-----LWKKLFKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKLKTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHDTGSFTSKKEKLIPEIVASHGILITSYSYIRIMQDYIQRYDWHYVILDEGHKIRNPNAGVTTACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYANASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEDQRQVYQTFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFTGGPRLLRGIP----HDQLTEEEH---FGYWKRSGKMIVVESLLRLWHKQGHRVLLFTQSRQMLEILEVFVKENGFSYLKMDGTTTIASRQPLIAQFNQN--KDIFVFILTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKQQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 975          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 503.827 bits (1296), Expect = 1.233e-159
Identity = 253/478 (52.93%), Postives = 325/478 (67.99%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSK----GGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN--DSPYKEAFIFLL 2202
            DD D E +  RI + K Q +     + +             DEG +I PGF     +W KL+ YQQ GVRW+ +LH   AGGILGDEMGLGKTIQ+IAFLAGLS SK    G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  I    G+LIT+YS + +    + RYDW Y+ILDEGHKI+NPNA VT  CKQF T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL TGGP+ +   P      + T++ H   FG++ RSGKM+VV+ LLRLW++  H+VLLFTQ R ML+IL+ F+++ G+S   MDGTT I SR  ++ +FN  +   +  F++ +
Sbjct:  430 DDGDIECYRQRIRKWKRQRLREKEAKREAGEEESDESDAEFDEGFKI-PGF-----LWKKLFKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKLKTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHDTGSFTSKKEKLIPEIVASHGILITSYSYIRIMQDYIQRYDWHYVILDEGHKIRNPNAGVTTACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYANASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEDQRQVYQTFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFTGGPRLLRGIP----HDQLTEEEH---FGYWKRSGKMIVVESLLRLWHKQGHRVLLFTQSRQMLEILEVFVKENGFSYLKMDGTTTIASRQPLIAQFNQVNKRLRSVFVYFV 894          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 484.567 bits (1246), Expect = 6.027e-153
Identity = 235/415 (56.63%), Postives = 299/415 (72.05%), Query Frame = 1
Query:  991 YQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSK----GGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN--DSPYKEAFIFLL 2202
            YQQ GVRW+ +LH   AGGILGDEMGLGKTIQ+IAFLAGLS SK    G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  I    G+LIT+YS + +    + RYDW Y+ILDEGHKI+NPNA VT  CKQF T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL TGGP+ +   P      + T++ H   FG++ RSGKM+VV+ LLRLW++  H+VLLFTQ R ML+IL+ F+++ G+S   MDGTT I SR  ++ +FN  +   +  F++ +
Sbjct:  443 YQQTGVRWMWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKLKTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHDTGSFTSKKEKLIPEIVASHGILITSYSYIRIMQDYIQRYDWHYVILDEGHKIRNPNAGVTTACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYANASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEDQRQVYQTFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFTGGPRLLRGIP----HDQLTEEEH---FGYWKRSGKMIVVESLLRLWHKQGHRVLLFTQSRQMLEILEVFVKENGFSYLKMDGTTTIASRQPLIAQFNQVNKRLRSVFVYFV 850          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Match: ercc6l (excision repair cross-complementation group 6-like [Source:NCBI gene;Acc:100005291])

HSP 1 Score: 339.347 bits (869), Expect = 6.267e-96
Identity = 195/561 (34.76%), Postives = 306/561 (54.55%), Query Frame = 1
Query:  943 NPGFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLL-----TRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGK-LGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--------------------------LQLP---RKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREA------TDDGHS--YKFGHFS------RSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            N G  +   +++KLY +Q+ GV +L  L+ +G  GGIL D+MGLGKTIQVI+FL+G+  ++  N+     L+V P ++++ W+ EF  W P  RV   H  GS   +  R LE I    GV+ITTY  ++ ++  L       + W Y+ILDE HKIK  + K          ++R++++G+P+QNNL+E+W+L DF   G  LG+  +F   +  PI +   + A+P +     R +  + D I  Y LRRTKA+V+                          +++P   RK + +++  L+  Q ++Y ++++  Q K+++   + P   L +L+K+C+HP L++   + V+    LG  R +      +D+  S   +  + S       SGK+  V  L+       H+ L+F+Q R ML I++R +  + + +  +DGT T +  R   +  F     K   IFLLTT+VGG+G+ L GA+RV++FDP WNP TD QA +RA+RIGQ   V+IYRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:   92 NSGLKLYKGLYDKLYDHQKEGVAFLYSLYRDGRKGGILADDMGLGKTIQVISFLSGMYDAELANH----TLLVMPTSLIKNWVREFAKWTPGMRVKEFH--GSSKTERNRNLERIQRKGGVIITTYQMLINNYEQLGSNGHREFKWDYVILDEAHKIKTSSTKTAKSAHAIPAKNRVLLTGTPVQNNLREMWALFDFACQGSLLGTSKTFKTEYENPITRAREKDATPGEKALGLRISQNLTDIIKPYFLRRTKADVQQKKLKLEEGFEEEEDQENKCPNAREGVEMPSLTRKNDLIVWTYLSSVQEDIYNKFISLDQIKELLTTTRSPLAELTVLKKLCDHPRLLS--QRAVIQ---LGLERGSDSELVHSDESESAVSQIDNISDHTLIEESGKLQFVVSLMECLREEGHRTLIFSQSRKMLDIMERVLRNRNFRLLRLDGTVTQLAEREKRISLFQTD--KRYTIFLLTTQVGGVGITLTGANRVVIFDPSWNPATDAQAVDRAYRIGQTENVIIYRLITCGTVEEKIYRRQVFKDSLIRQTTGDKKNP--FRYFSKQ 637          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Match: smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:ZFIN;Acc:ZDB-GENE-070705-296])

HSP 1 Score: 293.123 bits (749), Expect = 4.953e-82
Identity = 172/496 (34.68%), Postives = 267/496 (53.83%), Query Frame = 1
Query:  982 LYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLD-HPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            L  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q IA L  L   +      GP +++ P + +  WM+EF+ W P  +   L   G+  ++   + + +   PG   V +T+Y  ++    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELWSL++F+ P    S + F   F    +            +   R   V+R     +LLRR KAEVE  LP K E  ++ GL+  Q E Y   L         AG+  ++    ++M LRK CNHP L  G   GP    D H ++                    SGKMV + +LL        +VL+F+Q   +L IL+ +   +G+  C +DG T   +R   +D FN +P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ + V ++RL+   +VEE+I  R   K  L + +++  R
Sbjct:  143 LRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIP---GPHMVLVPKSTLHNWMNEFKRWVPTLKAVCL--IGNKDERAAFIRDVMM--PGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIAREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNCLGDQ---------KLVERLHAVLR----PFLLRRIKAEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVIN-------------------SGKMVALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGFEYCRLDGNTPHEAREQAIDAFN-APNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQRKPVKVFRLITDNTVEERIVERAEMKLRLDSIVIQQGR 598          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 317/554 (57.22%), Postives = 407/554 (73.47%), Query Frame = 1
Query:  907 ADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTA--SDTSIMFRGS 2535
            A +   D  +E + GF +  SIW KLY YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G +Y    +GP +IVCPATVM QW+ EF  W P FRV +LH TGS   K  +L+  + +  G+LIT+YS + L    L +Y W YIILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ ++ S++   I+ G+   FPGL+ LRKICNHPDL +GGPK      IL   R+  D     +FG + RSGK++VV+ LL++W+R  H+VLLFTQ R MLQIL+ F+  + YS   MDGTT I SR  ++ K+N+ P    F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+ DL +LF      T+  ++TS +F G+
Sbjct:  442 ATEESEDSDVEFDEGFSIPCSIWKKLYKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSRIRTRGSDYRYEGLGPSIIVCPATVMHQWVKEFHTWWPQFRVVILHETGSYAGKKVKLIGELGNGCGILITSYSYVRLMQEELQKYHWHYIILDEGHKIRNPNAGVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKADVKMSLALPDKNEQVLFCRLTDEQRQVYQTFIDSKEVYGILNGEMQVFPGLIALRKICNHPDLFSGGPK------ILKGTRDE-DLEEEEQFGFWKRSGKLIVVEALLKIWHRQGHRVLLFTQSRQMLQILEVFVRSRCYSYLKMDGTTTIASRQPLIAKYNEDP--SLFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTFSSPDTSHGTETSAIFAGT 986          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 317/554 (57.22%), Postives = 407/554 (73.47%), Query Frame = 1
Query:  907 ADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTA--SDTSIMFRGS 2535
            A +   D  +E + GF +  SIW KLY YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G +Y    +GP +IVCPATVM QW+ EF  W P FRV +LH TGS   K  +L+  + +  G+LIT+YS + L    L +Y W YIILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ ++ S++   I+ G+   FPGL+ LRKICNHPDL +GGPK      IL   R+  D     +FG + RSGK++VV+ LL++W+R  H+VLLFTQ R MLQIL+ F+  + YS   MDGTT I SR  ++ K+N+ P    F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+ DL +LF      T+  ++TS +F G+
Sbjct:  442 ATEESEDSDVEFDEGFSIPCSIWKKLYKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSRIRTRGSDYRYEGLGPSIIVCPATVMHQWVKEFHTWWPQFRVVILHETGSYAGKKVKLIGELGNGCGILITSYSYVRLMQEELQKYHWHYIILDEGHKIRNPNAGVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKADVKMSLALPDKNEQVLFCRLTDEQRQVYQTFIDSKEVYGILNGEMQVFPGLIALRKICNHPDLFSGGPK------ILKGTRDE-DLEEEEQFGFWKRSGKLIVVEALLKIWHRQGHRVLLFTQSRQMLQILEVFVRSRCYSYLKMDGTTTIASRQPLIAKYNEDP--SLFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTFSSPDTSHGTETSAIFAGT 986          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 529.25 bits (1362), Expect = 6.976e-166
Identity = 270/547 (49.36%), Postives = 351/547 (64.17%), Query Frame = 1
Query:  907 ADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTA--SDTSIMFRGS 2535
            A +   D  +E + GF +  SIW KLY Y+                                               +GP +IVCPATVM QW+ EF  W P FRV +LH TGS   K       + +  G+LIT+YS + L    L +Y W YIILDEGHKI+NPNA VT  CKQ               NNL+ELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ ++ S++   I+ G+   FPGL+ LRKICNHPDL +GGPK      IL   R+  D     +FG + RSGK++VV+ LL++W+R  H+VLLFTQ R MLQIL+ F+  + YS   MDGTT I SR  ++ K+N+ P    F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+ DL +LF      T+  ++TS +F G+
Sbjct:  419 ATEESEDSDVEFDEGFSIPCSIWKKLYKYE----------------------------------------------GLGPSIIVCPATVMHQWVKEFHTWWPQFRVVILHETGSYAGK------KLGNGCGILITSYSYVRLMQEELQKYHWHYIILDEGHKIRNPNAGVTLACKQ---------------NNLRELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKADVKMSLALPDKNEQVLFCRLTDEQRQVYQTFIDSKEVYGILNGEMQVFPGLIALRKICNHPDLFSGGPK------ILKGTRDE-DLEEEEQFGFWKRSGKLIVVEALLKIWHRQGHRVLLFTQSRQMLQILEVFVRSRCYSYLKMDGTTTIASRQPLIAKYNEDP--SLFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTFSSPDTSHGTETSAIFAGT 889          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Match: unnamed1012533 (Putative ortholog of ancient conserved domain protein 2, 2 of 2 [Source:Xenbase;Acc:XB-GENE-1012534])

HSP 1 Score: 347.051 bits (889), Expect = 1.017e-98
Identity = 201/551 (36.48%), Postives = 307/551 (55.72%), Query Frame = 1
Query:  940 INPGFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRY-----DWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKL-GSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQ------------------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHS---------YKFGHFS------RSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            +N G  + + ++NKL+ +Q+ GV +L  L+ +G  GGIL D+MGLGKTIQVI FL+G+  S+   Y    VL+V P T++  W+ EF+ W P  RVA  H  G+   +  R LE I    G++ITTY  ++ +   L  Y     +W YIILDE HKIK  + K    C     ++R++++G+PIQNNL+E+W+L DF   G L G+  +F   +  PI +   + A+P +     + +  +   I  Y LRRTK++V+ +                  L RK + +++  L+  Q +VYR++++  Q K+++   + P   L +L+K+C+HP L++    C+     LG      DD HS          KF H S       SGK++++ +LL       H+ L+F+Q R ML ++ R ++ + + +  +DGT A+  R   +  F  +      + LLTT+VGG+GL L  ADRV++FDP WNP TD QA +RA+RIGQ   VVIYRL+  G+VEEKIY RQ+FK+ L  +     KNP   R+F  Q
Sbjct:   93 LNSGLTIYNELYNKLFEHQKEGVAFLYSLYRDGRKGGILADDMGLGKTIQVIGFLSGMFDSELIKY----VLLVMPTTLISNWVKEFQKWTPGLRVAEFH--GTSKKERTRNLEKIQRMSGIIITTYQMLINNWQQLATYNGREFEWDYIILDEAHKIKTSSTKTAKSCHSIPAKNRILLTGTPIQNNLREMWALYDFACQGTLLGTSKTFKMEYENPITRAREKDATPGEKALGLKISENLMKIIQPYFLRRTKSDVQNKKTERTRAQDTSQGPSMPSLTRKNDFIVWVYLSTIQEDVYRKFISLDQIKELLMTTRSPLAELNILKKLCDHPRLLSARA-CIQ----LGLE---GDDYHSNEEGDHELVTKFDHLSDEILIEESGKLLLLIDLLHKLKEEGHRTLVFSQSRKMLDMIDRILQNKNFKVMRIDGTVALPEREKRISIFQSN--NNYSVLLLTTQVGGVGLTLTAADRVVIFDPSWNPATDAQAVDRAYRIGQQENVVIYRLITCGTVEEKIYRRQIFKESLIRQTTGDKKNP--FRYFSKQ 625          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:Xenbase;Acc:XB-GENE-5781886])

HSP 1 Score: 303.908 bits (777), Expect = 2.832e-85
Identity = 192/566 (33.92%), Postives = 289/566 (51.06%), Query Frame = 1
Query:  943 NPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDI-------------------GP---VLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLAS---------------------RQC--KQIIAGQQVP---FPGLVMLRKICNHPDLV---TGGPKCVLDH----------PILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            N    V  +I   L  YQ+ G+ +L +      G ILGD+MGLGKTIQVIAFLA +   KG   DI                    P    LIV P +V+  W DE   W   FR+ L+H    G  K   +         + +TTY ++ L    +   DW  +++DE H+IKNP A+VT   K+   + R+ ++G+ +QNN++ELW ++D+  PG LGS + F + F+ P+  G   +A+  ++ T  +    + + ++ + LRRTKA +  QLP+K ++++FC L+  Q  VY+  L +                     R+C  K+ + G+ V    F  L +LRK+ NH  L+   T   K    H              F R++ D        +   SGKM V+++LL    + K KVLLF+    +L +L+R+    G     +DG T    R  IV +FN    ++  I L++T  GGLGLN +GA+ V+VFDP WNP  DLQA +RA+RIGQ R V ++R V  G+VEE IY RQV+KQ L   ++ +   +R+F+
Sbjct:   97 NTAVSVPYTINRYLRDYQRDGITFLYKHFSRSVGCILGDDMGLGKTIQVIAFLAAILGKKGTREDIENNMPEFLLRTVKKVCSSSSPKKVFLIVSPLSVLYNWKDELETWG-YFRLTLIH----GNKKDSEISRLKQGKFEIALTTYETLRLCLDEINSIDWSAVVVDEVHRIKNPKARVTQVMKEIRCKVRIGLTGTILQNNMEELWCVMDWAVPGYLGSSSQFKEKFSNPVEYGQRHNATKRELATGRKAIQTLANKLSPFFLRRTKALISQQLPKKEDRIIFCSLSEFQKAVYQTVLETQDVNLVLQGGEPCSCKSGRKRRKCCYKENMFGESVRTLYFSYLAILRKVANHAALLQTDTSTSKKQEAHIKRVCNEVFSKFPEFVRQSKDAAFE-TLSNPRYSGKMKVLQQLLNHCRKNKDKVLLFSFSTKLLDVLERYSMASGLDYRRLDGNTKAEERMKIVKEFN--TMQDVNICLVSTMAGGLGLNFIGANVVVVFDPTWNPANDLQAIDRAYRIGQCRDVKVFRFVSLGTVEEMIYLRQVYKQQLQCAVVGSENAKRYFE 654          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Match: Ercc6 (excision repair cross-complementing rodent repair deficiency, complementation group 6 [Source:MGI Symbol;Acc:MGI:1100494])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 303/517 (58.61%), Postives = 385/517 (74.47%), Query Frame = 1
Query:  937 EINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            E + GF V   ++ KL+ YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G NY    +GP +IVCP TVM QW+ EF  W P FRVA+LH TGS   K ERL+  I +  GVLIT+YS + L    ++R+DW Y+ILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DFI+PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR K++V+  L LP K EQVLFC LT  Q++VY+ ++ S+   +I+ G+   F GLV LRKICNHPDL +GGPK     P         D+    +FGH+ RSGKM+VV+ LL++W+R   +VLLF+Q R ML IL+ F+    YS   MDGTT I SR  ++ K+N+      F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  488 EFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTIIVCPTTVMHQWVKEFHTWWPPFRVAVLHETGSYTHKKERLIRDIVYCHGVLITSYSYIRLMQDDISRHDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFIDSKAVYRILNGENQIFSGLVALRKICNHPDLFSGGPKNASGPP--------EDELEEEQFGHWRRSGKMIVVESLLKIWHRQGQRVLLFSQSRQMLHILEVFLRAHKYSYLKMDGTTTIASRQPLITKYNED--TSIFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 994          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Match: Ercc6l (excision repair cross-complementing rodent repair deficiency complementation group 6 like [Source:MGI Symbol;Acc:MGI:2654144])

HSP 1 Score: 329.717 bits (844), Expect = 2.048e-93
Identity = 190/550 (34.55%), Postives = 296/550 (53.82%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKL-GSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE------------------------LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFA----REATDDGHSYKFGHF------SRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            G ++   ++ KL+ +Q+ G+ +L  L+ +G  GGIL D+MGLGKT+Q+IAFL+G+  +   N+    VL++ P  ++  W++EF  W P  RV   H  GS   +  R L  I    GV+ITTY  ++ +   L  ++     W Y+ILDE HKIK+ + K   C +     +RL+++G+P+QNNL+ELWSL DF   G L G+L +F   +  PI++   + A+P +     + +  + + I  Y LRRTK EV+                          L RK + +++  L   Q E+YR++++    K+++   + P   L +L+K+C+HP L++     +L+     F+     E  D  +     H         SGKM+ +  LL       H+ L+F+Q   +L I++R ++ + +    +DGT T +  R   +  F  +  KE  +FLLTT+VGG+GL L  A RV++FDP WNP TD QA +R +RIGQ   VV+YRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:   86 GLLLYRELYEKLFEHQKEGIAFLYSLYKDGRKGGILADDMGLGKTVQIIAFLSGMFDASLVNH----VLLIMPTNLINTWVNEFAKWTPGMRVKTFH--GSSKSERTRSLTRIQQRNGVVITTYQMLLNNWQQLASFNGQAFVWDYVILDEAHKIKSASTKSAVCARAIPASNRLLLTGTPVQNNLQELWSLFDFACQGSLLGTLKTFKMEYEHPIIRAREKDATPGEKALGLKISENLMEIIKPYFLRRTKEEVQTKKADNPEARLGEKNPAGEAICDMFSLARKNDLIVWIRLLPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSARACRLLNLGTATFSAQDENEQEDVSNMNSIDHLPDKTLIQESGKMIFLMSLLERLQDEGHQTLVFSQSIKILNIIERLLKNKHFKTLRIDGTVTHLWEREKRIQLFQQN--KEYSVFLLTTQVGGVGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVFKDSLIRQTTGEKKNP--FRYFTKQ 625          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Match: Ercc6l2 (excision repair cross-complementing rodent repair deficiency, complementation group 6 like 2 [Source:MGI Symbol;Acc:MGI:1923501])

HSP 1 Score: 292.352 bits (747), Expect = 2.118e-84
Identity = 186/561 (33.16%), Postives = 284/561 (50.62%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDI---------------------GPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPG--------------------------LVMLRKICNHPDLVTGGPKCVLDHPILG------FAR-----EATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            G  +  +I   L  YQ+ G ++L + +  G G ILGD+MGLGKTIQVI+FLA +   KG   DI                        LIV P +V+  W DE   W   FRV +LH    G  K   LL        + +TTY ++ L    L   +W  II+DE H+IKNP A+VT   K  + + R+ ++G+ +QNN+KELW ++D+  PG LGS   F + F+ P+  G    A+  ++ T  +    +   ++ + LRRTK  ++ QLP+K +++++C LT  Q  VY+  L +     I+   Q    G                          L +L+K+ NH  L+           ++       F+R     + + D           SGKM V+++LL  + + + KVLLF+    +L +L+++    G     +DG+T    R  IV +FN S  ++  I L++T  GGLGLN VGA+ V++FDP WNP  DLQA +RA+RIGQ R V + RL+  G+VEE +Y RQV+KQ L   ++ +   +R+F+
Sbjct:  111 GDSIPYTINRYLRDYQREGAQFLYRHYIEGRGCILGDDMGLGKTIQVISFLAAVLHKKGTREDIENNMPEFLLKSMKKKPPSTAKKMFLIVAPLSVLYNWKDELDTWG-YFRVTVLH----GSKKDNELLRLKQRKCEIALTTYETLRLCLEELNSLEWSAIIVDEAHRIKNPKARVTEVMKAVKCKVRIGLTGTVLQNNMKELWCVMDWAVPGLLGSRIHFKKQFSDPVEHGQRHTATKRELATGRKAMHRLAKKMSGWFLRRTKTLIKGQLPKKEDRMVYCSLTDFQKAVYQTVLETEDVALILTSSQPCTCGSGQKRRKCCYKTNSRGDTVRTLCLSYLTVLQKVANHVALLQAASTSKHQETVIKRICDRVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHFRKQRDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSS--QDVNICLVSTMAGGLGLNFVGANVVILFDPTWNPANDLQAVDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQVYKQQLHCVVVGSENAKRYFE 664          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Match: Smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:MGI Symbol;Acc:MGI:1935129])

HSP 1 Score: 291.967 bits (746), Expect = 1.374e-81
Identity = 175/531 (32.96%), Postives = 272/531 (51.22%), Query Frame = 1
Query:  877 EHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERL-LESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            E   +L+  ++         E +P +V     W KL  YQ  G+ WL+ L++NG  GIL DEMGLGKT+Q I+ L  +   +      GP +++ P + +  WM EF+ W P  R   L       DK +R         PG   V +T+Y  ++    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELWSL++F+ P    S   F   F      G  +    L +             +  +LLRR KA+VE  LP K E  ++ GL+  Q E Y   L         AG+  ++    ++M LRK CNHP L  G   GP    D  ++                  + SGKMVV+ +LL        +VL+F+Q   +L IL+ +   + Y  C +DG T    R   ++ +N+ P    F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ + V ++R +   +VEE+I  R   K  L + +++  R
Sbjct:  148 EEDEELLTESSKATNVCTRFEDSPSYVK----WGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIP---GPHMVLVPKSTLHNWMSEFKKWVPTLRSVCLIG-----DKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHM------------VLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLV------------------TNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNE-PNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGR 635          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Match: Ercc6l2 (excision repair cross-complementing rodent repair deficiency, complementation group 6 like 2 [Source:MGI Symbol;Acc:MGI:1923501])

HSP 1 Score: 296.204 bits (757), Expect = 1.747e-81
Identity = 186/561 (33.16%), Postives = 284/561 (50.62%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGP---------------------VLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPG--------------------------LVMLRKICNHPDLVTGGPKCVLDHPILG------FAR-----EATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            G  +  +I   L  YQ+ G ++L + +  G G ILGD+MGLGKTIQVI+FLA +   KG   DI                        LIV P +V+  W DE   W   FRV +LH    G  K   LL        + +TTY ++ L    L   +W  II+DE H+IKNP A+VT   K  + + R+ ++G+ +QNN+KELW ++D+  PG LGS   F + F+ P+  G    A+  ++ T  +    +   ++ + LRRTK  ++ QLP+K +++++C LT  Q  VY+  L +     I+   Q    G                          L +L+K+ NH  L+           ++       F+R     + + D           SGKM V+++LL  + + + KVLLF+    +L +L+++    G     +DG+T    R  IV +FN S  ++  I L++T  GGLGLN VGA+ V++FDP WNP  DLQA +RA+RIGQ R V + RL+  G+VEE +Y RQV+KQ L   ++ +   +R+F+
Sbjct:  111 GDSIPYTINRYLRDYQREGAQFLYRHYIEGRGCILGDDMGLGKTIQVISFLAAVLHKKGTREDIENNMPEFLLKSMKKKPPSTAKKMFLIVAPLSVLYNWKDELDTWG-YFRVTVLH----GSKKDNELLRLKQRKCEIALTTYETLRLCLEELNSLEWSAIIVDEAHRIKNPKARVTEVMKAVKCKVRIGLTGTVLQNNMKELWCVMDWAVPGLLGSRIHFKKQFSDPVEHGQRHTATKRELATGRKAMHRLAKKMSGWFLRRTKTLIKGQLPKKEDRMVYCSLTDFQKAVYQTVLETEDVALILTSSQPCTCGSGQKRRKCCYKTNSRGDTVRTLCLSYLTVLQKVANHVALLQAASTSKHQETVIKRICDRVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHFRKQRDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSS--QDVNICLVSTMAGGLGLNFVGANVVILFDPTWNPANDLQAVDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQVYKQQLHCVVVGSENAKRYFE 664          
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Match: sp|Q03468|ERCC6_HUMAN (DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 313/584 (53.60%), Postives = 417/584 (71.40%), Query Frame = 1
Query:  838 DDADYEEFCSRI-------IEHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXX--XXXXXXXGTASDTSIMFRGS 2535
            DD D + +  R+       ++ K + +    D  + D   E + GF V   ++ KL+ YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G NY    +GP +IVCP TVM QW+ EF  W P FRVA+LH TGS   K E+L+  +AH  G+LIT+YS + L    ++RYDW Y+ILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DFI+PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR K++V+  L LP K EQVLFC LT  Q++VY+ ++ S++  +I+ G+   F GL+ LRKICNHPDL +GGPK +   P         D+    +FG++ RSGKM+VV+ LL++W++   +VLLF+Q R ML IL+ F+  Q Y+   MDGTT I SR  ++ ++N+      F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+ DL +       D   +++TS +F G+
Sbjct:  454 DDGDEDYYKQRLRRWNKLRLQDKEKRLKLEDDSEESD--AEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVMHQWVKEFHTWWPPFRVAILHETGSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLIALRKICNHPDLFSGGPKNLKGLP--------DDELEEDQFGYWKRSGKMIVVESLLKIWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNED--TSIFVFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLTSPDASQSTETSAIFAGT 1025          
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Match: sp|F8VPZ5|ERCC6_MOUSE (DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 303/517 (58.61%), Postives = 385/517 (74.47%), Query Frame = 1
Query:  937 EINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            E + GF V   ++ KL+ YQQ GVRWL +LH   AGGILGDEMGLGKTIQ+IAFLAGLS    R++G NY    +GP +IVCP TVM QW+ EF  W P FRVA+LH TGS   K ERL+  I +  GVLIT+YS + L    ++R+DW Y+ILDEGHKI+NPNA VT  CKQF T HR+I+SGSP+QNNL+ELWSL DFI+PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR K++V+  L LP K EQVLFC LT  Q++VY+ ++ S+   +I+ G+   F GLV LRKICNHPDL +GGPK     P         D+    +FGH+ RSGKM+VV+ LL++W+R   +VLLF+Q R ML IL+ F+    YS   MDGTT I SR  ++ K+N+      F+FLLTTRVGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  488 EFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTIIVCPTTVMHQWVKEFHTWWPPFRVAVLHETGSYTHKKERLIRDIVYCHGVLITSYSYIRLMQDDISRHDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFIDSKAVYRILNGENQIFSGLVALRKICNHPDLFSGGPKNASGPP--------EDELEEEQFGHWRRSGKMIVVESLLKIWHRQGQRVLLFSQSRQMLHILEVFLRAHKYSYLKMDGTTTIASRQPLITKYNED--TSIFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 994          
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Match: sp|P40352|RAD26_YEAST (DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 2.211e-170
Identity = 277/595 (46.55%), Postives = 372/595 (62.52%), Query Frame = 1
Query:  937 EINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGY-------------------DKP------------------------ERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMC-----TMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTASDTSIMFRGSKHHKSLKSNYFDEA 2577
            ++N  F +   I++ L+ YQ+  V+WL +L+    GGI+GDEMGLGKTIQVIAF+A L  S       GPVLIVCPATVM+QW +EF+ W P  R  +LH+ GSG                     KP                        ++L++ +     +LITTY  + +H   L +  WQY +LDEGHKI+NP+++++  CK+ +T +R+I+SG+PIQNNL ELWSL DFI+PGKLG+L  F Q F +PI  GGY +A+ +QV+T Y+CA  +RD I+ YLLRR KA+V   LP+K E VLFC LT +Q   Y E+L S    QI  G++    G+ +LRKICNHPDL+    K                  H+  +G   RSGKM VVK+LL LW++  +K LLFTQ R ML IL+ FI  +   +       MDGTT I  R ++VD+FN+  +    +FLLTTRVGGLG+NL GA+R+++FDPDWNP TD+QARERAWRIGQ R+V IYRL++ GS+EEKIYHRQ+FKQFLTNRIL +P+Q+RFFK  +L DLF L      S   +     KH ++LK++  +E+
Sbjct:  282 KLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHS---GLLTGPVLIVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTK-----------------RHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNNESFD---VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIHELHDLFSLGGENGYSTEELNEEVQKHTENLKNSKSEES 853          
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Match: sp|Q9UR24|RHP26_SCHPO (DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp26 PE=4 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 2.002e-166
Identity = 266/578 (46.02%), Postives = 367/578 (63.49%), Query Frame = 1
Query:  916 HQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSG-----------------------------------YDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQ-QGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK-TQXXXXXXXXXXXGTASDTSIMFRGSK 2538
            H   +G     GF +   I   L+ YQ   V+WL +L+   AGGI+GDEMGLGKTIQ+++FL+ L  S  G +   P LIVCPAT+M+QW++EF  W    RV +LHATGSG                                   +   + L+ES+     +LITTY+ + ++  L+   +W Y +LDEGHKI+NP+++++  CKQ  T +R+I+SG+PIQNNL ELW+L DF++PG+LG+L  F   FA+PI  GGY +AS +QV+TAY+CAC++RD I+ YLLRR K +V   LP+K+EQVLFC LT  Q + Y+++L     ++I+ G++    G+ +LRKICNHPDLVT               RE       Y +G   +SGK+ V++ LL LW +  H+ LLF+Q R ML IL+  ++       C MDG+T+I  R  +VD FN + Y +  +FLLTTRVGGLG+NL GADRV++FDPDWNP TD QARERAWR+GQ + VV+YRL+ +G++EEKIYHRQ+FKQFLTN+ILK+P+QRRFFK T         D+    ++T  MF GS+
Sbjct:  255 HPSKKGQTFEGGFTIPGDIRPHLFRYQVTCVQWLWELYCQEAGGIIGDEMGLGKTIQIVSFLSSLHHS--GKFQ-KPALIVCPATLMKQWVNEFHTWWAPLRVVVLHATGSGQRASREKRQYESDASESEAEESKTSIKLRGASSSFHRYAKNLVESVFTRGHILITTYAGLRIYGDLILPREWGYCVLDEGHKIRNPDSEISISCKQIRTVNRIILSGTPIQNNLTELWNLFDFVFPGRLGTLPVFQNQFALPINIGGYANASNVQVQTAYKCACMLRDLISPYLLRRMKLDVAADLPKKSEQVLFCKLTPLQRKAYQDFLQGSDMQKILNGKRQMLYGIDILRKICNHPDLVT---------------REYLLHKEDYNYGDPEKSGKLKVIRALLTLWKKQGHRTLLFSQTRQMLDILEIGLKDLPDVHYCRMDGSTSIALRQDLVDNFNKNEYFD--VFLLTTRVGGLGVNLTGADRVILFDPDWNPSTDAQARERAWRLGQKKDVVVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRRFFKMTDLHDLFTLGDNKTEGTETGSMFLGSE 812          
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Match: sp|Q9ZV43|CHR8_ARATH (Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana OX=3702 GN=CHR8 PE=2 SV=1)

HSP 1 Score: 528.48 bits (1360), Expect = 5.622e-165
Identity = 263/545 (48.26%), Postives = 347/545 (63.67%), Query Frame = 1
Query:  934 IEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLH--ATGSGYDKPE---------------------------------RLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQ 2463
            +++  G  +   I+ KL+ YQ+ GV+WL +LH   AGGI+GDEMGLGKTIQV++FL  L  SK       P +I+CP T++RQW  E + W P F V +LH  A  SG+ K +                                 R+L S     G+LITTY  + L    L   +W Y +LDEGH+I+NPN+ +T  CKQ +T HR+IM+G+PIQN L ELWSL DF++PGKLG L  F   F+VPI  GGY +ASPLQV TAYRCA V+RD I  YLLRR KA+V   L +KTE VLFC LT  Q   YR +LAS + +QI  G +    G+ ++RKICNHPDL+                RE +     Y  G+  RSGKM VV E+L++W +  H+VLLF+Q + ML IL+ F+    YS   MDG T +  R A++D+FN+S  ++ F+F+LTT+VGGLG NL GA+RV++FDPDWNP  D+QARERAWRIGQ + V +YRL+  G++EEK+YHRQ++K FLTN+ILKNP+QRRFFK +
Sbjct:  369 VQLEGGLNIPECIFRKLFDYQRVGVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGSLHFSKM----YKPSIIICPVTLLRQWRREAQKWYPDFHVEILHDSAQDSGHGKGQGKASESDYDSESSVDSDHEPKSKNTKKWDSLLNRVLNS---ESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQIFDGNRNSLYGIDVMRKICNHPDLL---------------EREHSHQNPDY--GNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNS--EDMFVFVLTTKVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKAR 887          
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Match: A0A267GRL4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006870g2 PE=4 SV=1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 337/628 (53.66%), Postives = 432/628 (68.79%), Query Frame = 1
Query:  928 EGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRS--KGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGF-AREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTASDTSIMFRGSKHHKSLKSNYFDEARLPIDAFTXXXXXXXXXXXXVLGAYEGLAGDSAAIAVPTDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMS 2802
            EG+     F +   IW  L+ YQ+  VRWL +LH    GGI+GD+MGLGKT+Q+IA LAGLS S  + G   +GPVLI CP TV++QW+ E R W P FRVA+LH+TGSGY KP +L+ SIA+HPG+L+TTY+++ +H  +L +Y W Y+ILDEGH+IKNP + VT  CKQF T HR+I+SG+P+QNNLKELWSL DF+YPGKLG L  F+Q+ A PI++GGY  AS  QVE AYRCAC +RDTIN YLLRR K +V LQLP K+EQVLFC L+ +Q +VY+EYLASR+C+QI+ G+ + FPGL  LRKICNHPDL TG P+        G  +RE      S  FG++ RSGKM+VV  LL+ W    HKVLLF+Q R ML +L+ F++++GY    MDG TA+ SR  +V +FN  P    F+FLLT+RVGG+G+NL GA+RV++FDPDWNPCTDLQARERAWRIGQ R VVIYRL+ SG++EEK+YHRQ+FKQFL NRIL++PRQRRFFK  +L +LF L D    ++T  +F G+       +N FD  R   +A                G   G A DS A    TD+D   +   S   VA   L+  +   LR  AR++S
Sbjct:  329 EGLPDGLAFALPRKIWQSLFPYQRVAVRWLRELHSQAVGGIMGDQMGLGKTVQMIALLAGLSYSHNRLGGPRLGPVLIACPGTVLQQWLGELRQWYPRFRVAILHSTGSGYSKPAKLVHSIANHPGILLTTYNTLTMHRDILLKYRWDYVILDEGHRIKNPTSDVTIACKQFPTPHRIIISGTPMQNNLKELWSLFDFVYPGKLGDLQDFMQHLATPILQGGYASASKFQVELAYRCACSLRDTINPYLLRRMKEDVRLQLPGKSEQVLFCRLSDYQRDVYKEYLASRECRQILEGRYMVFPGLSTLRKICNHPDLSTGPPQ------KFGLPSRE------SLTFGYYKRSGKMLVVDALLKAWRSDGHKVLLFSQSRRMLGVLEAFVKKRGYPYMRMDGGTAVRSRQTLVHRFNTDP--GTFVFLLTSRVGGIGVNLTGANRVIIFDPDWNPCTDLQARERAWRIGQQRDVVIYRLLSSGTIEEKVYHRQIFKQFLANRILRDPRQRRFFKANNLDELFALKDDVEGTETRALFTGT----GASTNRFDALRQRQEA---------------AGVDLGAASDSEAETASTDVDAMKESSASDAPVAAAQLTDSRRAELRELARKLS 923          
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Match: A0A2C9JP58 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106061886 PE=4 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 329/602 (54.65%), Postives = 432/602 (71.76%), Query Frame = 1
Query:  838 DDADYEEFCSRII----------EHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYD-----IGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXX--XXXXXXXGTASDTSIMFRGS----KHHKSLKSNYFDE 2574
            DDAD + +  R+           EH+++      D+   D+  E + GF V   +W KL+ YQ+ GVRWL +LH   AGGI+GDEMGLGKTIQ IAFLA L  S+  N +     +GP +IVCP TVM QW+ E   W P FRVA+LH++GS       L+ SIA   G+LIT+Y+++V+H  L+ R++W Y+ILDEGHKI+NP+AKVT CCKQF T HR+I+SGSPIQNNLKELWSL DF++PGKLG+L  F+Q+F++PI++GGY +A+ +QVETAYRCACV+RDTIN YL+RR KA+V+  L LP K EQVLFC LT  Q EVY+EYLASRQC+ I+ G+   F GL+ LRKICNHPDL TGGP+         F  ++       +FG+  RSGKM+VV+ LLRLW++ +H+VLLFTQ + ML IL++F+++QGYS   MDG T+I +R  ++ ++N+ P    ++FLLTTRVGGLG+NL GADRV+++DPDWNP TD+QARERAWRIGQ R+V IYRL+ SG++EEKIYHRQ+FKQFLTNRILK+P+QRR FK+QD+ +       D    ++TS +F G+    K  K  K N FDE
Sbjct:  388 DDADPDYYQKRLRKLQKQEKKEGEHRDREENNRDDR---DKESEFDGGFHVPQKLWTKLFPYQKTGVRWLWELHCQQAGGIIGDEMGLGKTIQTIAFLAALKTSRLKNVNFPYKGLGPTIIVCPTTVMHQWLKECHKWWPEFRVAILHSSGSFSGSESDLVRSIAKSQGILITSYNTLVVHQELVLRFNWHYVILDEGHKIRNPDAKVTICCKQFRTPHRIILSGSPIQNNLKELWSLFDFVFPGKLGTLPDFMQHFSIPIVQGGYSNATQIQVETAYRCACVLRDTINPYLIRRMKADVKKGLDLPNKNEQVLFCRLTDEQREVYQEYLASRQCQDILQGKFQVFVGLITLRKICNHPDLSTGGPQV--------FKSQSALSDPELQFGYHKRSGKMIVVEALLRLWHKQQHRVLLFTQSKSMLNILEKFVQEQGYSYLIMDGGTSISARQPLITQYNNDP--SIYLFLLTTRVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRIGQTRQVTIYRLLTSGTIEEKIYHRQIFKQFLTNRILKDPKQRRLFKSQDMMELFTLGSQDNKEGTETSAIFAGTGSDVKIPKRRKRNRFDE 976          
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Match: A0A1S3JMN1 (DNA excision repair protein ERCC-6 OS=Lingula unguis OX=7574 GN=LOC106174262 PE=4 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 316/555 (56.94%), Postives = 406/555 (73.15%), Query Frame = 1
Query:  832 TVDDADYEEFCSRIIEHKN------QLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY-DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDG-HSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            T DD D   F  R  E K       QL+         D GIE + G  V   IW+KLY YQ+ GVRWL +LH   AGGI+GDEMGLGKTIQ IAFLA +     RS+   Y  +GP++IVCP TVM QW+ EF  W P FRVA+LH++GS       L+     H GVL+T+Y+SMV+H   + ++DW Y ILDEGHKI+NP+A++T  CKQ  T HR+I+SGSP+QNNLKELWSL DF++PGKLG+L  F+ +F+VPI++GGY +AS +QV+TA++CAC +RDTIN YLLRR KA+V++ LP K+EQVLFC LT  Q EVY+EYL S++C+ I++G+ + FPGL+ LRKICNHPDL TGGPK         F  +  DD   S ++G++ RSGKM+VV+ LL++W +   +VLLFTQ R ML +L+ F+++QGY+   MDG TAIGSR  +VD FN    K  F+FLLTTRVGGLG+NLVGA+RVL+FDPDWNP TD+QARERAWRIGQ R+V +YRL+ SG++EEKIYHRQ+FKQFL NR+LK+P+QRRFFK+
Sbjct:  403 TKDDGDESYFAKRQKEWKKSELLRKQLLLEDGVSEDED-GIEFDGGLKVPGQIWSKLYNYQRTGVRWLWELHCQEAGGIIGDEMGLGKTIQTIAFLAAMKESKLRSRSSRYIGLGPLIIVCPTTVMHQWLKEFHKWWPPFRVAILHSSGSYTTSEAELIRETVRHNGVLVTSYNSMVIHQENILKHDWHYAILDEGHKIRNPDAQITLACKQIRTPHRIILSGSPMQNNLKELWSLFDFVFPGKLGTLPDFMAHFSVPIVQGGYSNASQIQVQTAFKCACALRDTINPYLLRRMKADVKINLPNKSEQVLFCRLTREQTEVYKEYLDSKECQMILSGRFMVFPGLITLRKICNHPDLSTGGPKI--------FRHDTVDDSDESLEYGYWKRSGKMIVVQSLLKIWKKQGQRVLLFTQSRQMLDVLETFVQKQGYNYLRMDGGTAIGSRQPLVDYFNKDMSK--FLFLLTTRVGGLGINLVGANRVLIFDPDWNPSTDIQARERAWRIGQQRQVTVYRLLTSGTIEEKIYHRQIFKQFLANRVLKDPKQRRFFKS 946          
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Match: A0A267GRT5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019797g3 PE=4 SV=1)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 336/628 (53.50%), Postives = 432/628 (68.79%), Query Frame = 1
Query:  928 EGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRS--KGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGF-AREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTASDTSIMFRGSKHHKSLKSNYFDEARLPIDAFTXXXXXXXXXXXXVLGAYEGLAGDSAAIAVPTDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMS 2802
            EG+     F +   +W  L+ YQ+  VRWL +LH  G GGI+GD+MGLGKT+Q+IA LAGLS S  + G   +GPVLI CP TV++QW+ E R W P FRVA+LH+TGSGY KP +L+ SIA+HPG+L+TTY+++ +H  +L +Y W Y+ILDEGH+IKNP + VT  CKQF T HR+I+SG+P+QNNLKELWSL DF+YPGKLG L  F+Q+ A PI++GGY  AS  QVE AYRCAC +RDTIN YLLRR K +V LQLP K+EQVLFC L+ +Q +VY+EYLASR+C+QI+ G+ + FPGL  LRKICNHPDL TG P+        G  +RE      S  FG++ RSGKM+VV  LL+ W    HKVLLF+Q R ML +L+ F++++GY    MDG TA+ SR  +V +FN  P    F+FLLT+RVGG+G+NL GA+RV++FDPDWNPCTDLQARERAWRIGQ R VVIYRL+ SG++EEK+YHRQ+FKQFL NRIL++PRQRRFFK  +L +LF L D    ++T  +F G+       +N FD  R   +A                G   G A DS A    TD+D   +   S    A   L+  +   LR  AR++S
Sbjct:  327 EGLPDGLAFALPRKVWQSLFPYQRVAVRWLRELHSQGVGGIMGDQMGLGKTVQMIALLAGLSYSHNRLGGPRLGPVLIACPGTVLQQWLGELRQWYPRFRVAILHSTGSGYSKPAKLVHSIANHPGILLTTYNTLTMHRDVLLKYRWDYVILDEGHRIKNPTSDVTIACKQFPTPHRIIISGTPMQNNLKELWSLFDFVYPGKLGDLQDFMQHLATPILQGGYASASKFQVELAYRCACSLRDTINPYLLRRMKEDVRLQLPGKSEQVLFCRLSDYQRDVYKEYLASRECRQILEGRYMVFPGLSTLRKICNHPDLSTGPPQ------KFGLPSRE------SLTFGYYKRSGKMLVVDALLKAWRSDGHKVLLFSQSRRMLGVLEAFVKKRGYPYMRMDGGTAVRSRQTLVHRFNTDP--GTFVFLLTSRVGGIGVNLTGANRVIIFDPDWNPCTDLQARERAWRIGQQRDVVIYRLLSSGTIEEKVYHRQIFKQFLANRILRDPRQRRFFKANNLDELFALKDDVEGTETRALFTGT----GASTNRFDALRQRQEA---------------AGVDLGAASDSEAEMASTDVDAMSESSASDAPAAAAQLTDSRRAELRELARKLS 921          
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Match: A0A3S1BSX8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_018111 PE=4 SV=1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 329/604 (54.47%), Postives = 428/604 (70.86%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQCDEGI------------EINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYD-----IGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGT--ASDTSIMFRGS----KHHKSLKSNYFDE 2574
            DDAD E++  R++  + Q + A  ++   D+              E + G  V   +W KLY YQ+ GVRWL +LH   AGGI+GDEMGLGKTIQ I+FLA L  SK  N +     +GP +IVCP TVM QW+ E   W P FRVA+LH++GS       L+ SIA   G+LIT+YS++V+   ++ R++W Y+ILDEGHKI+NP+AKVT CCKQF T HR+++SGSPIQNNLKELWSL DF++PGKLG+L  F+Q+F++PI++GGY +A+ +QVETAYRCACV+RDTIN YL+RR KA+V+  + LP K EQVLFC LT  Q  VY+EYL SR+C  I+ G+   F GL+MLRKICNHPDL TGG         L    +   D    +FGH+SRSGKMVVV+ LLRLW +  H+VLLFTQ + ML IL++F+++Q Y   +MDG T+I +R  ++D++N  P    F+FLLTTRVGGLG+NL GADRV++FDPDWNP TD QARERAWRIGQ R+V IYRL+ SG++EEKIYHRQ+FKQFLTNRILK+P+QRR FK+QD+ +LF L        ++TS +F G+    K  K  ++N FDE
Sbjct:  429 DDADPEDYQDRLL--RQQKLDAKEEKSAKDKKSESDEDDEDEESREFDGGLKVPRKLWKKLYKYQKTGVRWLWELHTQQAGGIVGDEMGLGKTIQTISFLAALRSSKVKNVNFPYKGLGPTIIVCPTTVMHQWLKECHKWWPEFRVAILHSSGSYTGSQTELVRSIAKSFGILITSYSTLVIQQEMILRFNWHYVILDEGHKIRNPDAKVTLCCKQFRTPHRIVLSGSPIQNNLKELWSLFDFVFPGKLGTLPDFMQHFSIPIVQGGYSNATQVQVETAYRCACVLRDTINPYLIRRMKADVKQNINLPGKNEQVLFCRLTDEQKNVYKEYLESRECNAILQGKFQIFAGLIMLRKICNHPDLSTGG---------LQLFNQGPSDRPEDQFGHWSRSGKMVVVEALLRLWRKQGHRVLLFTQSKTMLSILEKFVQEQEYRYLSMDGGTSISARQPLIDQYNKDP--SIFVFLLTTRVGGLGVNLTGADRVIIFDPDWNPSTDTQARERAWRIGQKRQVTIYRLLTSGTIEEKIYHRQIFKQFLTNRILKDPKQRRLFKSQDMYELFTLGSQDNEQGTETSALFAGTGSDVKVPKKSRNNRFDE 1019          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 314/562 (55.87%), Postives = 404/562 (71.89%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            DD D E +  RI + K Q +     + Q             DEG ++ PGF     +W KL+ YQQ GVRW+ +LH   AGGILGDEMGLGKTIQVIAFLAGLS    R++G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  IA   G+LIT+YS + +    + +YDW Y+ILDEGHKI+NPNA VT  CKQF T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RD+IN YLLRR KA+V+  L LP K+EQVLFC LT  Q +VY+++L S++  QI+ G    F GL+ LRKICNHPDL +GGP+ +   P         +      FG++ RSGK++VV+ LLRLWY+  H+VLLFTQ R ML+IL+ F+   GYS   MDGTT I SR  ++ ++N+    + F+FLLTT+VGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ ++V +YRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  431 DDGDIEYYRQRIRKWKRQRLQDKERRRQAGEDESEESDVEFDEGFKM-PGF-----LWKKLFKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVIAFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKREKLIPEIAAGHGILITSYSYVRIMQDYIQKYDWHYVILDEGHKIRNPNAGVTVACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDSINPYLLRRMKADVKANLALPDKSEQVLFCRLTEDQRKVYQDFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFSGGPRLLKGVP-------EEELSEEEHFGYWKRSGKLIVVESLLRLWYKQGHRVLLFTQSRQMLEILEVFVRGNGYSFLKMDGTTTIASRQPLIARYNE----DIFVFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKQQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 975          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Match: ercc6l (excision repair cross-complementation group 6-like [Source:NCBI gene;Acc:100005291])

HSP 1 Score: 331.643 bits (849), Expect = 1.865e-94
Identity = 194/554 (35.02%), Postives = 295/554 (53.25%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNGA-GGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGK-LGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQ---------------------------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFG----HFS------RSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKF-NDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            G ++   ++NKLY +Q+ GV +L  LH +G  GGIL D+MGLGKTIQVI+FL+G+  ++  N+     L+V P ++++ W+ EF  W P  RV   H  G+   +  R LE I    GV+ITTY  ++ +   L  Y      W Y+ILDE HKIK  + K          R+R++++G+P+QNNL+E+W+L DF   G  LG+  +F   +  PI +   + A+P +     + +  + D I  Y LRRTKAEV+ +                           L RK + +++  L+  Q ++Y+++++    K ++   + P   L +L+K+C+HP L++      L          A +D  +        H S       SGK+  +  LL      +H+ L+F+Q R ML I+ R +  + + +  +DGT T +  R   +  F  D  Y    +FLLTT+VGG+G+ L  A+RV++FDP WNP TD QA +RA+RIGQ   VVIYRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:   71 GLMLFKELYNKLYEHQKEGVAFLYSLHRDGRRGGILADDMGLGKTIQVISFLSGMYDAELANHS----LLVMPTSLIKNWVREFAKWTPGMRVKEFH--GTSKVERNRNLERIQRKGGVIITTYQMLINNWEQLATYQHQEFRWDYVILDEAHKIKTSSTKTAKSAHAIPARNRVLLTGTPVQNNLREMWALFDFACQGALLGTAKTFKTEYENPITRAREKDATPGEKTLGLKISQNLMDLIRPYFLRRTKAEVQQKKQNAKGTRHEEEENKCPNAGDSAEMPSLTRKNDLIIWTYLSEVQEDIYQQFISLDHIKALMMTTRSPLAELTVLKKLCDHPRLLSARAVTQLGLEQGAATDLAAEDNENESAAGSIEHVSDETLLEESGKLRFLVSLLEQLKADQHRTLVFSQSRKMLDIIDRVLRNRNFRLLRVDGTVTQLVERERRITLFQTDRRYS---VFLLTTQVGGVGITLTAANRVVIFDPSWNPATDAQAVDRAYRIGQTENVVIYRLITCGTVEEKIYRRQVFKDSLIRQTTGDKKNP--FRYFSKQ 613          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 291.197 bits (744), Expect = 4.264e-82
Identity = 176/513 (34.31%), Postives = 269/513 (52.44%), Query Frame = 1
Query:  934 IEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPER--LLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
             E +P +V   +    L  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q IA L  L   +      GP +++ P + +  WM+EF+ W P  +   L       DK  R   +  +   PG   V +T+Y  ++    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELWSL++F+ P    S + F   F      G  +           R   V+R     +LLRR K EVE  LP K E  ++ GL+  Q E Y   L         AG+  ++    ++M LRK CNHP L  G   GP    D  ++                  + SGKM+ + +LL        +VL+F+Q   +L IL+ +   +GY  C +DG T    R   +D FN +P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ + V ++RL+   +VEE+I  R   K  L + +++  R
Sbjct:   47 FEESPSYVKNGT----LRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIP---GPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIG-----DKDARAAFIRDVMM-PGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNNCLGDQKLVE--------RLHAVLRP----FLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLV------------------TNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFN-APNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGR 515          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 290.426 bits (742), Expect = 5.685e-82
Identity = 176/513 (34.31%), Postives = 269/513 (52.44%), Query Frame = 1
Query:  934 IEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPER--LLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
             E +P +V   +    L  YQ  G+ W++ L++NG  GIL DEMGLGKT+Q IA L  L   +      GP +++ P + +  WM+EF+ W P  +   L       DK  R   +  +   PG   V +T+Y  ++    +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELWSL++F+ P    S + F   F      G  +           R   V+R     +LLRR K EVE  LP K E  ++ GL+  Q E Y   L         AG+  ++    ++M LRK CNHP L  G   GP    D  ++                  + SGKM+ + +LL        +VL+F+Q   +L IL+ +   +GY  C +DG T    R   +D FN +P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ + V ++RL+   +VEE+I  R   K  L + +++  R
Sbjct:   47 FEESPSYVKNGT----LRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIP---GPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIG-----DKDARAAFIRDVMM-PGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNNCLGDQKLVE--------RLHAVLR----PFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLV------------------TNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFN-APNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGR 515          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:103021645])

HSP 1 Score: 286.189 bits (731), Expect = 8.100e-80
Identity = 169/497 (34.00%), Postives = 263/497 (52.92%), Query Frame = 1
Query:  979 KLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVP---FPGLVMLRKICNHPDLVTG---GPKCVLD-HPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            KL  YQ  G+ WL+ L++NG  GIL DEMGLGKT+Q I+ L  +   +      GP +++ P + +  WM+EF+ W P  R   L   G   ++   + +++   PG   V +T+Y  +++   +  +++W+Y+++DE H+IKN  +K++   ++F+T +RL+++G+P+QNNL ELW+L++F+ P    S   F   F      G          +   R   V+R     +LLRR KA+VE  L  K E  ++ GL+  Q E Y + L         AG+         L+ LRK CNHP L  G   GP    D H ++                    SGKM V+ +LL        +VL+F+Q   +L IL+ +   + Y  C +DG T    R   ++ FN+ P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++R +   +VEE+I  R   K  L + +++  R
Sbjct:  163 KLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIP---GPHMVLVPKSTLYNWMNEFKRWVPSLRAVCL--IGDRDERTAFIRDTLL--PGEWDVCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDTNNCLG--------DTKLVERLHTVLR----PFLLRRIKADVEKSLLPKKEIKMYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVN-------------------SGKMAVLDKLLPKLNEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNE-PNSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGR 620          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 542.347 bits (1396), Expect = 1.375e-177
Identity = 286/575 (49.74%), Postives = 379/575 (65.91%), Query Frame = 1
Query:  949 GFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSG-----------------------YDKPERLLES------IAHHPGVLI------TTYSSMVLHHPLLT----RYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQV-LFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTA--SDTSIMFRGSKH 2541
            GF V +S+W KLY YQQ GV+WL +LH   AGGILGDEMGLGKT+Q+IAFLAGLS    G   +GP L+VCP TVM QW+ EF  W P FRVA+LH +GS                        + +P  +L +      I H+  ++       TT+  +     L+     R  W        H  +N + K+   C  F T HR+I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI +GGY +AS +QV+TAY+CACV+RDTI  +LLRR KA+V+  L LP K EQV         +++VY+++L SR+ +Q++  ++  F  L+ LRKICNHPDL+TGG               A DDG    FG++ RSGK++VV+ LLR+W R  H+VLLFTQ R ML IL++F++ +GYS   MDGTT+I +R  ++DKFN    +  F+FLLTT VGG+G+NL GA+RV++FDPDWNP TD QARERAWRIGQ R+V IYRLV +G++EEKIYHRQ+FKQFLTNR+LK+PRQ+RFFK  DL +LF L D  ++  ++TS +F   KH
Sbjct:    4 GFKVPASLWQKLYKYQQTGVQWLWELHVKQAGGILGDEMGLGKTVQIIAFLAGLSHRYEG---LGPSLVVCPTTVMHQWVREFHTWWPQFRVAVLHESGSYSGKKKVRRARFFYSYSTYSRAPLWKRPPPVLRASDGVAAIMHNMYIMFGGQASQTTFRCLQFTRMLIIAIVFRSKWTCPRRAAHHPCRNADNKIFPNCFMFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQVKALLKYNFQRSQVYQKFLDSREVQQVLNRERQVFTALITLRKICNHPDLLTGG-------------LNAEDDG----FGYWRRSGKLLVVEALLRMWRRQGHRVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKD--ESMFMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVLKDPRQQRFFKANDLFELFALTDPDSSQGTETSALFAEQKH 556          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 550.051 bits (1416), Expect = 1.482e-176
Identity = 285/571 (49.91%), Postives = 378/571 (66.20%), Query Frame = 1
Query:  838 DDADYEEFCSRIIE-HKNQLIA---------AAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSK------GGNYD-IGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAH-----------HPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQV-LFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            DD D E++  R+   H+ +L+A         +A +  + D  +E   GF V +S+W KLY YQQ GV+WL +LH   AGGILGDEMGLGKT+Q+IAFLAGLS SK      G  Y+ +GP L+VCP TVM QW+ EF  W P FRVA+LH +GS   K + +   I              P  L+   +S  +    + R  +Q +I             V     QF T HR+I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI +GGY +AS +QV+TAY+CACV+RDTI  +LLRR KA+V+  L LP K EQV         +++VY+++L SR+ +Q++  ++  F  L+ LRKICNHPDL+TGG     D        E    G    FG++ RSGK++VV+ LLR+W R  H+VLLFTQ R ML IL++F++ +GYS   MDGTT+I +R  ++DKFN    +  F+FLLTT VGG+G+NL GA+RV++FDPDWNP TD QARERAWRIGQ R+V IYRLV +G++EEKIYHRQ+FKQFLTNR+LK+PRQ+RFFK
Sbjct:    9 DDGDIEQYKQRVRRWHRGRLLAKKKRLEEGLSATESEESD--VEFEGGFKVPASLWQKLYKYQQTGVQWLWELHVKQAGGILGDEMGLGKTVQIIAFLAGLSHSKLRTRGLGYRYEGLGPSLVVCPTTVMHQWVREFHTWWPQFRVAVLHESGSYSGKKKYMHRVIVFCFNNLQNERKLVPERLVDDLASRKMRE--VYRLRFQRVI----------KKNVALFLAQFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQVKALLKYNFQRSQVYQKFLDSREVQQVLNRERQVFTALITLRKICNHPDLLTGGLNAEDD--------ELAPSG----FGYWRRSGKLLVVEALLRMWRRQGHRVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKD--ESMFMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVLKDPRQQRFFK 551          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 419.468 bits (1077), Expect = 9.013e-130
Identity = 198/345 (57.39%), Postives = 261/345 (75.65%), Query Frame = 1
Query: 1432 QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQV-LFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            QF T HR+I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI +GGY +AS +QV+TAY+CACV+RDTI  +LLRR KA+V+  L LP K EQV         +++VY+++L SR+ +Q++  ++  F  L+ LRKICNHPDL+TGG     D        E    G    FG++ RSGK++VV+ LLR+W R  H+VLLFTQ R ML IL++F++ +GYS   MDGTT+I +R  ++DKFN    +  F+FLLTT VGG+G+NL GA+RV++FDPDWNP TD QARERAWRIGQ R+V IYRLV +G++EEKIYHRQ+FKQFLTNR+LK+PRQ+RFFK
Sbjct:    7 QFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQVKALLKYNFQRSQVYQKFLDSREVQQVLNRERQVFTALITLRKICNHPDLLTGGLNAEDD--------ELAPSG----FGYWRRSGKLLVVEALLRMWRRQGHRVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKD--ESMFMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVLKDPRQQRFFK 337          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 396.356 bits (1017), Expect = 1.468e-121
Identity = 192/344 (55.81%), Postives = 243/344 (70.64%), Query Frame = 1
Query: 1432 QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            QF T HR+I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI +GGY +AS +QV+TAY+CACV+RDTI  +LLRR KA+V+  L LP K EQV                                F  L+ LRKICNHPDL+TGG     D        E    G    FG++ RSGK++VV+ LLR+W R  H+VLLFTQ R ML IL++F++ +GYS   MDGTT+I +R  ++DKFN    +  F+FLLTT VGG+G+NL GA+RV++FDPDWNP TD QARERAWRIGQ R+V IYRLV +G++EEKIYHRQ+FKQFLTNR+LK+PRQ+RFFK
Sbjct:    7 QFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQV--------------------------------FTALITLRKICNHPDLLTGGLNAEDD--------ELAPSG----FGYWRRSGKLLVVEALLRMWRRQGHRVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKD--ESMFMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVLKDPRQQRFFK 304          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Match: ercc6l (excision repair cross-complementation group 6-like [Source:NCBI gene;Acc:100005291])

HSP 1 Score: 310.457 bits (794), Expect = 2.527e-91
Identity = 208/600 (34.67%), Postives = 307/600 (51.17%), Query Frame = 1
Query:  850 YEEFCSRIIEHKNQ-----LIAAAADQHQCDEGIEI-NPGFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGK-LGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEV-------------------------------ELQLP---RKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKF----------GHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            Y+ + S+ +E K +     L AA +   + DE I +   GF +   + N+LY +Q  GV WL  L  N   GGIL D+MGLGKTIQVI+FL+G+  +       G VL+V P T+M  W+ EF  WAP   +   + T S   +  R L+ +    GV+IT+Y  +V +   L+ Y      W  +ILDEGHKIK  + K            R+I++G+P+QNNLKE+W+L DF+  G  LG+  +F   +  PI K   + A+  +     R A  +++ I  Y LRRTKAEV                               ++++P   RK + +++  L+  Q ++YR++      K+++   + P   L +L+KIC HP L+     C        F R  ++   S  F               SGK+  +  LL    +  H+ L+F+Q   ML I+   ++ QG+ +  +DGT T I  R   V  F  DS +    +FLLTT+VGG+GL L  A+RV++ DP WNP TD QA +RA+RIGQ   V+IYRLV  G++EEKIY RQ+FK+ L  +     KNP   R+F  Q
Sbjct:   29 YKIYASKKLELKIKALEEVLKAAISSDDEEDEYINVLGSGFNLYHELHNQLYSHQLEGVAWLYNLFKNKRKGGILADDMGLGKTIQVISFLSGMFDASL----FGHVLLVMPTTLMSIWISEFDKWAPGITIREFYGTKS---ERTRNLQKVQRTQGVVITSYQLLVNNWHELSTYQGQEFIWDAMILDEGHKIKTSSTKTAKSAHAIPAHFRMILTGTPVQNNLKEIWALFDFVCEGSLLGTSKTFKMEYENPITKARQKDATVGEKALGTRMAENLQELIGPYFLRRTKAEVQSKELHAKQLRDNKENDPTKCFSYTFFDARIQIEMPTLTRKNDLIVWVYLSPVQEQIYRDFQNLDDIKELLDSTRSPLVALGILKKICVHPRLLPERA-CAQLGLNQQFGRIESEGLQSNWFLSSIKNVPPKTLIEESGKLTFLIGLLERLRQEGHRTLVFSQSLKMLDIIDHILKHQGFKVMRIDGTITHITEREKRVQTFQKDSAFN---VFLLTTQVGGVGLTLTAANRVVILDPSWNPATDAQAVDRAYRIGQTDNVIIYRLVTCGTMEEKIYRRQIFKESLIRQTTGDKKNP--FRYFSQQ 615          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Match: RAD26 (Protein involved in transcription-coupled nucleotide excision repair; repairs UV-induced DNA lesions; recruitment to DNA lesions is dependent on an elongating RNA polymerase II; homolog of human CSB protein [Source:SGD;Acc:S000003796])

HSP 1 Score: 539.65 bits (1389), Expect = 3.184e-172
Identity = 277/595 (46.55%), Postives = 372/595 (62.52%), Query Frame = 1
Query:  937 EINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGY-------------------DKP------------------------ERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMC-----TMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTASDTSIMFRGSKHHKSLKSNYFDEA 2577
            ++N  F +   I++ L+ YQ+  V+WL +L+    GGI+GDEMGLGKTIQVIAF+A L  S       GPVLIVCPATVM+QW +EF+ W P  R  +LH+ GSG                     KP                        ++L++ +     +LITTY  + +H   L +  WQY +LDEGHKI+NP+++++  CK+ +T +R+I+SG+PIQNNL ELWSL DFI+PGKLG+L  F Q F +PI  GGY +A+ +QV+T Y+CA  +RD I+ YLLRR KA+V   LP+K E VLFC LT +Q   Y E+L S    QI  G++    G+ +LRKICNHPDL+    K                  H+  +G   RSGKM VVK+LL LW++  +K LLFTQ R ML IL+ FI  +   +       MDGTT I  R ++VD+FN+  +    +FLLTTRVGGLG+NL GA+R+++FDPDWNP TD+QARERAWRIGQ R+V IYRL++ GS+EEKIYHRQ+FKQFLTNRIL +P+Q+RFFK  +L DLF L      S   +     KH ++LK++  +E+
Sbjct:  282 KLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHS---GLLTGPVLIVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTK-----------------RHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNNESFD---VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIHELHDLFSLGGENGYSTEELNEEVQKHTENLKNSKSEES 853          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 305.064 bits (780), Expect = 1.222e-86
Identity = 182/511 (35.62%), Postives = 269/511 (52.64%), Query Frame = 1
Query:  907 ADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPER--LLESIAHHP--GVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIA---------GQQVPFPGLVMLRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHR 2391
             D +Q D  +  +P FV +     KL  YQ  G+ WL+ LH+N   GIL DEMGLGKT+Q I+FL  L   K      GP LI+ P + +  W  EF  W P   V +LH      DK  R  ++ +I       VLIT+Y  ++     L R  WQYI++DE H+IKN  + ++   + F +++RL+++G+P+QNNL ELW+L++F+ P   G    F + F     +   E    + ++  +         +N +LLRR KA+VE  L  K E  ++ G+T  Q + Y+  L     K I A         G+      ++ LRK CNHP L  G   GP    D  ++                    SGKM+++ +LL+       +VL+F+Q   +L IL+ +   + +  C +DG+T+   R   +D++N  P  E F+FLLTTR GGLG+NLV AD V++FD DWNP  DLQA +RA RIGQ ++V +YR V   ++EEK+  R
Sbjct:  163 VDTYQEDIFVSESPSFVKSG----KLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIE---GPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHG-----DKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFE----QNNSEQDQEIVIQQLHSV-------LNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLE----KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLI------------------FNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYN-KPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 627          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 294.664 bits (753), Expect = 2.546e-82
Identity = 179/522 (34.29%), Postives = 275/522 (52.68%), Query Frame = 1
Query:  916 HQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHP-----GVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQF-ETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPG--------LVMLRKICNHP---DLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            H+  E I+  P  +V  +    L  YQ  G+ W++ L++N   GIL DEMGLGKTIQ I+ +  L   K    DIGP L++ P + +  W  EF  WAP     +   T +          S+ H        VL+TTY  ++    LL+++DW ++I+DEGH++KN  +K++     +  TR+RLI++G+P+QNNL ELW+L++F+ P    S  +F   F  P    G +    L  E        +   +  +LLRR K EVE  LP K E+V+ C L+G Q ++Y+  +       + AG +    G        ++ LRKICNHP   D V G         ++  +R  +D         F  +GK  ++  +L  +    H+VL+F Q   ++ I++ F+  +      +DG+T    R  +++ FN +P  + F FLL+TR GGLGLNL  AD V++FD DWNP  DLQA++RA RIGQ  +V I RL+ + SVEE I  R + K  +  ++++
Sbjct:  452 HRIKEKIDKQPSILVGGT----LKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKK---DIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQR-------HSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQ-QMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEG---------VVNPSRGNSD-------LLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFN-APDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQ 941          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 287.73 bits (735), Expect = 1.364e-79
Identity = 170/499 (34.07%), Postives = 263/499 (52.71%), Query Frame = 1
Query:  916 HQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCK-QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASR------QCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHR 2391
            H+  E I+  P  +V  +    L  YQ  G++W++ L +N   GIL DEMGLGKTIQ I+ L  L   K      GP L++ P + +  W  EF  WAP  R   +   GS  ++  +  +  A    V++TT+  ++    LL++  W ++I+DEGH++KN  +K++      +   +RLI++G+P+QNNL ELW+L++F+ P    S+ SF + F  P    G +    L  E        +   +  +LLRR K +VE +LP K E+V+ C ++  Q  +Y++ L  R      Q  + + G +     ++ L+KICNHP +     + V D   +   RE  DD        +  +GK  ++  +L       H+VL+F Q   ++ I++ F+         +DG T    R  ++  FN +P  E   F+L+TR GGLGLNL  AD V++FD DWNP  DLQA++RA RIGQ  +V I RL+ + SVEE I  R
Sbjct:  749 HRIKEDIKKQPSILVGGT----LKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIR---GPYLVIVPLSTLSNWSSEFAKWAPTLRT--ISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF----EEVEDQ--INPTRETNDDI-------WRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFN-APDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILER 1224          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 274.633 bits (701), Expect = 2.166e-76
Identity = 177/546 (32.42%), Postives = 266/546 (48.72%), Query Frame = 1
Query:  868 RIIEHKNQLIAAAADQHQCDEGIEI----NPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPER--LLES--IAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYL-----------ASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            R  EH+        +    DE IE     +P +V       +L  YQ  GV WL+ LH N   GIL DEMGLGKT+Q I+FL  L   +      GP L++ P + +  W+ E   W P     +L       DK ER  L++   +     V+I +Y  ++     L + +W+YII+DE H+IKN  + ++   ++F +R+RL+++G+P+QNNL ELW+L++F+ P        F   F+           S    E   +    +   +  +LLRR K++VE  L  K E  L+ G++  Q + Y++ L            S++ K  +         ++ LRK CNHP L  G   GP    D  ++  A  A               G                 +VL+F+Q   +L IL+ +   + Y  C +DG+TA   R   +D +N +P  + F+FLLTTR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++RLV   SVEEKI  R   K  L   +++  R
Sbjct:  159 RKTEHEEDAELLKEEDSDDDESIEFQFRESPAYVNG-----QLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKI---PGPFLVIAPKSTLNNWLREINRWTPDVNAFILQG-----DKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFS-----------SESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNI------MMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNA--AKLQVLDKLLKKLKEEGS----------------RVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYN-APDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNR 655          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Match: EDO46132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM3])

HSP 1 Score: 295.434 bits (755), Expect = 6.993e-87
Identity = 182/555 (32.79%), Postives = 284/555 (51.17%), Query Frame = 1
Query:  958 VASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDI--------------GPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLAS----------------------RQCKQIIAGQQVPFPGLVM-----LRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRS---------------GKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFF 2454
            V + I  +L  YQ+ GV++L Q + +  G ILGD+MGLGKT+QVIA L+ +    G   D+              G  LIVCP +++  W DE   W   FRV + H    G  K   + ++      V++TTY ++ ++       +W  +++DE HK+K+P+AK T   K+ + + R  ++G+P+QN   ELW ++D+  PG LGS   F   +   I KG    A+  ++      +   +  +N ++LRRTK  +   LP K ++V+FC LT  Q +VY   L S                      + C         P   L+M       K+ NH  L+  G K   D        +A  +G   +  HF +S               GKM V+ +LLR++ + K KVLLF+    +L IL+ ++  +G     +DG T+   R  +V +FN +  ++ FI L++T+ GGLGLN  GA+ V++FDP WNP  DLQA++RA+RIGQ R V + RL+ SG++EE +Y RQ++KQ + N  +    +RR+F
Sbjct:    4 VPAPINCRLRDYQREGVQFLYQHYRSNNGAILGDDMGLGKTVQVIALLSAILGKTGTRADVFGKYIGQGPSGKQKGVFLIVCPGSMLYNWKDELDTWG-YFRVKMYH----GSSKEMVMDQAAKGKLDVVLTTYDTLRINVTEFDCVNWLAVVMDEVHKLKDPSAKNTKAAKRLKVQRRFGLTGTPLQNRWSELWCVLDWANPGCLGSNLRFDAFYGKAIRKGQRHDANKRELALGRTRSSQFQSKLNNWMLRRTKDLIAQHLPHKDDKVVFCSLTPFQEDVYMALLQSPDVQLVRKKDYRCDCGSGQNRGKCCYSCCPVSGEPLKSLLMRCFQLFLKVANHAALLMPGVKQTDDQRKRA---KAICEGVLTRHPHFVQSLAENSFQTLSNPEYCGKMKVLDKLLRMFEKDKCKVLLFSYSTELLNILENYVIGRGLVFSRLDGQTSPAQRMRVVREFNGN--RDIFICLVSTKAGGLGLNFTGANVVIIFDPTWNPSNDLQAQDRAYRIGQRRDVQVLRLISSGTIEEMMYLRQIYKQQMANTAISGSTERRYF 548          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 298.516 bits (763), Expect = 1.016e-82
Identity = 181/516 (35.08%), Postives = 276/516 (53.49%), Query Frame = 1
Query:  916 HQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCK-QFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQ----NEVYREYL----ASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFN--DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            H   E I   P  +V      +L  YQ AG+ W++ LH+N   GIL DEMGLGKTIQ IA  + L   K  N   GP L++ P + +  W  EF  WAP   V     + +       +L +   +  V++TTY  ++    +L +  W+Y+++DEGH++KN + K+T      +  +HR++++G+P+QN L ELW+L++F+ P    S+++F Q F  P    G      L  E        +   +  +LLRR K EVE QLP K E V+ C ++  Q    N +Y++ +     S + K+   G +     ++ LRKICNHP +     + + +H  LGF          Y+      SGK  ++  +L    R KH+VL+F Q   ++ IL+ +   +G+    +DGTT    R  ++  FN  DSPY   F+FLL+TR GGLGLNL  AD V++FD DWNP  DLQA++RA RIGQ ++V + RL+   SVEEKI     +K  +  ++++
Sbjct:  628 HSMKETITEQPSMLVG----GRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLN---GPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGAVLRTGKFN--VVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTG--EKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEH--LGFHGGIVTGPDIYRA-----SGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPY---FVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQ 1122          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Match: EDO39300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAF5])

HSP 1 Score: 263.848 bits (673), Expect = 2.041e-76
Identity = 175/493 (35.50%), Postives = 253/493 (51.32%), Query Frame = 1
Query:  952 FVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERL--LESIAHHPGVLITTYSSMVLHHPLLTR------YDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGK-LGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKA---------------EVELQ------------------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVL-----DHPILGFAREAT------DDGHSYKFGH--FSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLV 2259
            F++A  +   LY YQ+ G+ W  +L++   GGILGD+MGLGKTIQVIAFLAG+  S+     I   LIV P +++  W  EF+ WAP  RV   H    G +K ERL  LE I    GV +TTY  +V  H  L++      Y W YIILDEGHKIKN   K +   +    +H  I++G+PIQNNL+E+W+L DF   G+ LGS  +F Q +  PI +     AS  +       A  +R  I  + LRRTKA               E E Q                  L RK + +++  ++  Q ++Y ++L   + K+++   + P   L +L+KIC+HP L++      L     D  I+    +         DG S          SGKMV + ELL       H+ L+F+Q R ML I++R I  +G+ +  +DGT T+   R  +++ F  +S Y     FLLTT+VGG+G+ L  ADRV++
Sbjct:   77 FLLARELSTALYPYQKEGLLWFWKLYNRNQGGILGDDMGLGKTIQVIAFLAGMFDSEL----IKSALIVMPVSLITNWEKEFKKWAPGIRVYPYH----GSNKRERLKNLEKIQRKNGVCLTTYGLVVSSHEALSQTSTGKDYQWDYIILDEGHKIKNV-TKTSKNVRAIPAKHHFILTGTPIQNNLREMWALFDFTCQGQLLGSSKTFKQEYESPITRARERDASAYEKRIGGEMAESLRKLIQPHFLRRTKAMVLKNTKKEEEGTIKEREEQIDGSQSIPKMPSAKAPEGLKRKNDLIIWLQMSDTQLKIYSDFLGLERVKEMLMSTRSPLAELNVLKKICDHPRLLSAMACTQLGLNERDRAIIDEEDKENHLEVDLSDGSSGPSDQTLIQESGKMVFLVELLDNLREQGHRCLIFSQSRKMLDIIQRVITHRGHKVLRIDGTITSTSERQHLINTFQKNSSYT---CFLLTTQVGGVGITLTAADRVVI 557          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 272.707 bits (696), Expect = 9.626e-76
Identity = 168/513 (32.75%), Postives = 269/513 (52.44%), Query Frame = 1
Query:  934 IEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPG---VLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPL--QVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQ--QVPFPGLVM-LRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
             E +P ++       ++  YQ  G+ WL+ L++NG  GIL DEMGLGKT+Q I+ L  +   +      GP +++CP + +  WM EF  W P  R   L   G+   +   + +++   PG   V +T+Y  ++    +  ++ W+YI++DE H+IKN  +K++   ++  + +RL+++G+P+QNNL ELW+L++F+ P    S   F   F          +++ L  + +   R   V+R     +LLRR K++VE +L  K E  ++ GLT  Q   Y + L         AG+  ++    ++M LRK CNHP L  G   GP    D  ++                    SGKM V+ +LL    +   +VL+F+Q   +L IL+ +   + Y  C +DG T    R A ++ FN  P    FIF+L+TR GGLG+NL  AD V+++D DWNP  DLQA +RA RIGQ ++V ++R +   +VEE+I  R   K  L   +++  R
Sbjct:  132 FEESPNYIKGG----EMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVP---GPHMVICPKSTLANWMAEFERWCPSIRAVCL--IGNQEQRTAFIRDTML--PGEWDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWF----------NSNNLVEEKQLVERLHSVLRP----FLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDVHLI------------------ENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFN-MPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQGR 600          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 265.774 bits (678), Expect = 1.332e-74
Identity = 169/523 (32.31%), Postives = 260/523 (49.71%), Query Frame = 1
Query:  922 CDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALL------HATGSGYD------------KPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASR-QCKQIIAGQQVPFPGLVM-LRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            C E  E  P ++  +    KL+ YQ+ G+ WL      G   IL DEMGLGKTIQ I+FL  L +     +  GP L+  P + +  W  EF  WAP   V          AT   +D            K  +L +       VL+T+Y  + +    L   DW  +++DE H++KN  +K       +   ++L+++G+P+QNNL+ELW+L+ F+ P +  +  +F+  F           A   Q++        + D +  ++LRR KA+V   +P K+E ++   L+  Q + Y+  L    +       QQV    ++M L+K CNHP L                  + T  G          SGK++++ ++L+      H+VL+F+Q   ML +L+ F+E  GY    +DG+    +R   +D+FN +P  +AF FLL+TR GGLG+NL  AD V ++D DWNP  D+QA  RA RIGQN KV+IYR V   SVEE+I      K  LT+ +++
Sbjct:  240 CKERYEKQPAYLDETG--GKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKE---GHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFD--------NVAKEDQIKK-------LHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALNTKGAQQVSLLNVMMELKKCCNHPYLFHAA----------ALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFN-APTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVR 731          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 316/556 (56.83%), Postives = 401/556 (72.12%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            DD D E +  RI   K   +    ++ +       D   E + GF V   +W KLY YQQ GVRW+ +LH   AGGILGDEMGLGKTIQVI+FLAGLS    R++G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  IA   G+LIT+YS++     +L RYDW YIILDEGHKI+NPNA VT  CKQF+T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL +GGP+ +   P      + T++ H   FG + RSGK++VV+ LLRLW++  H+VLLF+Q R ML IL+ F+ +  YS   MDGTT I SR  ++ ++N    +  FIFLLTT+VGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ  +V IYRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  379 DDGDVEYYRQRIRRWKRNRLREKEEKRERGEEMSDDSDAEFDEGFKVPGFLWKKLYKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVISFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKKEKLIPEIASCHGILITSYSAVRNLQDILIRYDWHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFSGGPRMLKGIP----EDQLTEEEH---FGFWRRSGKLIVVESLLRLWFKQGHRVLLFSQSRQMLDILEVFVRENNYSYLKMDGTTTIASRQPLIARYNQD--RSIFIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 925          

HSP 2 Score: 60.4622 bits (145), Expect = 1.470e-8
Identity = 69/264 (26.14%), Postives = 114/264 (43.18%), Query Frame = 1
Query: 3058 AAEMVAERAKRS----LEQTLANVGVTDKIYHDSVLADESPDPALVQREAETAAKNGADWLRAHLLGNRNGGRL----------RVVFGVTKNSFLFNKNEEKLYFQNLGXXXXXXADSLF-------HFNGSANQSATNNAKHVRFSSGLLLTLIRNRSMSS--------------ANRPTGTRDNPVVVNNEVKTLTN-SIYLFLESSGTGQTTSKQLVRHFRSQVSSKNNLLFKSILNELCTFQRSTSGPNDGTWHLRVEF 3741
            A E  AE  K+S    L + L   G+   + HDS++   +PD  LV+ EA   AK   D L+A L  +R   RL          R  FG  +NS L  ++ +          SS    S         HF+G   +S +N+A     SS  LL  +R R+  S               +   GT   P       + L +   ++  +++  GQ T+++++ +F+ +++ +   +F+ +L  +C F R TSG  +G W L+  F
Sbjct: 1087 AEENTAEEQKKSDDYVLSKLLKKSGIHSVMQHDSIMESSNPDYVLVEAEANRVAK---DALKA-LKSSRQQCRLPFNRPPPPPARKRFGQKRNSILVGRSVQSTTTSIKCKDSSIVKKSALKKPGAGAHFSGEGAESDSNSAP---LSSASLLAKMRARNHISNLSSRGDAEEEDEDNSEAPGTSSPPAPPTEHDELLVDLRNFVAFQANVDGQATTQEVLEYFKPRLTQEQVPVFRELLRSICFFHR-TSG-QEGIWRLKEHF 1341          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 316/556 (56.83%), Postives = 401/556 (72.12%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            DD D E +  RI   K   +    ++ +       D   E + GF V   +W KLY YQQ GVRW+ +LH   AGGILGDEMGLGKTIQVI+FLAGLS    R++G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  IA   G+LIT+YS++     +L RYDW YIILDEGHKI+NPNA VT  CKQF+T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL +GGP+ +   P      + T++ H   FG + RSGK++VV+ LLRLW++  H+VLLF+Q R ML IL+ F+ +  YS   MDGTT I SR  ++ ++N    +  FIFLLTT+VGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ  +V IYRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  444 DDGDVEYYRQRIRRWKRNRLREKEEKRERGEEMSDDSDAEFDEGFKVPGFLWKKLYKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVISFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKKEKLIPEIASCHGILITSYSAVRNLQDILIRYDWHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFSGGPRMLKGIP----EDQLTEEEH---FGFWRRSGKLIVVESLLRLWFKQGHRVLLFSQSRQMLDILEVFVRENNYSYLKMDGTTTIASRQPLIARYNQD--RSIFIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 990          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 316/556 (56.83%), Postives = 401/556 (72.12%), Query Frame = 1
Query:  838 DDADYEEFCSRIIEHKNQLIAAAADQHQC------DEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLS----RSKGGNY---DIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVE--LQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKT 2460
            DD D E +  RI   K   +    ++ +       D   E + GF V   +W KLY YQQ GVRW+ +LH   AGGILGDEMGLGKTIQVI+FLAGLS    R++G NY    +GP +IVCPATVM QW+ EF  W P FRVA+LH TGS   K E+L+  IA   G+LIT+YS++     +L RYDW YIILDEGHKI+NPNA VT  CKQF+T HR I+SGSP+QNNLKELWSL DF++PGKLG+L  F++ F+VPI  GGY +ASP+QV+TAY+CACV+RDTIN YLLRR KA+V+  L LP K EQVLFC LT  Q +VY+ +L S++  QI+ G    F GL+ LRKICNHPDL +GGP+ +   P      + T++ H   FG + RSGK++VV+ LLRLW++  H+VLLF+Q R ML IL+ F+ +  YS   MDGTT I SR  ++ ++N    +  FIFLLTT+VGGLG+NL GA+RV+++DPDWNP TD QARERAWRIGQ  +V IYRL+ +G++EEKIYHRQ+FKQFLTNR+LK+P+QRRFFK+
Sbjct:  444 DDGDVEYYRQRIRRWKRNRLREKEEKRERGEEMSDDSDAEFDEGFKVPGFLWKKLYKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVISFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKKEKLIPEIASCHGILITSYSAVRNLQDILIRYDWHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLDSKEVYQILNGDMQVFSGLIALRKICNHPDLFSGGPRMLKGIP----EDQLTEEEH---FGFWRRSGKLIVVESLLRLWFKQGHRVLLFSQSRQMLDILEVFVRENNYSYLKMDGTTTIASRQPLIARYNQD--RSIFIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKS 990          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Match: ercc6l (excision repair cross-complementation group 6-like [Source:NCBI gene;Acc:100005291])

HSP 1 Score: 290.426 bits (742), Expect = 1.798e-84
Identity = 185/554 (33.39%), Postives = 285/554 (51.44%), Query Frame = 1
Query:  874 IEHKNQLIAAAADQHQCDEGIEIN-PGFVVASSIWNKLYGYQQAGVRWLLQLHDNG-AGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYD-----WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGK-LGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQC-KQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGH----------FSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGT-TAIGSRHAIVDKFN-DSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL---KNPRQRRFFKTQ 2463
            I+   +L++    + + DE + +N  GF++   + +KLYGYQ+ GV +L  L+ +G  GGIL D+MGLGKTIQVI+FL+G+      N  I   L++ P +++  W+ EF  W P  RV   H  G+   +  R LE +    GV+ITTY+ ++ +   L+ Y      W Y+ILDE HKIKN ++K         +++R++++G+P+QNNL+E+W+L DF   G  LG+  +F   +  PI +   + A+P                  E L  +             E++ F  L                C K+++   + P   L +L+K+C+HP L++              AR   ++  +    H           S SGK+  +  LL        + L+F   R +L I++R +  +G+ +  +DGT T I  R  ++  F  D  Y    +FLLTT+VGG+G+ L  A+RV+++DP WNP TD QA +RA+RIGQ   VVIYRL+  G+VEEKIY RQVFK  L  +     KNP   R+F  Q
Sbjct:   48 IKKIQELLSQNDSEDEDDEFVNVNNSGFMLYKELHDKLYGYQREGVSFLYGLYRDGRKGGILADDMGLGKTIQVISFLSGMY----DNELIKHTLLIMPTSLITNWIKEFSRWTPGMRVKEFH--GASKAERTRSLEKVQRRSGVVITTYNMLLNNWQQLSSYQGKEFCWDYVILDEAHKIKNTSSKTAKSAYAIPSKNRVLLTGTPVQNNLREMWALFDFACQGTLLGTGKTFKTEYENPITRAREKDATP-----------------GEKLCEK-------------EKLQFIDL---------------DCIKELLLTTRSPLAELTVLKKLCDHPRLLSTD----------ALARLGLEENAADAAAHGIADVPDHTLISESGKLAFLVALLERLREEGQRTLIFAHYRKVLDIIERILNNRGFKVLRLDGTITQITERERLISLFQKDRSYS---VFLLTTQVGGVGITLTAANRVVIYDPSWNPATDAQAVDRAYRIGQTENVVIYRLITCGTVEEKIYRRQVFKDSLIRQNTGDKKNP--FRYFSKQ 535          
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Match: ercc6l2 (ERCC excision repair 6 like 2 [Source:NCBI gene;Acc:101165812])

HSP 1 Score: 293.123 bits (749), Expect = 5.061e-82
Identity = 184/559 (32.92%), Postives = 283/559 (50.63%), Query Frame = 1
Query:  958 VASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIG---PV-----------------LIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLAS---------------------RQC--KQIIAGQQVP---FPGLVMLRKICNHPDLVTGGPK------------CVLDHPIL-GFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFK 2457
            V  +I   L  YQ+ G++++ + +   +G ILGD+MGLGKT+QVI FLA +    G   D+    P+                 L+V P +V+  W DE   W   F   ++H    G  K E L         + +TTY ++ L        +W  + +DE HKIKNPN+++T   K    + R+ ++G+ +QNNL+ELW ++D+  PG LG+L  F   F+ P+ +G    A+   + T  +    +   I+ + LRRTKA +E QLP+K ++V++C LT  Q  VY+  L +                     R C  K+   G Q+    F  L +LRK+ NH  L+   P             C    P    F +   ++         + SGKM V+++LL+ + + + K+L+F+    +L +L+ +   +G     +DGTT    R  IV  FN S +    + L++T  GGLGLN VGA+ V++FDP WNP  DLQA +RA+RIGQ R V + RL+  G+VEE IY RQV+KQ L   ++     RR+F+
Sbjct:   83 VPFTINRYLRDYQREGIKFIYKNYIRSSGCILGDDMGLGKTVQVIGFLAAVLHKTGTWEDVENNRPLFLQSQIPSKESNSNKVFLVVAPLSVLYNWKDELDTWG-YFHCVVVH----GLRKEEELTRISNGRIEIALTTYETLRLCLDQFNMINWSAVFVDEAHKIKNPNSQITQAMKGLRCKVRIGLTGTILQNNLEELWCVMDWAVPGCLGNLGHFKNKFSDPVEQGQRHSATKRALATGRKTVRALVKKISPWFLRRTKALIEEQLPKKDDRVVYCSLTDFQQAVYQAVLDTEDVTLLLRSSDKCECQSGRTRRSCCYKKNSEGAQIKELYFSYLAILRKVANHAALLQFTPGTSKKQEKYVSSICAKVFPNFPDFVQRCRNEAFE-ALSDPTYSGKMKVLQKLLKYYLQKRSKMLIFSLSTKLLDVLESYCMAEGLDYSRLDGTTKSKDRVQIVKDFNSSSH--VNLCLVSTMAGGLGLNFVGANVVVLFDPTWNPANDLQAIDRAYRIGQCRDVTVLRLISLGTVEEIIYLRQVYKQQLQCSVVGEQSARRYFE 633          
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Match: SMESG000014388.1 (SMESG000014388.1)

HSP 1 Score: 2316.19 bits (6001), Expect = 0.000e+0
Identity = 1196/1204 (99.34%), Postives = 1199/1204 (99.58%), Query Frame = 1
Query:  142 MSEFNDNFLLKHVKAVDQNKFESDILSKVDKAYKNHVNEEKSVIKRNLTETTDKIKTLSKSVNELNECLVYNLKNNKCSEEEFNKIKNSLQNQIDLKKQEIARLSRFEKKYKDQLATFDISEKFNTILDGAGKESDKNLLXXXXXXXXXXXXXXXXXXXPLEPGEIADSDDSGTSVVSNQTMVFDHRNEQLEIAEPVVRKRKIVFTEEQGDQQEVVLVXXXXXXXXXXXXTVDDADYEEFCSRIIEHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQXXXXXXXXXXXGTASDTSIMFRGSKHHKSLKSNYFDEARLPIDAFTXXXXXXXXXXXXVLGAYEGLAGDSAAIAVPTDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMSKAMGIXXXXXXXXXXXXXAECNTTVTNSTRIEGEFISNVKAKKEYKPPADDTDQKSATGADHIVSVLLPNKTGQSTASVSYNVVCAAEMVAERAKRSLEQTLANVGVTDKIYHDSVLADESPDPALVQREAETAAKNGADWLRAHLLGNRNGGRLRVVFGVTKNSFLFNKNEEKLYFQNLGXXXXXXADSLFHFNGSANQSATNNAKHVRFSSGLLLTLIRNRSMSSANRPTGTRDNPVVVNNEVKTLTNSIYLFLESSGTGQTTSKQLVRHFRSQVSSKNNLLFKSILNELCTFQRSTSGPNDGTWHLRVEFTNNN 3753
            MSEFNDNFLLKHVKAVDQNKFESDILSKVDKAYKNHVNEEKSVIKRNL ETTDKIKTLSKSVNELNECLVYNLKNNKCSEEEFNKIKNSLQNQIDLKKQEIARLSRFEKKYKDQLATFDISEKFNTILDGAGKESDKNLLKAEREKAKEKRKKHRKTKEPLEPGEIADSDDSGTSVVSNQTMVFDHRNEQLEIAEPVVRKRKIVFTEEQGDQQE V+VKKKKSQRIKIDKTVDDADYEEFCSRIIEHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQDLRDLFRLDDLGTASDTSIMFRGSKHHKSLKSNYFDEARLPIDAFTSDDDNSNHGDNDVLGAYEGLAG SAAIAVPTDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMSKAMGIQGNNSSGSKSQSNAEC+TTVTNSTRIEGEFISNVKAKKEYKPPADDTDQKSATGADHIVSVLLPNKTGQST SVSYNVVCAAEMVAERAKRSLEQTLANVGVTDKIYHDSVLADESPDPALVQREAETAAKNGADWLRAHLLGNRNGGRLRVVFGVTKNSFL+NKNEEKLYFQNLG SSSSSADSLFHFNGSANQSATNNAKHVRFSSGLLLTLIRNRSMSSANRPTGTRDNPVVVNNEVKTLTNSIYLFLESSGTGQTTSKQLVRHFRSQVSSKNNLLFKSILNELCTFQRSTSGPNDGTWHLRVEFTNNN
Sbjct:    1 MSEFNDNFLLKHVKAVDQNKFESDILSKVDKAYKNHVNEEKSVIKRNLMETTDKIKTLSKSVNELNECLVYNLKNNKCSEEEFNKIKNSLQNQIDLKKQEIARLSRFEKKYKDQLATFDISEKFNTILDGAGKESDKNLLKAEREKAKEKRKKHRKTKEPLEPGEIADSDDSGTSVVSNQTMVFDHRNEQLEIAEPVVRKRKIVFTEEQGDQQEAVVVKKKKSQRIKIDKTVDDADYEEFCSRIIEHKNQLIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPRQRRFFKTQDLRDLFRLDDLGTASDTSIMFRGSKHHKSLKSNYFDEARLPIDAFTSDDDNSNHGDNDVLGAYEGLAGGSAAIAVPTDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMSKAMGIQGNNSSGSKSQSNAECSTTVTNSTRIEGEFISNVKAKKEYKPPADDTDQKSATGADHIVSVLLPNKTGQSTTSVSYNVVCAAEMVAERAKRSLEQTLANVGVTDKIYHDSVLADESPDPALVQREAETAAKNGADWLRAHLLGNRNGGRLRVVFGVTKNSFLWNKNEEKLYFQNLG-SSSSSADSLFHFNGSANQSATNNAKHVRFSSGLLLTLIRNRSMSSANRPTGTRDNPVVVNNEVKTLTNSIYLFLESSGTGQTTSKQLVRHFRSQVSSKNNLLFKSILNELCTFQRSTSGPNDGTWHLRVEFTNNN 1203          
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Match: SMESG000033073.1 (SMESG000033073.1)

HSP 1 Score: 307.76 bits (787), Expect = 4.758e-87
Identity = 186/508 (36.61%), Postives = 275/508 (54.13%), Query Frame = 1
Query:  940 INPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPER--LLESIAHHPGVLITTYSSMVLHHPLLT---RYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKL-GSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQ-------LPRKTEQVLFCGLTGHQNEVYREYLASRQCKQII--AGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGS-RHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLT 2415
            IN  + + + +++KLY YQQ GV WL +L     G IL D+MGLGKTIQ+I +L  L  S+     I  VLI+ P +++  W  E   WAP     LL  T  G DK  +   L+ I H  G+LITTY +++     L     + W  ++LDEGHKIKNP++K            R++M+G+ +QNNLKELW+L DF + G L G+  +F + +  PI     + AS  +     R +  +++ I  Y LRRTK +V  Q       L  KT+  ++  +T  Q + Y+ +L   + K ++    ++ P   L +L+KIC+HP L++      L    L +AR              + SGKM  V +LL+       K L+F+Q +++L IL R +         +DG     + R  IVD FN +   E  I LLT +VGG+GL L GA+RV+++D +WNP  D QA +R +RIGQ + V++YRL+  G+VEEKIY RQ+FK  L 
Sbjct:   75 INETYYLNAKMFDKLYEYQQEGVIWLFELFKQKKGCILADDMGLGKTIQMIFYLRELFESEM----IKSVLIIIPKSLIVNWERELIVWAP----DLLVLTYFGNDKENKWKCLKKIQHKGGILITTYGTVMHSWDGLNSDENFKWNILLLDEGHKIKNPSSKTFKTVNALRADLRIVMTGTAVQNNLKELWALFDFTHQGSLLGTYPTFNRGYERPITDSRKKDASKEEKLYGDRISISLKNLIKPYFLRRTKEQVINQINVNSGGLSIKTDLAIWIPMTDVQIDFYKRFLELEEVKILLLRTEKRSPLLELNVLKKICDHPRLLSPEQCQTLG---LKYARTIN---DIDIDDLIAESGKMTFVIQLLKQMIIENCKCLIFSQSKVILNILGRLLLSMKVKFLRLDGDVLKATDRQMIVDNFNTNS--EVKILLLTLQVGGVGLTLTGANRVIIYDLNWNPSIDAQAVDRIYRIGQKKDVIVYRLISCGTVEEKIYRRQIFKDSLN 566          
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Match: SMESG000076666.1 (SMESG000076666.1)

HSP 1 Score: 293.123 bits (749), Expect = 7.165e-81
Identity = 172/498 (34.54%), Postives = 262/498 (52.61%), Query Frame = 1
Query:  982 LYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFE-TRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQII------AGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDD--------GHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILK 2430
            L  YQ  G+ WL+ L++N   GIL DEMGLGKTIQ I  +  L   K  N   GP LI+ P + M  W  EF  W P  +  L    GS   + E   +       VL+TTY  ++     L++  W+Y+I+DEGH++KN + K+T     F    +RL+++G+P+QN L ELW+L++F+ P    S+ +F Q F  P    G      L  E        +   +  +LLRR K EVE QLP K E V+ C ++  Q +VY    + R   + +        +++    L+ LRKICNHP +    P+  +++    F +    +           +    +  SGK  ++  +L    R KH+VL+F Q   ++ +++ ++E + +    +DGTT    R  ++  FN  P  E FIF+L+TR GGLGLNL  AD V++FD DWNP  DLQA++RA RIGQ  +V + RL++  S+EEKI     FK  +  ++++
Sbjct:  548 LKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVN---GPFLIIVPLSTMSNWAMEFEKWGPSVKKILY--KGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSG--EKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMF---PEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFN-KPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQ 1034          
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 287.345 bits (734), Expect = 8.646e-81
Identity = 172/509 (33.79%), Postives = 272/509 (53.44%), Query Frame = 1
Query:  952 FVVASSIW----NKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAP-LFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGL----VMLRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELL-RLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            F   S+ W     ++  YQ  G+ W++QL+ +   GIL DEMGLGKT+Q I+ +  L    G     G  +++ P + ++ W++E   WAP L  ++L+   G    + E + +       VL+TTY   +     + +Y++ Y+ +DE H+IKN N+K++   ++F + HRL+++G+P+QNNL ELW+L++F+ P +  S  +F + F    M      A   QV+  +         +  YLLRR K +VE +LP K E  ++ GL+  Q E+Y + L           ++V    L    + LRK  NHP L  G   GP    D+ ++                  +  GKM+++ +LL RL   G  +VL+FTQ   ML IL+ +   +G+  C +DG T    R   +D +N SP    F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA++RA RIGQ + V ++RL+   +VEE+I  R   K  L N +++  R
Sbjct:   61 FRFESTPWYVSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKK---GHFIVITPKSTLQNWVNEINRWAPSLTSISLI---GDQQARHEIIHQLQTKQWDVLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDELFNNDKM------AEQNQVQKLHSI-------LKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVEKTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLV------------------ANCGKMILLDKLLSRLKAEGS-RVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYN-SPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGR 530          
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 286.96 bits (733), Expect = 9.077e-81
Identity = 169/508 (33.27%), Postives = 269/508 (52.95%), Query Frame = 1
Query:  952 FVVASSIW----NKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWAP-LFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHPLLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQCKQIIAGQQVPFPGL----VMLRKICNHPDLVTG---GPKCVLDHPILGFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRILKNPR 2439
            F   S+ W     ++  YQ  G+ W++QL+ +   GIL DEMGLGKT+Q I+ +  L    G     G  +++ P + ++ W++E   WAP L  ++L+   G    + E + +       VL+TTY   +     + +Y++ Y+ +DE H+IKN N+K++   ++F + HRL+++G+P+QNNL ELW+L++F+ P +  S  +F + F    M      A   QV+        +   +  YLLRR K +VE +LP K E  ++ GL+  Q E+Y + L           ++V    L    + LRK  NHP L  G   GP    D+ ++                  +  GKM+++ +LL        +VL+FTQ   ML IL+ +   +G+  C +DG T    R   +D +N SP    F+F+L+TR GGLG+NL  AD V+++D DWNP  DLQA++RA RIGQ + V ++RL+   +VEE+I  R   K  L N +++  R
Sbjct:   38 FRFESTPWYVSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKK---GHFIVITPKSTLQNWVNEINRWAPSLTSISLI---GDQQARHEIIHQLQTKQWDVLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDELFNNDKM------AEQNQVQK-------LHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVEKTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLV------------------ANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYN-SPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGR 507          
The following BLAST results are available for this feature:
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERCC60.000e+053.60ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC6L3.929e-9634.71ERCC excision repair 6 like, spindle assembly chec... [more]
ERCC6L2.435e-8734.76ERCC excision repair 6 like, spindle assembly chec... [more]
SMARCA13.070e-8233.98SWI/SNF related, matrix associated, actin dependen... [more]
ERCC6L23.440e-8232.56ERCC excision repair 6 like 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csb-11.087e-10135.60CSB (Cockayne Syndrome B) homolog [Source:UniProt... [more]
swsn-42.787e-8135.25SWI/SNF nucleosome remodeling complex component; S... [more]
chd-11.447e-7735.14Chromodomain and Helicase Domain protein [Source:... [more]
isw-11.799e-7733.07Chromatin-remodeling complex ATPase chain isw-1 [... [more]
pqn-155.276e-7735.37Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iswi2.097e-7833.07gene:FBgn0011604 transcript:FBtr0087841[more]
Iswi2.097e-7833.07gene:FBgn0011604 transcript:FBtr0087842[more]
Iswi2.097e-7833.07gene:FBgn0011604 transcript:FBtr0087843[more]
okr1.389e-7732.68gene:FBgn0002989 transcript:FBtr0077673[more]
brm5.048e-7534.48gene:FBgn0000212 transcript:FBtr0075524[more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc60.000e+056.76excision repair cross-complementation group 6 [Sou... [more]
ercc61.233e-15952.93excision repair cross-complementation group 6 [Sou... [more]
ercc66.027e-15356.63excision repair cross-complementation group 6 [Sou... [more]
ercc6l6.267e-9634.76excision repair cross-complementation group 6-like... [more]
smarca14.953e-8234.68SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc60.000e+057.22ERCC excision repair 6, chromatin remodeling facto... [more]
ercc60.000e+057.22ERCC excision repair 6, chromatin remodeling facto... [more]
ercc66.976e-16649.36ERCC excision repair 6, chromatin remodeling facto... [more]
unnamed10125331.017e-9836.48Putative ortholog of ancient conserved domain prot... [more]
rcn32.832e-8533.92reticulocalbin 3 [Source:Xenbase;Acc:XB-GENE-57818... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ercc60.000e+058.61excision repair cross-complementing rodent repair ... [more]
Ercc6l2.048e-9334.55excision repair cross-complementing rodent repair ... [more]
Ercc6l22.118e-8433.16excision repair cross-complementing rodent repair ... [more]
Smarca51.374e-8132.96SWI/SNF related, matrix associated, actin dependen... [more]
Ercc6l21.747e-8133.16excision repair cross-complementing rodent repair ... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03468|ERCC6_HUMAN0.000e+053.60DNA excision repair protein ERCC-6 OS=Homo sapiens... [more]
sp|F8VPZ5|ERCC6_MOUSE0.000e+058.61DNA excision repair protein ERCC-6 OS=Mus musculus... [more]
sp|P40352|RAD26_YEAST2.211e-17046.55DNA repair and recombination protein RAD26 OS=Sacc... [more]
sp|Q9UR24|RHP26_SCHPO2.002e-16646.02DNA repair protein rhp26 OS=Schizosaccharomyces po... [more]
sp|Q9ZV43|CHR8_ARATH5.622e-16548.26Protein CHROMATIN REMODELING 8 OS=Arabidopsis thal... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GRL40.000e+053.66Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A2C9JP580.000e+054.65Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3JMN10.000e+056.94DNA excision repair protein ERCC-6 OS=Lingula ungu... [more]
A0A267GRT50.000e+053.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3S1BSX80.000e+054.47Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc60.000e+055.87excision repair cross-complementation group 6 [Sou... [more]
ercc6l1.865e-9435.02excision repair cross-complementation group 6-like... [more]
smarca14.264e-8234.31SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca15.685e-8234.31SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca58.100e-8034.00SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc61.375e-17749.74excision repair cross-complementation group 6 [Sou... [more]
ercc61.482e-17649.91excision repair cross-complementation group 6 [Sou... [more]
ercc69.013e-13057.39excision repair cross-complementation group 6 [Sou... [more]
ercc61.468e-12155.81excision repair cross-complementation group 6 [Sou... [more]
ercc6l2.527e-9134.67excision repair cross-complementation group 6-like... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD263.184e-17246.55Protein involved in transcription-coupled nucleoti... [more]
ISW21.222e-8635.62ATP-dependent DNA translocase involved in chromati... [more]
STH12.546e-8234.29ATPase component of the RSC chromatin remodeling c... [more]
SNF21.364e-7934.07Catalytic subunit of the SWI/SNF chromatin remodel... [more]
ISW12.166e-7632.42ATPase subunit of imitation-switch (ISWI) class ch... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461326.993e-8732.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481161.016e-8235.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393002.041e-7635.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407619.626e-7632.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395851.332e-7432.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc61.470e-856.83ERCC excision repair 6, chromatin remodeling facto... [more]
ercc60.000e+056.83ERCC excision repair 6, chromatin remodeling facto... [more]
ercc60.000e+056.83ERCC excision repair 6, chromatin remodeling facto... [more]
ercc6l1.798e-8433.39excision repair cross-complementation group 6-like... [more]
ercc6l25.061e-8232.92ERCC excision repair 6 like 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of DNA excision repair protein ERCC-6-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014388.10.000e+099.34SMESG000014388.1[more]
SMESG000033073.14.758e-8736.61SMESG000033073.1[more]
SMESG000076666.17.165e-8134.54SMESG000076666.1[more]
SMESG000017699.18.646e-8133.79SMESG000017699.1[more]
SMESG000017699.19.077e-8133.27SMESG000017699.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007712 ID=SMED30007712|Name=DNA excision repair protein ERCC-6-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3965bp
CATTTAATTGGAATTCGCATCCAGTTGAATATTTTAGGTTCGGCAAAACA
ATTCAAATTGATTGTTTTTTGTTTTGTTTAAATATATAAAGTAAAAATGG
CACCGTTTAAAATTTAAATTATAAAATTTTGATATTTATAAATGTCGGAA
TTCAATGATAATTTTCTTCTTAAACATGTTAAAGCTGTTGATCAAAATAA
ATTCGAATCGGATATTTTATCGAAAGTAGACAAAGCATATAAAAACCATG
TCAATGAAGAAAAGTCAGTTATTAAGAGAAATCTAACGGAAACAACTGAT
AAAATTAAAACTTTGTCTAAGTCGGTTAATGAACTAAATGAATGCTTAGT
TTACAATTTGAAAAATAATAAATGTTCAGAAGAGGAATTTAATAAAATTA
AAAACTCTCTTCAGAATCAAATTGATTTGAAGAAACAAGAAATAGCGAGA
TTGAGCCGATTTGAAAAAAAATACAAAGATCAACTGGCAACATTTGACAT
TTCAGAGAAATTTAATACGATCCTTGATGGAGCTGGGAAAGAGAGCGATA
AAAATCTATTAAAGGCAGAGAGAGAAAAGGCAAAGGAGAAGAGGAAAAAG
CACCGCAAAACCAAAGAGCCCCTTGAACCGGGGGAAATTGCCGACAGTGA
TGACAGCGGCACGTCGGTAGTGTCAAATCAGACGATGGTATTCGATCATA
GGAATGAGCAGTTGGAAATCGCTGAACCGGTAGTCAGAAAACGGAAAATT
GTTTTCACAGAAGAACAAGGAGATCAACAAGAGGTAGTACTGGTGAAGAA
GAAAAAATCCCAGAGAATAAAAATAGACAAGACAGTGGATGATGCCGATT
ATGAGGAGTTTTGCAGCCGGATTATCGAACACAAGAACCAACTGATTGCC
GCCGCCGCCGACCAGCACCAATGCGATGAAGGTATTGAAATCAATCCAGG
ATTTGTCGTTGCATCGAGCATATGGAATAAGCTCTATGGATATCAGCAGG
CGGGAGTGCGCTGGTTGCTACAGTTGCATGACAACGGCGCCGGGGGAATC
CTCGGAGATGAGATGGGCCTCGGGAAAACCATTCAAGTGATCGCGTTCCT
TGCTGGGTTGTCTAGGTCGAAAGGAGGGAATTATGATATCGGCCCGGTAT
TGATTGTCTGCCCAGCAACGGTGATGCGCCAATGGATGGATGAATTCAGG
GCTTGGGCACCTTTGTTCCGGGTGGCGTTACTACACGCCACAGGCAGTGG
CTACGACAAACCGGAGCGACTACTAGAATCAATAGCCCACCATCCAGGGG
TCCTCATCACCACTTATTCATCGATGGTGCTCCATCACCCGCTATTGACC
CGGTATGATTGGCAGTATATCATCCTTGATGAGGGACATAAGATCAAGAA
TCCAAATGCCAAAGTTACTCACTGCTGTAAACAGTTCGAGACTCGGCACC
GGCTCATCATGTCAGGCAGTCCAATCCAGAACAACCTGAAAGAATTGTGG
TCACTTGTAGATTTCATTTATCCCGGTAAACTCGGTTCCCTCGCAAGTTT
CATTCAGAATTTTGCCGTGCCCATCATGAAGGGCGGCTATGAGCACGCCA
GCCCGCTGCAGGTTGAAACTGCTTATCGGTGCGCCTGCGTTGTCCGCGAC
ACGATCAATGAGTACTTGCTGCGCAGGACTAAGGCCGAGGTGGAGTTGCA
GTTGCCCAGGAAAACCGAGCAAGTTCTGTTCTGTGGTTTGACTGGCCATC
AGAATGAGGTCTATCGGGAATATCTGGCATCTCGGCAGTGCAAGCAGATT
ATCGCTGGCCAGCAAGTGCCATTCCCAGGCCTCGTCATGTTACGGAAGAT
TTGCAACCATCCCGACTTGGTGACAGGAGGACCGAAATGCGTACTCGATC
ATCCAATTCTCGGTTTCGCTCGGGAGGCAACTGACGATGGTCACAGCTAT
AAGTTCGGGCATTTCTCGCGTTCCGGCAAAATGGTGGTTGTCAAGGAGCT
GCTGAGGTTGTGGTACCGTGGCAAGCACAAGGTGCTGTTGTTCACTCAGG
GCCGGATGATGCTGCAGATACTGAAGCGGTTCATAGAGCAACAGGGCTAC
TCTATGTGCACCATGGACGGCACCACTGCTATCGGGTCTCGGCACGCGAT
TGTCGACAAATTTAACGATTCTCCATACAAAGAAGCTTTCATATTCCTTC
TCACAACTCGGGTTGGCGGGCTAGGATTGAATCTTGTTGGCGCCGACAGA
GTGCTCGTATTCGATCCCGACTGGAACCCGTGCACCGACTTGCAGGCTAG
GGAACGCGCCTGGCGCATTGGACAGAACCGAAAGGTCGTCATCTACCGAC
TGGTGATCAGTGGCAGTGTCGAGGAGAAAATATATCACCGGCAAGTGTTC
AAGCAGTTCCTGACCAATCGGATCCTCAAGAATCCTCGTCAGCGCAGATT
TTTCAAAACTCAAGATTTACGGGACCTGTTTCGATTGGATGACCTCGGTA
CCGCCAGTGACACCTCGATCATGTTCCGAGGTTCCAAGCACCACAAGAGC
TTGAAATCAAACTATTTTGACGAGGCCCGATTGCCAATTGACGCATTTAC
CAGTGACGATGACAACAGCAACCATGGTGACAATGACGTACTCGGTGCTT
ATGAGGGACTGGCGGGAGATAGCGCCGCCATTGCTGTACCGACAGATCTT
GACATAGAGGTCAAACAGGACACGAGCGCACTCCTCGTTGCGGAATTGGG
ACTGTCCCAGGAGAAATTGGACGCGTTGCGAAGGAAAGCCCGGCAGATGA
GCAAAGCAATGGGGATCCAAGGTAACAACAGTAGCGGCAGCAAAAGCCAA
TCAAATGCCGAGTGCAACACGACCGTAACCAACAGCACCCGGATCGAGGG
GGAATTCATCAGCAATGTCAAGGCCAAGAAAGAGTACAAGCCACCGGCAG
ATGATACCGATCAGAAATCCGCCACCGGGGCGGATCACATCGTGTCCGTG
CTGCTTCCAAATAAAACCGGCCAATCAACGGCCAGTGTCAGCTACAATGT
CGTCTGCGCTGCAGAAATGGTTGCCGAGCGCGCTAAAAGATCACTGGAGC
AAACGCTGGCCAATGTCGGCGTTACAGACAAGATTTACCACGACTCAGTG
CTGGCCGATGAAAGCCCAGACCCAGCACTTGTGCAACGGGAAGCAGAGAC
CGCTGCTAAGAACGGTGCCGACTGGTTACGCGCTCATCTACTGGGAAACC
GCAACGGGGGTCGACTTCGGGTGGTCTTCGGCGTCACCAAGAATTCATTT
CTCTTTAATAAGAATGAGGAGAAATTGTATTTTCAGAATCTTGGATCTTC
ATCATCATCATCGGCAGACAGTTTGTTCCATTTCAACGGTAGTGCCAATC
AGAGCGCAACAAACAACGCGAAACACGTGCGGTTTTCATCGGGATTGCTC
CTGACACTTATCAGGAATAGATCAATGAGTAGCGCCAATAGGCCGACAGG
AACACGGGACAATCCGGTGGTTGTCAACAATGAAGTGAAAACTTTGACCA
ATAGCATTTATCTGTTCCTGGAATCGAGCGGCACCGGACAAACGACATCA
AAGCAGTTGGTGAGGCACTTCCGTAGCCAAGTCTCATCAAAGAACAACTT
GCTGTTCAAATCGATACTCAACGAACTGTGCACCTTTCAGCGCTCAACTA
GCGGGCCCAATGACGGAACCTGGCATTTACGCGTGGAATTTACAAATAAT
AATAATAAATAAATAAGATTTTATTCTTTACACATCTTTTGCAATAACAG
AGCGATGAGAATCATAAAGAGTGATCTGATTGGTTGTTGATGTTGTTTGT
CGTGTTGCTGTCATTGGGCAATTATTATCTGTCAGCCGAGGCCCATGTCC
AGGCACATCATCACCACGAATCCTAGCACGGCACAGATCGATGCCAGATG
GCCGTTGCCCATTTG
back to top

protein sequence of SMED30007712-orf-1

>SMED30007712-orf-1 ID=SMED30007712-orf-1|Name=SMED30007712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1207bp
MSEFNDNFLLKHVKAVDQNKFESDILSKVDKAYKNHVNEEKSVIKRNLTE
TTDKIKTLSKSVNELNECLVYNLKNNKCSEEEFNKIKNSLQNQIDLKKQE
IARLSRFEKKYKDQLATFDISEKFNTILDGAGKESDKNLLKAEREKAKEK
RKKHRKTKEPLEPGEIADSDDSGTSVVSNQTMVFDHRNEQLEIAEPVVRK
RKIVFTEEQGDQQEVVLVKKKKSQRIKIDKTVDDADYEEFCSRIIEHKNQ
LIAAAADQHQCDEGIEINPGFVVASSIWNKLYGYQQAGVRWLLQLHDNGA
GGILGDEMGLGKTIQVIAFLAGLSRSKGGNYDIGPVLIVCPATVMRQWMD
EFRAWAPLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSMVLHHP
LLTRYDWQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLK
ELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACV
VRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQC
KQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPILGFAREATDDG
HSYKFGHFSRSGKMVVVKELLRLWYRGKHKVLLFTQGRMMLQILKRFIEQ
QGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVG
ADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHR
QVFKQFLTNRILKNPRQRRFFKTQDLRDLFRLDDLGTASDTSIMFRGSKH
HKSLKSNYFDEARLPIDAFTSDDDNSNHGDNDVLGAYEGLAGDSAAIAVP
TDLDIEVKQDTSALLVAELGLSQEKLDALRRKARQMSKAMGIQGNNSSGS
KSQSNAECNTTVTNSTRIEGEFISNVKAKKEYKPPADDTDQKSATGADHI
VSVLLPNKTGQSTASVSYNVVCAAEMVAERAKRSLEQTLANVGVTDKIYH
DSVLADESPDPALVQREAETAAKNGADWLRAHLLGNRNGGRLRVVFGVTK
NSFLFNKNEEKLYFQNLGSSSSSSADSLFHFNGSANQSATNNAKHVRFSS
GLLLTLIRNRSMSSANRPTGTRDNPVVVNNEVKTLTNSIYLFLESSGTGQ
TTSKQLVRHFRSQVSSKNNLLFKSILNELCTFQRSTSGPNDGTWHLRVEF
TNNNNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR000330SNF2_N
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 80..107
NoneNo IPR availableCOILSCoilCoilcoord: 133..159
NoneNo IPR availableGENE3DG3DSA:1.20.120.850coord: 534..786
e-value: 7.7E-79
score: 267.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 512..798
e-value: 7.7E-79
score: 267.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 136..174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 889..913
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 887..913
NoneNo IPR availablePANTHERPTHR45629FAMILY NOT NAMEDcoord: 17..1199
NoneNo IPR availablePANTHERPTHR45629:SF5DNA EXCISION REPAIR PROTEIN ERCC-6coord: 17..1199
NoneNo IPR availableCDDcd18000DEXHc_ERCC6coord: 281..461
e-value: 1.7022E-95
score: 301.165
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 611..738
e-value: 1.76216E-51
score: 175.358
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 642..727
e-value: 2.2E-18
score: 77.0
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 624..727
e-value: 7.2E-16
score: 58.5
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 619..777
score: 15.877
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 277..474
e-value: 3.2E-37
score: 139.7
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 293..462
score: 22.889
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 290..577
e-value: 4.8E-66
score: 222.9
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 246..511
e-value: 9.4E-72
score: 243.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 513..788
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 269..512