wnt11-1

Overview
Namewnt11-1 (ABY85210.1)
Smed IDSMED30007710
Length (bp)1744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wnt11-1 (SMED30007710) t-SNE clustered cells

Violin plots show distribution of expression levels for wnt11-1 (SMED30007710) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of wnt11-1 (SMED30007710) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for wnt11-1 (SMED30007710) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007710

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30007710SMESG000005930.1 ABY85210.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 ABY85210.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30007710SMESG000005930.1 ABY85210.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30007710SMESG000005930.1 SmedASXL_016131SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior muscle cellSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30007710SMESG000005930.1 dd_Smed_v6_14391_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30007710SMESG000005930.1 dd_Smed_v6_14391_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 EU296633smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30007710SMESG000005930.1 EU296633smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 Smed-wnt11-1smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30007710SMESG000005930.1 Smed-wnt11-1smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30007710SMESG000005930.1 OX_Smed_1.0.18076ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
mouthSMED30007710SMESG000005930.1 Smed-wnt11-1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 Smed-wnt11-1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30007710SMESG000005930.1 dd_Smed_v4_14391_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
mouthSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30007710SMESG000005930.1 wnt11-1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wnt11-1 vs. Ensembl Human
Match: WNT4 (Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:12783])

HSP 1 Score: 135.576 bits (340), Expect = 1.346e-34
Identity = 103/375 (27.47%), Postives = 169/375 (45.07%), Query Frame = 2
Query:  206 NLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            +L + V  +   +   WL LAKL+          + SE E   K++ L +R  + C   ++   M +V   ++  +  C   F +RRWNC +++ LP     +  GT+E A V+A SSA + F ++R CS  +L  C C +     +         + +S C DNI  G+  +++F+   +                   +  S     +N HN E G   ++   + +CKCHGVSGSC  K C+R        ++   +K+ +  A  V  E          +    Q +P    DL ++E S D+CE D  +G +GT+GR C   N T    + C  +CCGRG+     +   +C C+      VKC+QC ++
Sbjct:    9 SLRLLVFAVFSAAASNWLYLAKLSSVG-------SISEEETCEKLKGLIQRQVQMC--KRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVS------PQGFQWSGCSDNIAYGVAFSQSFVDVRE-----------------RSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR--AVPPFRQVGHALKEKFDGATEV--EPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTC---NKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRL 344          
BLAST of wnt11-1 vs. Ensembl Human
Match: WNT11 (Wnt family member 11 [Source:HGNC Symbol;Acc:HGNC:12776])

HSP 1 Score: 134.42 bits (337), Expect = 3.752e-34
Identity = 123/398 (30.90%), Postives = 180/398 (45.23%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVIL-INYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            MR  P +   LL  + L      GIKWL L+K      LN++ H ++L+G   ++ +  R    L                MH V+ A++  +  C + FAD RWNC S+E  P    DL+ GT+E A V+A S+AA+   I+R C+   L  CSCG    +             +  C DN+  G+     F                S+     K+  SQ  K +  HN EVG   +  S + KCKCHGVSGSC  + C++ L+ L D      +K  YL A  V           H +   L   P+K ++L +++ S D+C  +   GS GTQ RQC   N T + ++ C  MCCGRGY    ++   +C C+      V C++C +   R  C
Sbjct:    1 MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLEL----------------MHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPG------PGNRWGGCADNLSYGLLMGAKF----------------SDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAAD--LKTRYLSATKVVHRPMGTR--KHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353          
BLAST of wnt11-1 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 127.487 bits (319), Expect = 1.490e-31
Identity = 94/319 (29.47%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  374 LHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            L H ++  M  +   +K  +  C   F  RRWNC +V+        +++G++E A  +A S+A +V  +SR C + +L  C C +     ++        + +  C DNID G    + F+   +          +           ++I+  +N HN E G   + N     CKCHGVSGSC  K C+ Q    D  ++   +K+ Y  A  + +    KL     +    +     T DL +I+ S DYC  + S GS+GTQGR C   N T    + C  MCCGRGY +    +T +C C+      VKCK+C +I
Sbjct:   82 LCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDL-----PRDWLWGGCGDNIDYGYRFAKEFVDARE----------RERIHAKGSYESARIL--MNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQ--LADFRKVGDALKEKYDSAAAMRLNSRGKL-----VQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLC---NKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEI 373          
BLAST of wnt11-1 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 127.487 bits (319), Expect = 1.490e-31
Identity = 94/319 (29.47%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  374 LHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            L H ++  M  +   +K  +  C   F  RRWNC +V+        +++G++E A  +A S+A +V  +SR C + +L  C C +     ++        + +  C DNID G    + F+   +          +           ++I+  +N HN E G   + N     CKCHGVSGSC  K C+ Q    D  ++   +K+ Y  A  + +    KL     +    +     T DL +I+ S DYC  + S GS+GTQGR C   N T    + C  MCCGRGY +    +T +C C+      VKCK+C +I
Sbjct:   82 LCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDL-----PRDWLWGGCGDNIDYGYRFAKEFVDARE----------RERIHAKGSYESARIL--MNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQ--LADFRKVGDALKEKYDSAAAMRLNSRGKL-----VQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLC---NKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEI 373          
BLAST of wnt11-1 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 127.487 bits (319), Expect = 1.527e-31
Identity = 94/319 (29.47%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  374 LHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            L H ++  M  +   +K  +  C   F  RRWNC +V+        +++G++E A  +A S+A +V  +SR C + +L  C C +     ++        + +  C DNID G    + F+   +          +           ++I+  +N HN E G   + N     CKCHGVSGSC  K C+ Q    D  ++   +K+ Y  A  + +    KL     +    +     T DL +I+ S DYC  + S GS+GTQGR C   N T    + C  MCCGRGY +    +T +C C+      VKCK+C +I
Sbjct:   67 LCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDL-----PRDWLWGGCGDNIDYGYRFAKEFVDARE----------RERIHAKGSYESARIL--MNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQ--LADFRKVGDALKEKYDSAAAMRLNSRGKL-----VQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLC---NKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEI 358          
BLAST of wnt11-1 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 130.568 bits (327), Expect = 4.776e-33
Identity = 100/369 (27.10%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  248 IKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXX---XGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            + WL L        ++  G +       + ++ L +R  RFC   K+   M +V   S A    C   F  RRWNC  ++ +             T+E A VHA SSAA+ ++++R C++     C C   ++D +         + Y  C DN+  GI  ++ F+   Q  +     D+ +    P+ Q  +  +  +N HN + G  ++  S + +CKCHG+SGSC  + C+  L       +   IKD +  A  V +  ++ +     +    Q +     DL ++  S D+CE DP  G +GT+GRQC    +  +  + CS +CCGRGY + ++    +C C+ +    V+C+ C Q  I K+
Sbjct:   21 LSWLALGLAANRFDRDKPGTS------CKSLKGLTRRQMRFC--KKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTRESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHS-----GKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPS-QLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMA--IKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQC---TLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPC-QKRIEKY 369          
BLAST of wnt11-1 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 127.487 bits (319), Expect = 4.817e-32
Identity = 93/317 (29.34%), Postives = 144/317 (45.43%), Query Frame = 2
Query:  398 MHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            M AV + ++  +  C + F   RWNC +      L P  K+ T+E A  +A  SA +  EI RRC Q  L  C C  +    NV        + +  C DN++ G + +R+F+   +              +   K+N       +N  N E G  I+    K KCKCHGVSG+C  K C+ QL  ++     K++++ Y +A  V + D   L       T  +K     TDL F++ S DYC  D  +G++GT+GR C+  +        C ++CCGRGY    ++   +C C+      V C+ C  +     C
Sbjct:   66 MPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNV-----PTDWSWGGCGDNVEYGYKFSRDFIDIRE-------------KEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVG--KILRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGS---GGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDIC 359          
BLAST of wnt11-1 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 107.457 bits (267), Expect = 6.342e-25
Identity = 91/348 (26.15%), Postives = 154/348 (44.25%), Query Frame = 2
Query:  323 EYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXX---------XXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSC----GKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQ 1327
            E  R++  L       C  +   F++  V    +  +  C   F   RWNC S +++ +             L+   +E A ++A  +A++V  I++ C+   L  C C    G     A    +     + +  C DN+  GI   + FL   +              +    +N + +++R   HN  VG   +  + + +C+CHGVSGSC  K C+ Q+++      L + K Y   A  VT +   +L          +K PL+  ++A++  S  YCE + +AG +GT GR+C  ++ + S +  C  +CCGRGY   +E    QC C+ V    VKCK C +
Sbjct:   62 ELCRRLDGLNPNQQALCAENP--FSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWETA------------QFDKTKNVAHLVRR---HNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDL-LKKRYDHFAVQVTRKATKRLRRKERTE---RKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGREC--IHNSYS-SESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTE 385          
BLAST of wnt11-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 100.908 bits (250), Expect = 7.036e-23
Identity = 98/408 (24.02%), Postives = 179/408 (43.87%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGK-DESDANVGXXXXXXXXXX----XXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLK------------TTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            M I   ++  ++ F++    ++   WL L+K + S      G +   C   + +  L  +  R C  H++   +  ++   ++ ++ C  TF    WNC ++         L++ ++E A V+A S+A +   ++R CS+  +  C CG+  +   +V  +  +         + C DN+  G    R F+  +                   +Q+ ++   ++N HN  VG  +++N+   +CKCHGVSGSC+ K C++ +    DE   ++ + Y L AK VT  +D KL      + G      +              +L +++ S +YC       +I  + R+C           +C N+CCGRG+R   E     C C+ V    VKCK C ++  R +CL
Sbjct:    1 MHINTPVLLAIIYFLVFAPKSADAWWL-LSKTDTSSANS--GSSPILC---KNVPGLTPQQKRMC--HENPNIIKYLISGLRSALHTCEYTFQREAWNC-TLTLPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYD------------------RQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWK-VMPKFDEFASRLHQKYQL-AKLVT-NNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYC-------AIDVKDREC---------GENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYCL 362          
BLAST of wnt11-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 100.908 bits (250), Expect = 7.036e-23
Identity = 98/408 (24.02%), Postives = 179/408 (43.87%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGK-DESDANVGXXXXXXXXXX----XXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLK------------TTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            M I   ++  ++ F++    ++   WL L+K + S      G +   C   + +  L  +  R C  H++   +  ++   ++ ++ C  TF    WNC ++         L++ ++E A V+A S+A +   ++R CS+  +  C CG+  +   +V  +  +         + C DN+  G    R F+  +                   +Q+ ++   ++N HN  VG  +++N+   +CKCHGVSGSC+ K C++ +    DE   ++ + Y L AK VT  +D KL      + G      +              +L +++ S +YC       +I  + R+C           +C N+CCGRG+R   E     C C+ V    VKCK C ++  R +CL
Sbjct:    1 MHINTPVLLAIIYFLVFAPKSADAWWL-LSKTDTSSANS--GSSPILC---KNVPGLTPQQKRMC--HENPNIIKYLISGLRSALHTCEYTFQREAWNC-TLTLPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYD------------------RQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWK-VMPKFDEFASRLHQKYQL-AKLVT-NNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYC-------AIDVKDREC---------GENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYCL 362          
BLAST of wnt11-1 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 103.605 bits (257), Expect = 2.119e-23
Identity = 62/221 (28.05%), Postives = 104/221 (47.06%), Query Frame = 2
Query:  689 CLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            C DN++ G+  +R FL   Q                  +Q +S +   +  HN   G + + ++ + +CKCHG+SGSC  K C+ ++    +      ++D Y  A+ VT+ +D       F+       P     L F + S D+C P+   G++GTQGR+C   NVT S ++ C  +CC RG+   + +E   C+C       V C++C++      CL
Sbjct:  227 CSDNVNFGLRHSRVFLDAKQ------------------RQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGR--LRDRYDSARKVTLRNDG----NSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGREC---NVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL 420          
BLAST of wnt11-1 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 103.605 bits (257), Expect = 2.119e-23
Identity = 62/221 (28.05%), Postives = 104/221 (47.06%), Query Frame = 2
Query:  689 CLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            C DN++ G+  +R FL   Q                  +Q +S +   +  HN   G + + ++ + +CKCHG+SGSC  K C+ ++    +      ++D Y  A+ VT+ +D       F+       P     L F + S D+C P+   G++GTQGR+C   NVT S ++ C  +CC RG+   + +E   C+C       V C++C++      CL
Sbjct:  227 CSDNVNFGLRHSRVFLDAKQ------------------RQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGR--LRDRYDSARKVTLRNDG----NSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGREC---NVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL 420          
BLAST of wnt11-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 91.2781 bits (225), Expect = 1.123e-19
Identity = 80/303 (26.40%), Postives = 125/303 (41.25%), Query Frame = 2
Query:  440 CMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLY------PTHFITTGLQKEPL---KTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            C   F   RWNC  V +       +   ++E A  +A +SA   + ++  C++  +  C C         G    +  + +  C  ++D G+   R F+   ++                  +  S+ +  +N HN   G  ++    ++ CKCHGVSGSC+ K C++ L          M+K  Y +AK V      +          H  T   QK  L   K  +L ++E S +YCE     GS GT GR C+    T      C  +CCGRG+     + T QCRC+      VKC +C
Sbjct:   65 CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDAREL------------------ERDSRTL--MNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLK--YQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQR---TGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 342          
BLAST of wnt11-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 90.5077 bits (223), Expect = 1.435e-19
Identity = 82/318 (25.79%), Postives = 130/318 (40.88%), Query Frame = 2
Query:  395 AMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLY------PTHFITTGLQKEPL---KTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            A+ A+    +     C   F   RWNC  V +       +   ++E A  +A +SA   + ++  C++  +  C C         G    +  + +  C  ++D G+   R F+   ++                  +  S+ +  +N HN   G  ++    ++ CKCHGVSGSC+ K C++ L          M+K  Y +AK V      +          H  T   QK  L   K  +L ++E S +YCE     GS GT GR C+    T      C  +CCGRG+     + T QCRC+      VKC +C
Sbjct:   23 ALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDAREL------------------ERDSRTL--MNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLK--YQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQR---TGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 315          
BLAST of wnt11-1 vs. Ensembl Fly
Match: Wnt4 (gene:FBgn0010453 transcript:FBtr0334799)

HSP 1 Score: 85.1149 bits (209), Expect = 3.862e-17
Identity = 82/318 (25.79%), Postives = 135/318 (42.45%), Query Frame = 2
Query:  416 ASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRA-----KHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVK--CKQCIQINIRKFC 1348
            A +    +C + F   RWNC S+E   K     KL  +E A VHA ++AA+   I+R C++ ++  CSCG  + +           + +  C DN+  G   TR+FL                     +    S+I++    H+ EVGI  + +    KCKCHGVSGSC  K C++++   +      +++  Y  A        +M   +            + +  + T L ++E S  YC          T+ RQC          ++C  +CCGRGY   + K+  +CRC   +    +  C  C ++  + FC
Sbjct:  266 ARRLATTHCEEQFRYDRWNC-SIETRGKRNIFKKL-YKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREA------QDFQWGGCNDNLKHGKRVTRSFLDLR----------------GGDGDEVSEILR----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATAT--LLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQCL-------HPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538          
BLAST of wnt11-1 vs. Ensembl Zebrafish
Match: wnt11f2 (wnt 11, family member 2 [Source:NCBI gene;Acc:791595])

HSP 1 Score: 142.124 bits (357), Expect = 4.941e-37
Identity = 118/390 (30.26%), Postives = 177/390 (45.38%), Query Frame = 2
Query:  209 LLMFVI---LINYNSGIKWLGLA------KLNRSHK-QELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            LL+F+    +I   +GI WLGL         N++H  + LDG    +       Q L KR+            MH+++ A++ T   C  +F+D RWNC S+E  P   PDL  GT+E A V + ++A +   I+R C+   L  CSC    S+           + +  C DN+  G+          QMG       + S+    N+++  Q  + +  HN  VG  ++M+S + KCKCHGVSGSC  K C++ L+ +        +K  YL A  V             +   ++  P+   +L ++  S DYC  +   GS+GT  RQC   N T S +  C  MCCGRGY    E    +C+C+      V CK C +   R  C
Sbjct:    8 LLLFITSLSVIYPCTGISWLGLTINGSSVGWNQTHHCKLLDGLVPDQ-------QQLCKRNLEL---------MHSIVRAARLTKSACTSSFSDMRWNCSSIESAPHFTPDLAKGTREAAFVFSLAAAVVSHAIARACASGDLPSCSCAAMPSE------QAAPDFRWGGCGDNLRYGL----------QMG------SAFSDAPIRNRRSGPQAFRLMQLHNNAVGRQVLMDSLEMKCKCHGVSGSCSVKTCWKGLQDISTISAD--LKSKYLSATKVIPRQIGTR--RQLVPREMEVRPVGENELVYLVSSPDYCTQNAKQGSLGTTDRQC---NKTASGSESCGLMCCGRGYNAYTEVLVERCQCKYHWCCYVSCKTCKRTVERYVC 352          
BLAST of wnt11-1 vs. Ensembl Zebrafish
Match: wnt11f2 (wnt 11, family member 2 [Source:NCBI gene;Acc:791595])

HSP 1 Score: 142.124 bits (357), Expect = 4.941e-37
Identity = 118/390 (30.26%), Postives = 177/390 (45.38%), Query Frame = 2
Query:  209 LLMFVI---LINYNSGIKWLGLA------KLNRSHK-QELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            LL+F+    +I   +GI WLGL         N++H  + LDG    +       Q L KR+            MH+++ A++ T   C  +F+D RWNC S+E  P   PDL  GT+E A V + ++A +   I+R C+   L  CSC    S+           + +  C DN+  G+          QMG       + S+    N+++  Q  + +  HN  VG  ++M+S + KCKCHGVSGSC  K C++ L+ +        +K  YL A  V             +   ++  P+   +L ++  S DYC  +   GS+GT  RQC   N T S +  C  MCCGRGY    E    +C+C+      V CK C +   R  C
Sbjct:    8 LLLFITSLSVIYPCTGISWLGLTINGSSVGWNQTHHCKLLDGLVPDQ-------QQLCKRNLEL---------MHSIVRAARLTKSACTSSFSDMRWNCSSIESAPHFTPDLAKGTREAAFVFSLAAAVVSHAIARACASGDLPSCSCAAMPSE------QAAPDFRWGGCGDNLRYGL----------QMG------SAFSDAPIRNRRSGPQAFRLMQLHNNAVGRQVLMDSLEMKCKCHGVSGSCSVKTCWKGLQDISTISAD--LKSKYLSATKVIPRQIGTR--RQLVPREMEVRPVGENELVYLVSSPDYCTQNAKQGSLGTTDRQC---NKTASGSESCGLMCCGRGYNAYTEVLVERCQCKYHWCCYVSCKTCKRTVERYVC 352          
BLAST of wnt11-1 vs. Ensembl Zebrafish
Match: wnt11 (wingless-type MMTV integration site family, member 11 [Source:ZFIN;Acc:ZDB-GENE-980526-249])

HSP 1 Score: 140.969 bits (354), Expect = 9.988e-37
Identity = 124/388 (31.96%), Postives = 178/388 (45.88%), Query Frame = 2
Query:  182 RIFPDLIGNLLMFVILINYNSGIKWLGLAK----LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAK---HVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            R FP L   LL F++L    +GI+WL L++    +N++ H + L G   S+ +  R    L                M  ++ A++     C KTF D RWNC S++    LP   + GT+E A V+A S+AA+   I+R C+   LR CSCG       +        Y +  C DNI  G+     F                    K  K++ S   K ++ HN EVG   + ++   KCKCHGVSGSC  + C+R L  L D  +   +K  YL A    H  M    +L P       +   P++  +L +++ S DYC  +   GS GTQ RQC   N T S ++ C  MCCGRGY    E+   +C C+      V CK+C
Sbjct:    3 RTFPSLPLCLLTFLLLSQQCTGIRWLALSQTAQHINKTQHCKTLPGLVSSQAQLCRSNLEL----------------MQTIIQAAREVKKVCQKTFTDMRWNCSSIDGPKFLPDLER-GTRESAFVYALSAAAISHTIARACTSGDLRLCSCGP------IPGEIPEPGYRWGGCADNIHYGLLMGSKF---------------SDAPMKMKKKSGSHANKLMHLHNSEVGRQALRDALVMKCKCHGVSGSCSIRTCWRGLLDLKDIAID--LKTKYLSATKVVHRPMGTRKQLVPKD-----IDIRPVRENELVYLQSSPDYCMKNDKLGSFGTQDRQC---NKTSSGSDSCDLMCCGRGYNPYTERVVERCHCKYHWCCYVTCKKC 342          
BLAST of wnt11-1 vs. Ensembl Zebrafish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 140.969 bits (354), Expect = 1.218e-36
Identity = 114/379 (30.08%), Postives = 180/379 (47.49%), Query Frame = 2
Query:  197 LIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKR--LNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDP-SAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            LI +LLM  + +   +   WL LAKL+          + S+ E   K++ L +R  + C   ++   M AV   ++  +  C   F +RRWNC ++E +P     +  GT+E A V+A S+A++ F ++R CS  +L  C C     D NV        + +S C DNI  G+  +++F+   +                   ++K Q   R  +N HN E G   ++N  + +CKCHGVSGSC  K C++        ++  +IK+ +  A  V +    K+  T   +    Q +P    DL +++ S D+CE DP + G +GT GR C   N T    + C  MCCGRG+     +   +C C+      VKCKQC
Sbjct:    6 LIRSLLMLFLALFSANASNWLYLAKLSSVG-------SISDEETCEKLRGLIQRQVQIC--KRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLESVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGC-----DRNV-HGVSPEGFQWSGCSDNIAYGVAFSQSFVDIRE-------------------RSKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVELR---KVGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 342          
BLAST of wnt11-1 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 132.88 bits (333), Expect = 8.395e-34
Identity = 99/331 (29.91%), Postives = 152/331 (45.92%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQK--EPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            KI  L  R    C       A+  +   ++  +  C   F   RWNC ++ +      +L++G++E A  +A ++A +   ++  CSQ  + HC C +++     G  NQ   + +  C  +I  GIE +R F+   ++                    K    + +N HN E G  ++    K +CKCHGVSGSC  K C+         E+  ++KD Y +A  V +   ++L    F+     +  +PL+ TDL +IE S +YCE D   GS+GTQGR C   N T   T+ C  MCCGRGY      +  QC C+      VKC  C
Sbjct:   44 KIPGLAPRQRAICQSRPD--AIIVIGEGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQ----GYYNQEEGWKWGGCSADIKYGIEFSRKFVDAREI--------------------KKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLE-TDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 342          
BLAST of wnt11-1 vs. Ensembl Xenopus
Match: rhbdl1 (rhomboid, veinlet-like 1 [Source:Xenbase;Acc:XB-GENE-953355])

HSP 1 Score: 156.762 bits (395), Expect = 3.477e-42
Identity = 131/400 (32.75%), Postives = 190/400 (47.50%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAK---HVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            M+I+  L+G  L F++      GIKWL LAK      LN+S H ++L+G   S+ +  R    L                M  ++ A+K     C+K F D RWNC S+E  P    DL+ GT+E A V+A S+AA+   I+R C+   +  CSC      A +   +    Y +  C DN++ GI     F                S+     K++ SQ  K ++ HN EVG  ++  S + KCKCHGVSGSC  K C+R L+ L +  L   +K  YL A    H  M    +L P       +   P++ T++ +++ S DYC  +   GS GT  RQC   N T + ++ C  MCCGRGY   M+K   +C C+      V CK+C +   R  C
Sbjct:    1 MKIY-FLLGIFLTFLLHTRICQGIKWLALAKTPLSLALNQSQHCKQLEGLVSSQMQLCRSNLEL----------------MQTIIHAAKEVKKTCIKAFTDMRWNCSSIELAPTFHQDLERGTRESAFVYALSAAAISHTIARACTTGDIPGCSC------APIPGESPGPGYRWGGCADNLNYGILMGSKF----------------SDAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWRGLQELREIALD--LKTKYLSATKVVHRPMGTRKQLVPKD-----IDIRPVQETEMIYLQSSPDYCLKNEKMGSHGTHERQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 351          
BLAST of wnt11-1 vs. Ensembl Xenopus
Match: wnt11b-2 (wingless-type MMTV integration site family, member 11B [Source:NCBI gene;Acc:549489])

HSP 1 Score: 151.369 bits (381), Expect = 2.680e-40
Identity = 118/381 (30.97%), Postives = 175/381 (45.93%), Query Frame = 2
Query:  206 NLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
             LL+ +        I+WLGL  +N S          +E E+ R +  L     + C   ++   M +V+ A+K     C  TF+D RWNC SVE  P   PDL  GT+E A V+A +SA +   I+R C+  +L  CSCG   ++           + +  C DN+  G+     F+                   K +K   +Q  K +N HN  VG  ++M+S ++KCKCHGVSGSC  K C++ L+ L        +K  YL A  V             +   L   P++ ++L ++  S DYC  +P  GS GTQ R C   +V    ++ C+ MCCGRGY    E    +C+C+      V CK+C +   R  C
Sbjct:    9 TLLLILCCSRLCGAIQWLGLT-VNGSR------VAWNESEHCRLLDGLVPEQSQLC--KRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSCGATPAEV------PGTGFRWGGCGDNLHYGLNMGSAFV---------------DAPMKSSKSGGTQATKMINLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWKGLQDLPHIANE--LKSKYLGATKVIHRQTGTR--RQLVPRELDIRPVRESELVYLVSSPDYCAKNPKLGSYGTQDRVCNKTSV---GSDSCNLMCCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVC 352          
BLAST of wnt11-1 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 138.658 bits (348), Expect = 1.022e-35
Identity = 105/379 (27.70%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  197 LIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
             + +LLM ++ +   +   WL LAKL+          + SE E   K++ L +R  + C   ++   M +V   ++  +  C   F +RRWNC +++ LP     +  GT+E A V+A SSA + F ++R CS   L  C C +     +         + +S C DNI  G+  +++F+   +                   +  S     +N HN + G   ++N+ + +CKCHGVSGSC  K C++        ++  ++K+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ D   G +GT GRQC   N T    + C  MCCGRG+     +   +C C+      VKCKQC ++
Sbjct:    6 FLRSLLMMILAVFSANASNWLYLAKLSSVG-------SISEEETCEKLKGLIQRQVQMC--KRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVS------PQGFQWSGCSDNIAYGVAFSQSFVDVRE-----------------RSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWK--AMPTFRKVGNVLKEKFDGATEV---EQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQC---NKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKV 344          
BLAST of wnt11-1 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 129.413 bits (324), Expect = 1.670e-32
Identity = 103/370 (27.84%), Postives = 169/370 (45.68%), Query Frame = 2
Query:  224 ILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            I+     G  W  LAKL+          + SE E   K++ L +R  + C   ++   M +V   ++  +  C   F +RRWNC +++ LP     +  GT+E A V+A SSA + F ++R CS   L  C C +     +         + +S C DNI  G+  +++F+   +                   +  S     +N HN + G   ++N+ + +CKCHGVSGSC  K C++        ++  ++K+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ D   G +GT GRQC   N T    + C  MCCGRG+     +   +C C+      VKCKQC ++
Sbjct:   13 IVFLSAQGNLWEYLAKLSSVG-------SISEEETCEKLKGLIQRQVQMC--KRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVS------PQGFQWSGCSDNIAYGVAFSQSFVDVRE-----------------RSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWK--AMPTFRKVGNVLKEKFDGATEV---EQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQC---NKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKV 342          
BLAST of wnt11-1 vs. Ensembl Xenopus
Match: wnt3 (Wnt family member 3 [Source:NCBI gene;Acc:100125198])

HSP 1 Score: 126.331 bits (316), Expect = 1.792e-31
Identity = 96/335 (28.66%), Postives = 148/335 (44.18%), Query Frame = 2
Query:  338 IQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSV-EXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTME---DDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            I  L  +  RFC ++     M +V    K  +  C   F  RRWNC ++ + L    P L   T+E A VHA +SA + F ++R C++     C C      +          + +  C ++ D G+  +R F                       ++N+      +N HN E G   +++    +CKCHG+SGSC  K C+    + D   +   +KD Y  A  +++E   +      T      L K P +  DL + E S ++CEP+P  GS GTQGR C   NVT    + C  +CCGRG+    EK   +C C       V C++C++I
Sbjct:   35 IPGLVPKQMRFCRNYIE--IMPSVAEGIKLGIQECQHQFRGRRWNCTTIHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSSTICGCDSHHKGSP------GDGWKWGGCSEDADFGVLVSREF--------------------ADARENRPDARSAMNRHNNEAGRATILDHMHLRCKCHGLSGSCEVKTCW--WSQPDFRAIGDHLKDKYDSASEMSVEKHRESRGWVETLRAKYSLFKPPTER-DLVYYETSPNFCEPNPETGSFGTQGRSC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRI 335          
BLAST of wnt11-1 vs. Ensembl Mouse
Match: Wnt11 (wingless-type MMTV integration site family, member 11 [Source:MGI Symbol;Acc:MGI:101948])

HSP 1 Score: 143.28 bits (360), Expect = 1.571e-37
Identity = 120/398 (30.15%), Postives = 179/398 (44.97%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVIL-INYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            MR  P +   LL  + L      GIKWL L+K      LN++ H ++L+G   ++ +  R    L                M  ++ A++  +  C + FAD RWNC S+E  P    DL+ GT+E A V+A S+A +   I+R C+   L  CSCG    +             +  C DN+  G+     F                S+     K+  SQ  K +  HN EVG   +  S ++KCKCHGVSGSC  + C++ L+ L D      +K  YL A  V           H +   L   P+K ++L +++ S D+C  +   GS GTQ RQC   N T + ++ C  MCCGRGY    ++   +C C+      V C++C +   R  C
Sbjct:    1 MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNLEL----------------MRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCGPVPGEPPG------PGNRWGGCADNLSYGLLMGAKF----------------SDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAAD--LKTRYLSATKVVHRPMGTR--KHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353          
BLAST of wnt11-1 vs. Ensembl Mouse
Match: Wnt11 (wingless-type MMTV integration site family, member 11 [Source:MGI Symbol;Acc:MGI:101948])

HSP 1 Score: 143.28 bits (360), Expect = 1.571e-37
Identity = 120/398 (30.15%), Postives = 179/398 (44.97%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVIL-INYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            MR  P +   LL  + L      GIKWL L+K      LN++ H ++L+G   ++ +  R    L                M  ++ A++  +  C + FAD RWNC S+E  P    DL+ GT+E A V+A S+A +   I+R C+   L  CSCG    +             +  C DN+  G+     F                S+     K+  SQ  K +  HN EVG   +  S ++KCKCHGVSGSC  + C++ L+ L D      +K  YL A  V           H +   L   P+K ++L +++ S D+C  +   GS GTQ RQC   N T + ++ C  MCCGRGY    ++   +C C+      V C++C +   R  C
Sbjct:    1 MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNLEL----------------MRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCGPVPGEPPG------PGNRWGGCADNLSYGLLMGAKF----------------SDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAAD--LKTRYLSATKVVHRPMGTR--KHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353          
BLAST of wnt11-1 vs. Ensembl Mouse
Match: Wnt4 (wingless-type MMTV integration site family, member 4 [Source:MGI Symbol;Acc:MGI:98957])

HSP 1 Score: 134.806 bits (338), Expect = 1.636e-34
Identity = 103/375 (27.47%), Postives = 168/375 (44.80%), Query Frame = 2
Query:  206 NLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            +L + V  +   +   WL LAKL+          + SE E   K++ L +R  + C   ++   M +V   ++  +  C   F +RRWNC +++ LP     +  GT+E A V+A SSA + F ++R CS  +L  C C +     +         + +S C DNI  G+  +++F+   +                   +  S     +N HN E G   ++   + +CKCHGVSGSC  K C+R        ++   +K+ +  A  V  E          +    Q +P    DL ++E S D+CE D  +G +GT+GR C   N T    + C  +CCGRG+     +   +C C       VKC+QC ++
Sbjct:    9 SLRLLVFAVFSAAASNWLYLAKLSSVG-------SISEEETCEKLKGLIQRQVQMC--KRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVS------PQGFQWSGCSDNIAYGVAFSQSFVDVRE-----------------RSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR--AVPPFRQVGHALKEKFDGATEV--EPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTC---NKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRL 344          
BLAST of wnt11-1 vs. Ensembl Mouse
Match: Wnt2 (wingless-type MMTV integration site family, member 2 [Source:MGI Symbol;Acc:MGI:98954])

HSP 1 Score: 128.257 bits (321), Expect = 4.475e-32
Identity = 105/348 (30.17%), Postives = 153/348 (43.97%), Query Frame = 2
Query:  302 GFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXX-XXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRL-NGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLR----AKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQ 1327
            G +R  C+    +  L  R  + C  H+H   M A+ +        C   F   RWNC ++++        L   ++E A V+A SSA +VF I+R CSQ +L+ CSC   +  +   + +   T+ +  C DNID GI+  R F+                      K+ K +  + L N HN   G   +    K +CKCHGVSGSC  + C+            +   DY  R    A  V M  D   +    +     K+P K  DL + E+S DYC  D  AGS+GT GR C   N+T    + C  MCCGRGY         +C C+      V+C+ C++
Sbjct:   35 GSSRVMCD---NVPGLVSRQRQLC--HRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGS---AKDSKGTFDWGGCSDNIDYGIKFARAFV--------------------DAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCW------LAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFT---VANKRFKKPTK-NDLVYFENSPDYCIRDREAGSLGTAGRVC---NLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLE 341          
BLAST of wnt11-1 vs. Ensembl Mouse
Match: Wnt5a (wingless-type MMTV integration site family, member 5A [Source:MGI Symbol;Acc:MGI:98958])

HSP 1 Score: 127.487 bits (319), Expect = 8.264e-32
Identity = 94/319 (29.47%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  374 LHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            L H ++  M  +   +K  +  C   F  RRWNC +V+        +++G++E A  +A S+A +V  +SR C + +L  C C +     ++        + +  C DNID G    + F+   +          +           ++I+  +N HN E G   + N     CKCHGVSGSC  K C+ Q    D  ++   +K+ Y  A  + +    KL     +    +     T DL +I+ S DYC  + S GS+GTQGR C   N T    + C  MCCGRGY +    +T +C C+      VKCK+C +I
Sbjct:   62 LCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDL-----PRDWLWGGCGDNIDYGYRFAKEFVDARE----------RERIHAKGSYESARIL--MNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQ--LADFRKVGDALKEKYDSAAAMRLNSRGKL-----VQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLC---NKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEI 353          
BLAST of wnt11-1 vs. UniProt/SwissProt
Match: sp|B2GUT4|WNT11_XENTR (Protein Wnt-11 OS=Xenopus tropicalis OX=8364 GN=wnt11 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.842e-41
Identity = 131/400 (32.75%), Postives = 190/400 (47.50%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAK---HVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            M+I+  L+G  L F++      GIKWL LAK      LN+S H ++L+G   S+ +  R    L                M  ++ A+K     C+K F D RWNC S+E  P    DL+ GT+E A V+A S+AA+   I+R C+   +  CSC      A +   +    Y +  C DN++ GI     F                S+     K++ SQ  K ++ HN EVG  ++  S + KCKCHGVSGSC  K C+R L+ L +  L   +K  YL A    H  M    +L P       +   P++ T++ +++ S DYC  +   GS GT  RQC   N T + ++ C  MCCGRGY   M+K   +C C+      V CK+C +   R  C
Sbjct:    1 MKIY-FLLGIFLTFLLHTRICQGIKWLALAKTPLSLALNQSQHCKQLEGLVSSQMQLCRSNLEL----------------MQTIIHAAKEVKKTCIKAFTDMRWNCSSIELAPTFHQDLERGTRESAFVYALSAAAISHTIARACTTGDIPGCSC------APIPGESPGPGYRWGGCADNLNYGILMGSKF----------------SDAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWRGLQELREIALD--LKTKYLSATKVVHRPMGTRKQLVPKD-----IDIRPVQETEMIYLQSSPDYCLKNEKMGSHGTHERQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 351          
BLAST of wnt11-1 vs. UniProt/SwissProt
Match: sp|P51891|WNT11_COTJA (Protein Wnt-11 OS=Coturnix japonica OX=93934 GN=WNT11 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.281e-41
Identity = 125/398 (31.41%), Postives = 188/398 (47.24%), Query Frame = 2
Query:  179 MRIFPD-LIGNLLMFVILINYNSGIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            M+  P  L+   L  ++      GIKW+ L+K      LN++ H ++L+G   S+ +  R    L                M  ++ A++  +  C KTF+D RWNC S+E  P    DL+ GT+E A V+A S+AA+   I+R C+   L  CSCG       +        Y +  C DN++ G+     F                S+     K++ SQ  K ++ HN EVG  ++  S + KCKCHGVSGSC  K C++ L+ L D  L   +K+ YL A  V           + +   +   P+K T+L +++ S D+C  +   GS GTQ RQC   N T + ++ C  MCCGRGY   M+K   +C C+      V CK+C +   R  C
Sbjct:    1 MKPSPQFLLAAFLSLILQTGICYGIKWIALSKTPSALALNQTQHCKQLEGLVVSQVQLCRSNLEL----------------MQTIIQAAREVIKTCRKTFSDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHTIARACTTGDLPGCSCGP------IPGETPGPGYRWGGCADNLNYGLIMGSKF----------------SDAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWKGLQELRDIALD--LKNKYLSATKVVHRPMGTR--KYLVPKDIDIRPVKETELIYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 353          
BLAST of wnt11-1 vs. UniProt/SwissProt
Match: sp|P49339|WNT11_CHICK (Protein Wnt-11 OS=Gallus gallus OX=9031 GN=WNT11 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.311e-40
Identity = 123/398 (30.90%), Postives = 184/398 (46.23%), Query Frame = 2
Query:  179 MRIFPDL-IGNLLMFVILINYNSGIKWLGLAKLNRS-------HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            M+  P   +   L  ++      GIKW+ L+K   S       H ++L+G   S+ +  R    L                M  ++ A++  +  C KTF+D RWNC S+E  P    DL+ GT+E A V+A S+AA+   I+R C+   L  CSCG       +        Y +  C DN++ G+     F                S+     K++ SQ  K ++ HN EVG  ++  S + KCKCHGVSGSC  K C++ L+ L D  L   +K+ YL A  V           + +   +   P+K T+L +++ S D+C  +   GS GTQ RQC   N T + ++ C  MCCGRGY   M+K   +C C+      V CK+C +   R  C
Sbjct:    1 MKPSPQFFLAAFLSLILQTGICYGIKWIALSKTPSSLALNQTQHCKQLEGLVVSQVQLCRSNLEL----------------MQTIIQAAREVIKTCRKTFSDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHTIARACTTGDLPGCSCGP------IPGETPGPGYRWGGCADNLNYGLIMGSKF----------------SDAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWKGLQELRDIALD--LKNKYLSATKVVHRPMGTR--KYLVPKDIDIRPVKETELIYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 353          
BLAST of wnt11-1 vs. UniProt/SwissProt
Match: sp|Q670P5|WNT11_XENLA (Protein Wnt-11 OS=Xenopus laevis OX=8355 GN=wnt11 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.006e-39
Identity = 123/375 (32.80%), Postives = 177/375 (47.20%), Query Frame = 2
Query:  245 GIKWLGLAK------LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            GIKWL L+K      LN++ H ++L+G   S+ +  R    L                M  ++ A+K     C+K F D RWNC S+E  P    DL+ GT+E A VHA S+AA+   I+R C+   +  CSC      A +   +    Y +  C DN++ GI     F                S+     K++ SQ  K ++ HN EVG  ++  S + KCKCHGVSGSC  K C+R L+ L +  L   +K  YL A  V           H +   +   P++ T+L +++ S DYC  +   GS GT  RQC   N T + ++ C  MCCGRGY   M+K   +C C+      V CK+C +   R  C
Sbjct:   22 GIKWLALSKTPLSLPLNQTQHCKQLEGLVSSQMQLCRSNLEL----------------MQTIIHAAKEVKKTCVKAFTDMRWNCSSIELAPTFHQDLERGTRESAFVHALSAAAISHTIARACTTGDIPGCSC------APIPGESPGPGYRWGGCADNLNYGILMGSKF----------------SDAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWRGLQELREIALD--LKTKYLSATKVVHRPMGTR--KHLVPKDIDIRPVQETELIYLQSSPDYCLKNEKIGSHGTHERQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCLCKYHWCCYVTCKKCERTVERYVC 351          
BLAST of wnt11-1 vs. UniProt/SwissProt
Match: sp|Q28J82|W11B2_XENTR (Protein Wnt-11b-2 OS=Xenopus tropicalis OX=8364 GN=wnt11b-2 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.420e-39
Identity = 118/381 (30.97%), Postives = 175/381 (45.93%), Query Frame = 2
Query:  206 NLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
             LL+ +        I+WLGL  +N S          +E E+ R +  L     + C   ++   M +V+ A+K     C  TF+D RWNC SVE  P   PDL  GT+E A V+A +SA +   I+R C+  +L  CSCG   ++           + +  C DN+  G+     F+                   K +K   +Q  K +N HN  VG  ++M+S ++KCKCHGVSGSC  K C++ L+ L        +K  YL A  V             +   L   P++ ++L ++  S DYC  +P  GS GTQ R C   +V    ++ C+ MCCGRGY    E    +C+C+      V CK+C +   R  C
Sbjct:    9 TLLLILCCSRLCGAIQWLGLT-VNGSR------VAWNESEHCRLLDGLVPEQSQLC--KRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSCGATPAEV------PGTGFRWGGCGDNLHYGLNMGSAFV---------------DAPMKSSKSGGTQATKMINLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWKGLQDLPHIANE--LKSKYLGATKVIHRQTGTR--RQLVPRELDIRPVRESELVYLVSSPDYCAKNPKLGSYGTQDRVCNKTSV---GSDSCNLMCCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVC 352          
BLAST of wnt11-1 vs. TrEMBL
Match: B0LMF9 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wnt11-1 PE=2 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 390/391 (99.74%), Postives = 391/391 (100.00%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMG+KSKDSDSKSENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL
Sbjct:    1 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMGMKSKDSDSKSENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 391          
BLAST of wnt11-1 vs. TrEMBL
Match: F8WQT0 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 GN=Djwnt11-1 PE=2 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 290/359 (80.78%), Postives = 323/359 (89.97%), Query Frame = 2
Query:  281 SHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMG-IXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCEL-VDVYIVKCKQCIQINIRKFCL 1351
            +HKQELDGFTRSECEYA+KIQVLRKRH+RFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPK+ PDL+LGTQEQAVVHAFSSAAL+FEISRRCSQNKLRHCSCGK+  D N  +NNQNYTYYY+NCLDNI++GIE T+ FLGFH+MG  KSKD++ KS+N    ++NKSQ+I+RLNGHNYEVG+MIM NSWK KCKCHGVSGSC  KIC+RQLRRLDDEELLK IKDYYL+AKHVT+ ++NKLYPT F +   Q EPLK  +LAFIEHSSDYCEPDPSAGS GTQGRQCET NVTLS+TNHCSNMCCGRGYREV+EKETVQC+CEL V  Y+VKCK C QINI+KFCL
Sbjct:    1 NHKQELDGFTRSECEYAKKIQVLRKRHYRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKISPDLRLGTQEQAVVHAFSSAALLFEISRRCSQNKLRHCSCGKENPDVNDLTNNQNYTYYYTNCLDNIEVGIEFTKTFLGFHKMGKTKSKDTEWKSDNSSLKEKNKSQMIQRLNGHNYEVGLMIMKNSWKPKCKCHGVSGSCSQKICYRQLRRLDDEELLKTIKDYYLKAKHVTIGENNKLYPTQFTSQSYQNEPLKNNELAFIEHSSDYCEPDPSAGSFGTQGRQCETKNVTLSETNHCSNMCCGRGYREVVEKETVQCKCELDVGYYVVKCKTCSQINIKKFCL 359          
BLAST of wnt11-1 vs. TrEMBL
Match: T1E100 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 2.710e-133
Identity = 213/385 (55.32%), Postives = 282/385 (73.25%), Query Frame = 2
Query:  197 LIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            ++G +++   +I  N+ I+WLGL KL R H+QE+DGFT++EC+ A+ I++LR RH++FC+H KHRFAMHAV MASKA  +YCM+TF DRRWNCKS+E LPKL  +L LGTQEQA+VHAFSSAA++FEISRRCSQ+KLRHC CG+D        ++Q+ T+Y+S+C DN+++G+E  + FLG+ +M    K++  K  N     + +   +KR+NGHNY  G+ IM  SWKSKCKCHGVSGSC N++CFRQLRRLDD+ LL  +K+ YL AK+VT E +  LY     T    K  L+ T+LAF+EHSSDYC+P+P  GS+GT  RQCE  NVT + TNHC+ MCCGRG+R  +E+ET+QC+C L   + VKCK C  I   KFCL
Sbjct:    7 MLGKIVLISFIIKNNTCIRWLGLGKLMRVHEQEMDGFTQAECDDAKSIEILRGRHYKFCVHQKHRFAMHAVYMASKAASFYCMRTFKDRRWNCKSIEDLPKLSAELTLGTQEQAIVHAFSSAAILFEISRRCSQSKLRHCPCGRDNLQNKPSGDSQSGTFYHSSCTDNVEMGMEYAKKFLGYERMKRNKKENILKQINYAKTTKERKVFLKRINGHNYAAGLEIMKRSWKSKCKCHGVSGSCTNQVCFRQLRRLDDDILLMKLKNQYLAAKYVTAERNGILY-----TDPKNKIGLEDTELAFMEHSSDYCDPEPKVGSVGTVNRQCEIKNVTTADTNHCNIMCCGRGFRNTIEQETIQCKCNLDQNFNVKCKLCTVIKENKFCL 386          
BLAST of wnt11-1 vs. TrEMBL
Match: T1E1C8 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 7.588e-101
Identity = 176/374 (47.06%), Postives = 248/374 (66.31%), Query Frame = 2
Query:  230 INYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEP--LKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            I ++  I WLG+++ NR    EL GF+  EC +      L++R  +FCL+ +H+FAMH +L ASKA VYYCMKTF DRRWNC S E+LP +  DL+LGTQEQAVVHAF+S+++++EISRRC+QNK+ HCSCG   SD      N      ++ C DN+DIGI+  + F G+H++         KS+ K  +  +++  +K++NGHNYE GI I + + ++ CKCHGVSGSC  ++C+RQLRRLDDE LL  ++  YL AK V +  +NKL+  +         P  +  TDLAFIEHS D+CEPDPS GS+GT GR+C+  NV+ + T HCSNMCCGR YR  +E++  +C C + + + + C  C  +N++ F
Sbjct:   36 IGFHESINWLGMSQYNRPESHELRGFSEVECHFISTNHGLKQRQAKFCLNRQHKFAMHGILRASKAAVYYCMKTFHDRRWNCSSTERLPNIGKDLQLGTQEQAVVHAFASSSVLYEISRRCAQNKIAHCSCGN--SDQVQSQYNSQRRLMFAGCPDNVDIGIKYVKKFTGYHKL-------GKKSKKKVKSLNDQTLKVKKINGHNYEAGIKIQLENQRTHCKCHGVSGSCAQRVCYRQLRRLDDEVLLTALRKQYLAAKFVDISSNNKLFIANPFGIQEGSPPIYIADTDLAFIEHSPDFCEPDPSVGSLGTHGRKCKIDNVSETATEHCSNMCCGREYRMSLEQKKTKCGCRIDENFKILCDDCF-LNVKNF 399          
BLAST of wnt11-1 vs. TrEMBL
Match: C3U5B2 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 9.823e-101
Identity = 177/401 (44.14%), Postives = 251/401 (62.59%), Query Frame = 2
Query:  209 LLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXX--------------XXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXX-------XXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVT-MEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            +++   L++ N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL              + GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN           ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDL F EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:   15 VIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGKKLIWFHGYIFQSGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTAN--QEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 412          
BLAST of wnt11-1 vs. Ensembl Cavefish
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:103026929])

HSP 1 Score: 137.887 bits (346), Expect = 1.217e-35
Identity = 105/333 (31.53%), Postives = 153/333 (45.95%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFI----TTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            KI  L  R    C       A+  +   ++  +  C   F   RWNC ++ +      +L++G++E A  +A ++A +   ++  CSQ  + HC C +++     G  NQ   + +  C  +I  GIE +R F+   ++                    K    + +N HN E G   +    K +CKCHGVSGSC  K C+         E+  M+KD Y +A HV +    +L    F+    T G QK PL+ TDL +IE S +YCE D   GS+GTQGR C   N T   T+ C  MCCGRGY      +  QC C+      VKC  C
Sbjct:   44 KIPGLAPRQRAICQSRPD--AIIVIGEGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQ----GYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREI--------------------KKNARRLMNLHNNEAGRKALEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYMLKDKYNKAVHVEVVRATRLRQPTFLKVKKTHGYQK-PLE-TDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 343          
BLAST of wnt11-1 vs. Ensembl Cavefish
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:103026929])

HSP 1 Score: 137.117 bits (344), Expect = 2.018e-35
Identity = 105/333 (31.53%), Postives = 153/333 (45.95%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFI----TTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            KI  L  R    C       A+  +   ++  +  C   F   RWNC ++ +      +L++G++E A  +A ++A +   ++  CSQ  + HC C +++     G  NQ   + +  C  +I  GIE +R F+   ++                    K    + +N HN E G   +    K +CKCHGVSGSC  K C+         E+  M+KD Y +A HV +    +L    F+    T G QK PL+ TDL +IE S +YCE D   GS+GTQGR C   N T   T+ C  MCCGRGY      +  QC C+      VKC  C
Sbjct:   47 KIPGLAPRQRAICQSRPD--AIIVIGEGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQ----GYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREI--------------------KKNARRLMNLHNNEAGRKALEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYMLKDKYNKAVHVEVVRATRLRQPTFLKVKKTHGYQK-PLE-TDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 346          
BLAST of wnt11-1 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 135.576 bits (340), Expect = 4.333e-35
Identity = 107/354 (30.23%), Postives = 165/354 (46.61%), Query Frame = 2
Query:  272 LNRSH-KQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRF-AMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDP-SAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            L R H +QE+ G   S C +  K+ V        C   K     M AV   ++  +  C   F +RRWNC ++E +P     +  GT+E A V+A S+A++ F ++R CS  +L  C C     D NV        + +S C DNI  G+  +++F+   + G                 + +S     +N HN E G   ++N  + +CKCHGVSGSC  K C++        ++  +IK+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ DP + G +GT GR C   N T    + C  MCCGRG+     +   +C C+      VKCKQC
Sbjct:    2 LKRCHYEQEVSGSNPSSCSFTIKLPV--------CFRCKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-----DRNV-HGVSPDGFQWSGCSDNIAYGVAFSQSFVDIRERG-----------------KGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEV---EQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 316          
BLAST of wnt11-1 vs. Ensembl Cavefish
Match: wnt11f2 (protein Wnt-11-like [Source:NCBI gene;Acc:103022398])

HSP 1 Score: 132.88 bits (333), Expect = 7.769e-34
Identity = 112/378 (29.63%), Postives = 174/378 (46.03%), Query Frame = 2
Query:  236 YNSGIKWLGLA----KLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVT---MEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            +  GI WLGLA     ++ +H Q           + + +  L     + C   ++   M +V+ A++ T   C  TF D RWNC S++  P   PDL  GT+E A V + S+A L   I+R C+   L  CSC    ++        +  + +  C DN+  G+          QMG       + S+    ++++ S  I+ ++ HN  VG   +++S +++CKCHGVSGSC  K C++    LD  ++   +K  YL A  V    M    +L P       ++  P+   +L ++  S DYC  +   GS GT  RQC   N T + ++ C  MCCGRGY    E+   +C C       V CK+C     R  C
Sbjct:   28 HGEGIYWLGLASRGIPVSWNHTQ-----------HCKLLHTLAPDQQQLC--RRNLELMGSVVQAAELTKAACQSTFKDMRWNCSSIQSAPNFSPDLAKGTRESAFVFSLSAAVLSHSIARSCASGALPSCSCAPAPAE------QASSDFRWGGCGDNVHYGM----------QMG------SAFSDATLNSRRSGSPSIRLMHLHNNAVGRQAVLDSLETRCKCHGVSGSCSVKTCWKS--LLDVGQISAQLKARYLSATKVVPRQMGSRRQLVPRE-----MEVRPVLENELVYLISSPDYCSYNTKHGSYGTTDRQC---NKTATGSSSCGLMCCGRGYNTYTEQVEERCNCRYHWCCYVTCKKCQHTVERHVC 360          
BLAST of wnt11-1 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 130.183 bits (326), Expect = 3.315e-33
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 2
Query:  398 MHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDP-SAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            M AV   ++  +  C   F +RRWNC ++E +P     +  GT+E A V+A S+A++ F ++R CS  +L  C C     D NV        + +S C DNI  G+  +++F+   + G                 + +S     +N HN E G   ++N  + +CKCHGVSGSC  K C++        ++  +IK+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ DP + G +GT GR C   N T    + C  MCCGRG+     +   +C C+      VKCKQC
Sbjct:   35 MDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-----DRNV-HGVSPDGFQWSGCSDNIAYGVAFSQSFVDIRERG-----------------KGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEV---EQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 313          
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 119.783 bits (299), Expect = 5.355e-30
Identity = 91/336 (27.08%), Postives = 144/336 (42.86%), Query Frame = 2
Query:  338 IQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSV-EXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPL----KTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQI 1330
            I  L  +  RFC +++    M +V    +  +  C   F  RRWNC ++ E      P L+  T+E + VHA SSA + F ++R C+      C C         G            C ++ D G+  +R F                       ++N+      +N HN E G + +++  + KCKCHG+SGSC  K C+    +     +   +KD Y  A  + +E   +     ++ T   K PL       DL + E S ++CEP    GS+GT GR C   N+T    + C  +CC RGY    E+   +C+C       V C++C ++
Sbjct:   48 IPGLVPKQLRFCRNYQE--LMPSVAEGVRLGIQECQHQFRGRRWNCTTMTEGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGGWKWGG------CSEDADFGVMVSREF--------------------ADARENRPDARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCW--WAQPSFRTVGDHLKDKYDSASEMLVERHRES--RGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPC---NLTSHGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECARV 348          
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 6.323e-29
Identity = 93/325 (28.62%), Postives = 137/325 (42.15%), Query Frame = 2
Query:  386 HRFAMHAVLMASKA--TVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKR--LNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            H +  H   +A  A   V  C   F  RRWNC + E          +G++E A  HA S+A +   +SR C + +L  C C +      +        + +  C DN++ G    R F+   +     +    + + ++      S    R  +N HN E G   +       CKCHGVSGSC  K C+ Q    D  ++ K +K+ Y  A         KL P +      +  P    DL +++ S DYC  + + GS+GT GR C   N T    + C  MCCGRGY         +C C+      VKCK+C  +  R  C
Sbjct:   63 HLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEGDSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPREL-----QRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQ--LADFRKVGKFLKEKYDSASAARAGRRAKLEPAN-----RKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSC---NKTSEGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKCTSVVDRFVC 372          
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.251e-18
Identity = 55/172 (31.98%), Postives = 81/172 (47.09%), Query Frame = 2
Query:  815 SQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQK---EPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            +Q+++++    +     ++    K +CKCHGVSGSC  K C+         E+   +KD Y    HV     ++     F+     +   +PL T +L F E S +YCE DP+ GS GT+GR C   N T    + C  +CCGRGY         QC C+      V+C  C
Sbjct:  149 AQLMQKVPYRRFHSTDQVLEEKMKLECKCHGVSGSCTTKTCW--TTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVKKSRSYRKPLDT-ELVFTERSPNYCEEDPATGSAGTRGRLC---NRTSPHADGCDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTC 314          
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 82.4185 bits (202), Expect = 7.994e-18
Identity = 71/297 (23.91%), Postives = 114/297 (38.38%), Query Frame = 2
Query:  521 GTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSC-----GKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFL-GFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXX--------XXKMIKDYYLRAKHVTMEDDNKLYPT-----HFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSI-GTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            G +E A +HA  SAAL   ++R CS+  +  C+C     G+   D   G            C DN+  G    R    G  + G                 ++   ++ R   HN E G+  + +  + +CKCHG+SGSC  K C+ +L                   + DY       + + D     +     H        +P    DL +++ S ++C  D +  S  GT+GR C   +  L     C  +CCGRG+     + + +C C       V C+ C ++     CL
Sbjct:    4 GCRETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGRGGPDWEWGG-----------CSDNLPFGTRFARELAAGAGERG----------------GRDARALMDR---HNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAHKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVCVRGSPGLGG---CELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHECL 267          
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 78.5666 bits (192), Expect = 1.601e-17
Identity = 47/151 (31.13%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  869 MMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            +++  + +CKCHGVSGSC  + C+R        ++  ++K+ +  A  V +           +    Q +P    DL ++  S D+C+ DP AG  GT GR+C   N T    + C  MCCGRG+     +   +C C+      VKC+QC
Sbjct:    3 VVSHMRVECKCHGVSGSCEVRTCWR--ALPPFRKIGSVLKEKFDGATEVELRKIGTR--RQLVPRNAQFKPHTDEDLVYVAPSPDFCDADPKAGVAGTAGREC---NRTSRALDGCELMCCGRGFHTTRAELVERCYCKFHWCCFVKCRQC 146          
BLAST of wnt11-1 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 124.79 bits (312), Expect = 1.870e-31
Identity = 101/378 (26.72%), Postives = 162/378 (42.86%), Query Frame = 2
Query:  209 LLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXX--XXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKL-RHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH--FITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQ 1327
            +L  +++ +     +WL LA L  S+       ++  C+     Q+L  R  + C  +     M +V   +   ++ C   F  R WNC +V+          +  GT+E A VHA SSA + + +++ CS  +L + C C +       G N          C D+ID G+     F+   + G                  + ++++  +N HN   G + +      +CKCHGVSGSC  K C+R           +++ DY         E + KL       +    + +P    DL ++  S D+CEP+P  GS+GTQGR C   N T    + C  MCCGRGY    E    QC C+      V+C+ C++
Sbjct:    8 ILTQLVMASLVYSSQWLSLA-LTGSNPNRF--LSKKNCDEIG--QLLNHRQVQVCKRNIQ--VMDSVKDGASVALFECQHQFRYRPWNCTTVQFSRSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRGQADGFNWAG-------CSDDIDFGMTFATRFVDARERG--------------SGIGSPARVL--MNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWR------ALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRIC---NRTSQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMR 346          
BLAST of wnt11-1 vs. Ensembl Nematostella
Match: EDO37901 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2])

HSP 1 Score: 117.857 bits (294), Expect = 4.830e-29
Identity = 102/379 (26.91%), Postives = 177/379 (46.70%), Query Frame = 2
Query:  212 LMFVILINYNSG---IKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDE----SDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYR--EVMEKETVQCRCELVDVYIVKCKQC 1321
            L  V+ +++ S    I+WLG+   ++        + + +C    +I     + ++ C   ++  AM  V  A + T   C   F ++RWNC ++ K P+  PDLK GT E A V+A S+AAL + I++ C   +L+ C CG +      D   G            C DNI  G+  +++F              + +   +  +++KS  +  +N HN  VG   + +  +  C+CHGVSG C  K C R+    D   +  ++K+ Y R  +V  +  +K      + +   +    ++DL  ++ S +YC  +   G+ GT GR C+           C+ +CCGRG+R  EV+ +E  +C C+ +    VKC+ C
Sbjct:    7 LFVVLCLSFWSPVVTIRWLGIRHTSQ------HTWDKKDCN---RIHGFSGKQYKIC--RRNLPAMLYVTAAVEMTREECQHQFQNKRWNCSTIVKAPQFLPDLKRGTPEAAFVYALSAAALTYSITQACGMKRLKPCKCGTNPKFKHPDGEWG-----------GCHDNIARGMRFSKDF--------------TDAVEAQRMRKHKSMAVALMNLHNNGVGRKAVHSRLEFHCRCHGVSGGCTAKTCIRR--LGDFRLVADLLKNRYARIVYVESKTKSK-RKARVLKSKRGRRRYTSSDLVALQGSPNYCHKNRKRGTAGTHGRLCDPTK--RRGEGSCAYLCCGRGHRTEEVVHEE--RCECKYIWCCYVKCQTC 342          
BLAST of wnt11-1 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 117.087 bits (292), Expect = 1.015e-28
Identity = 85/309 (27.51%), Postives = 139/309 (44.98%), Query Frame = 2
Query:  398 MHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXX-XXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            M ++   +K  V  C   F D+RWNC +V     +    ++  ++E A V+A SSA +V E++R CS  +L+ CSC   +  +  G            C DNI  G+   + F+   ++                    +      +N HN  VG  ++  +    CKCHGVSGSC  + C++         + + +++ Y  A  VT+           ++    K+P +  DL ++E S +YC  D + GS+GT GR+C         T  CS +CCGRG+  +  +E  +C C+      VKC+ C
Sbjct:   63 MVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKGFEWGG-------CSDNIQYGLNFAKAFVDSREV--------------------EKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKS--ISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVS---YKKPSR-DDLVYLEDSPNYCMVDSNTGSLGTSGRECN--GSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTC 336          
BLAST of wnt11-1 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 115.546 bits (288), Expect = 3.484e-28
Identity = 91/358 (25.42%), Postives = 145/358 (40.50%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLY-------------------PTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            +I+ L ++  R  +  ++   +  +   ++  ++ C   F +R+WNC +          LK   +E A  +A ++A +   I+R C + KL  CSC  D+    V      +      C DNI      ++ F+   + G                         ++N HN E G   + N+   +CKCHG+S +C  K C+            K + D+ L    +  + DN                      P  FI +          DL + EHS ++CE +PSAGS+GTQGR+C   N T   T+ C  MCCGRG+    ++    C C       VKC++C    I   CL
Sbjct:   49 QIRALTQKQIR--ISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSPENVFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSC--DQRYRGVSKQGWQWGG----CSDNIHFADNFSKRFVDAQEKG--------------------RDFRAQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCW------------KRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGREC---NTTSMGTDGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNCL 363          
BLAST of wnt11-1 vs. Ensembl Nematostella
Match: EDO37387 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2])

HSP 1 Score: 110.538 bits (275), Expect = 1.533e-26
Identity = 97/337 (28.78%), Postives = 142/337 (42.14%), Query Frame = 2
Query:  347 LRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXX---XXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            L K   + C       A  + L   +  ++ C+  F  RRWNC S+E     P   P L  G +E A VHA  SA +   ++R CS  KL  C C  DES    G+  +        C DNID GIE++  FL   + G                      +   +N HN  VG   +  + K+KCKCHG+ GSC  K C++ +  + +     M K  Y  A  + M   N     H      ++  +    L + E S +YC  +   G  GT+GR C   ++    T++C N+CC RGY     + T +CRC       + C  C + +    C
Sbjct:   49 LSKEQLKMCRRLPDVVA--SALQGMQYAIHECLAQFRYRRWNCSSLEMKNRNPLANPLLSRGFRETAFVHAILSAGMTSSVARACSMGKLAKCGC--DESLRGRGTGWEWGG-----CGDNIDYGIETSAKFLDSREKG--------------------RDLHSMMNMHNNMVGRTTLSENAKTKCKCHGMCGSCSVKTCWKTVPDIREIGDRLMEK--YDHATTIGM--GNGRLRLHLTRRKARRSSVGRA-LVYYEDSPNYCIENKELGIFGTRGRICSPESL---DTDNCQNLCCERGYTTKKLQVTKRCRCHFSWCCYLICDTCRETSTVSIC 348          
BLAST of wnt11-1 vs. Ensembl Medaka
Match: wnt11 (Wnt family member 11 [Source:NCBI gene;Acc:101155217])

HSP 1 Score: 146.747 bits (369), Expect = 8.657e-39
Identity = 119/392 (30.36%), Postives = 178/392 (45.41%), Query Frame = 2
Query:  206 NLLMFVILINYNSGIKWLGLAK----LNRS-HKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXX---XGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAK---HVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
             +L  ++L    SGIKWL L++    +N++ H + L G   S+ +  R    L                M  ++ A++     C KTFAD RWNC S+E              GT+E A V+A S+A +   I+R C+   LR C+CG       + +      Y +  C DN+  G+ +   F                S+     K++ S   K ++ HN EVG  ++  S   KCKCHGVSGSC  + C+R L+ L +  +   +K  YL A    H  M    +L P       +   P++  +L +++ S D+C  +   GS+GTQ RQC   N T   ++ C  MCCGRGY    EK   +C C+      V CK+C +I  R  C
Sbjct:   11 GVLTALLLSQVCSGIKWLTLSQTTSHINQTQHCKRLSGLVSSQVQLCRSNLEL----------------MQTIVQAAREVKKTCQKTFADMRWNCSSIEIAADGQKYPPDLDRGTREAAFVYALSAATISHTIARACTSGDLRLCTCGP------IPAEIPEPGYRWGGCADNLHYGLMTGSKF----------------SDAPMKMKRSGSHANKLMHLHNSEVGRQVLRESMVMKCKCHGVSGSCSIRTCWRGLQDLREIAMD--LKTKYLSATKVIHRPMGTRKQLVPKD-----IDIRPVRENELVYLQSSPDFCSKNEKLGSVGTQDRQC---NKTSVGSDSCDLMCCGRGYNPYTEKLVERCHCKYHWCCYVTCKKCERIVERYVC 354          
BLAST of wnt11-1 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 140.969 bits (354), Expect = 9.872e-37
Identity = 117/377 (31.03%), Postives = 186/377 (49.34%), Query Frame = 2
Query:  209 LLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDP-SAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETV-QCRCELVDVYIVKCKQCIQI 1330
            L++   L++ N+   WL LAKL+        G  R E E   +++ L +R  + C   +    M AV   ++  +  C   F +RRWNC ++E LP     +  GT+E A V+A S+A++ F ++R CS  +L  C C     D NV        + +S C DNI  G+  +++F+   +              +    Q+ SQ +  +N HN E G   ++++ + +CKCHGVSGSC  K C++        ++  +IK+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ DP + G +GT GRQC   N T    + C  MCCGRG+ +  E E V +C C+      VKCKQC +I
Sbjct:   11 LMLCCALLSANAS-NWLYLAKLSSV------GSIRDE-ETCERLRGLIQRQVQIC--KRSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLETLPVFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-----DHNV-HGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRE--------------RSKGGQSSSQAL--MNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEV---EQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQC---NRTSKAIDGCELMCCGRGF-QTQEVEVVDRCSCKFHWCCYVKCKQCRKI 346          
BLAST of wnt11-1 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 135.961 bits (341), Expect = 5.759e-35
Identity = 113/368 (30.71%), Postives = 179/368 (48.64%), Query Frame = 2
Query:  257 LGLAKLNRSH-------KQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTH-FITTGLQKEPLKTTDLAFIEHSSDYCEPDP-SAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETV-QCRCELVDVYIVKCKQCIQI 1330
            L ++K+NR +       K    G  R E E   +++ L +R  + C        M AV   ++  +  C   F +RRWNC ++E LP     +  GT+E A V+A S+A++ F ++R CS  +L  C C     D NV        + +S C DNI  G+  +++F+   +              +    Q+ SQ +  +N HN E G   ++++ + +CKCHGVSGSC  K C++        ++  +IK+ +  A  V   +  K+  T   +    Q +P    DL +++ S D+C+ DP + G +GT GRQC   N T    + C  MCCGRG+ +  E E V +C C+      VKCKQC +I
Sbjct:   15 LAMSKMNRFYIFFRYLAKLSSVGSIRDE-ETCERLRGLIQRQVQICKRSVE--VMDAVRRGAQLAIDECQFQFRNRRWNCSTLETLPVFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-----DHNV-HGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRE--------------RSKGGQSSSQAL--MNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEV---EQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQC---NRTSKAIDGCELMCCGRGF-QTQEVEVVDRCSCKFHWCCYVKCKQCRKI 348          
BLAST of wnt11-1 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 134.806 bits (338), Expect = 1.316e-34
Identity = 103/332 (31.02%), Postives = 154/332 (46.39%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKL-YPTHFITTGLQ--KEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            KI  L  R    C       A+  V   ++  +  C   F   RWNC ++ +      +L++G++E A  +A ++A +   I+  CSQ  L  C C +++     G  NQ   + +  C  +I  GIE +R F+   ++                    K    + +N HN E G  ++    K +CKCHGVSGSC  K C+         E+  ++K+ Y  A HV +   ++L  PTH      Q  ++P++ TDL +IE S +YCE D + GS+GTQGR C   N T   T+ C  MCCGRGY      +  QC C+      VKC  C
Sbjct:   44 KIPGLAPRQRAICQSRPD--AIIVVGEGAQMGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQ----GYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREI--------------------KKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYILKEKYNEAVHVEVVRASRLRQPTHLKVKQTQGYRKPME-TDLVYIERSPNYCEEDAATGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 343          
BLAST of wnt11-1 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 134.806 bits (338), Expect = 1.327e-34
Identity = 103/332 (31.02%), Postives = 154/332 (46.39%), Query Frame = 2
Query:  335 KIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKL-YPTHFITTGLQ--KEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQC 1321
            KI  L  R    C       A+  V   ++  +  C   F   RWNC ++ +      +L++G++E A  +A ++A +   I+  CSQ  L  C C +++     G  NQ   + +  C  +I  GIE +R F+   ++                    K    + +N HN E G  ++    K +CKCHGVSGSC  K C+         E+  ++K+ Y  A HV +   ++L  PTH      Q  ++P++ TDL +IE S +YCE D + GS+GTQGR C   N T   T+ C  MCCGRGY      +  QC C+      VKC  C
Sbjct:   40 KIPGLAPRQRAICQSRPD--AIIVVGEGAQMGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQ----GYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREI--------------------KKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYILKEKYNEAVHVEVVRASRLRQPTHLKVKQTQGYRKPME-TDLVYIERSPNYCEEDAATGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 339          
BLAST of wnt11-1 vs. Planmine SMEST
Match: SMESG000005930.1 (SMESG000005930.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 390/391 (99.74%), Postives = 391/391 (100.00%), Query Frame = 2
Query:  179 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 1351
            MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMG+KSKDSDSKSENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL
Sbjct:    1 MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMGMKSKDSDSKSENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL 391          
BLAST of wnt11-1 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 331.257 bits (848), Expect = 2.422e-108
Identity = 177/387 (45.74%), Postives = 251/387 (64.86%), Query Frame = 2
Query:  209 LLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXX-------XXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVT-MEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            +++   L++ N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL+ GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN           ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDL F EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:   15 VIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTAN--QEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 398          
BLAST of wnt11-1 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 331.257 bits (848), Expect = 2.958e-108
Identity = 177/387 (45.74%), Postives = 251/387 (64.86%), Query Frame = 2
Query:  209 LLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXX-------XXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHV-TMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            +++   L++ N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL+ GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN           ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDL F EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:   25 VIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTAN--QEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 408          
BLAST of wnt11-1 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.237e-107
Identity = 176/380 (46.32%), Postives = 247/380 (65.00%), Query Frame = 2
Query:  230 INYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFLGFHQMGIXXXXXXXXX-------XXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVT-MEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 1345
            ++ N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL+ GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN           ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDL F EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:    1 MDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTAN--QEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 377          
BLAST of wnt11-1 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 105.531 bits (262), Expect = 1.851e-24
Identity = 101/404 (25.00%), Postives = 181/404 (44.80%), Query Frame = 2
Query:  197 LIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNC---------------KSVEXXXXXXXXXXXGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGXXXXXXXXXXXXCLDNIDIGIESTRNFL-GFHQMGIXXXXXXXXXXXXXXXXQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQXXXXXXXXXXKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSK--TNHCSNMCCGRGY--REVMEKETVQCRCELVDVYIVKCKQCIQINIRKFC 1348
            L+ +++   + +N   G+ +  L KL  S K +L+  T   C    K+Q         CL  +H   + +V+      +  C   F +  WNC               K   +   L   +  G  E A + + +SAA+  ++S+ CS  + ++C C +   +           + ++ C DN+  G   ++ FL   H+  I                  ++  +  +N HN   G  I++++   KCKCHGVSGSC  K C+R     D  ++  ++K+ + +A  V M +D KL P H   + + +      DL +++ S ++C  +PS GS+GTQGR C    V   +     C+++CC RG+  ++ + KE  +C+C+ V    V+C+ C  + +   C
Sbjct:   11 LVIDIISIKVYVNSGRGM-FFTLMKLQESTKFDLNN-TNIFCNQLMKLQR------SICL--RHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYET------PEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKI-----------------KRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYR--ALPDLRKVGDILKEKFSKAILVRM-NDFKLVPMHSGESRITEH-----DLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKE--KCQCKFVWCCTVQCQTCEILKVESRC 371          
The following BLAST results are available for this feature:
BLAST of wnt11-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT41.346e-3427.47Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT113.752e-3430.90Wnt family member 11 [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A1.490e-3129.47Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A1.490e-3129.47Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A1.527e-3129.47Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-14.776e-3327.10pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
cwn-24.817e-3229.34pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-206.342e-2526.15Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-27.036e-2324.02pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-27.036e-2324.02pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt62.119e-2328.05gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt62.119e-2328.05gene:FBgn0031902 transcript:FBtr0303251[more]
Wnt21.123e-1926.40gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt21.435e-1925.79gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt43.862e-1725.79gene:FBgn0010453 transcript:FBtr0334799[more]
back to top
BLAST of wnt11-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt11f24.941e-3730.26wnt 11, family member 2 [Source:NCBI gene;Acc:7915... [more]
wnt11f24.941e-3730.26wnt 11, family member 2 [Source:NCBI gene;Acc:7915... [more]
wnt119.988e-3731.96wingless-type MMTV integration site family, member... [more]
wnt41.218e-3630.08wingless-type MMTV integration site family, member... [more]
wnt7bb8.395e-3429.91wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbdl13.477e-4232.75rhomboid, veinlet-like 1 [Source:Xenbase;Acc:XB-GE... [more]
wnt11b-22.680e-4030.97wingless-type MMTV integration site family, member... [more]
wnt41.022e-3527.70Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt41.670e-3227.84Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt31.792e-3128.66Wnt family member 3 [Source:NCBI gene;Acc:10012519... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt111.571e-3730.15wingless-type MMTV integration site family, member... [more]
Wnt111.571e-3730.15wingless-type MMTV integration site family, member... [more]
Wnt41.636e-3427.47wingless-type MMTV integration site family, member... [more]
Wnt24.475e-3230.17wingless-type MMTV integration site family, member... [more]
Wnt5a8.264e-3229.47wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wnt11-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2GUT4|WNT11_XENTR1.842e-4132.75Protein Wnt-11 OS=Xenopus tropicalis OX=8364 GN=wn... [more]
sp|P51891|WNT11_COTJA4.281e-4131.41Protein Wnt-11 OS=Coturnix japonica OX=93934 GN=WN... [more]
sp|P49339|WNT11_CHICK1.311e-4030.90Protein Wnt-11 OS=Gallus gallus OX=9031 GN=WNT11 P... [more]
sp|Q670P5|WNT11_XENLA1.006e-3932.80Protein Wnt-11 OS=Xenopus laevis OX=8355 GN=wnt11 ... [more]
sp|Q28J82|W11B2_XENTR1.420e-3930.97Protein Wnt-11b-2 OS=Xenopus tropicalis OX=8364 GN... [more]
back to top
BLAST of wnt11-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMF90.000e+099.74Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
F8WQT00.000e+080.78Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
T1E1002.710e-13355.32Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
T1E1C87.588e-10147.06Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
C3U5B29.823e-10144.14Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt7bb1.217e-3531.53protein Wnt-7b [Source:NCBI gene;Acc:103026929][more]
wnt7bb2.018e-3531.53protein Wnt-7b [Source:NCBI gene;Acc:103026929][more]
wnt44.333e-3530.23wingless-type MMTV integration site family, member... [more]
wnt11f27.769e-3429.63protein Wnt-11-like [Source:NCBI gene;Acc:10302239... [more]
wnt43.315e-3330.65wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt35.355e-3027.08wingless-type MMTV integration site family, member... [more]
ENSPMAT00000010914.16.323e-2928.62pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
ENSPMAT00000001922.11.251e-1831.98pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt17.994e-1823.91wingless-type MMTV integration site family, member... [more]
wnt41.601e-1731.13wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wnt11-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of wnt11-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310001.870e-3126.72Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
EDO379014.830e-2926.91Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2][more]
WNT21.015e-2827.51Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO494313.484e-2825.42Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
EDO373871.533e-2628.78Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2][more]
back to top
BLAST of wnt11-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt118.657e-3930.36Wnt family member 11 [Source:NCBI gene;Acc:1011552... [more]
wnt49.872e-3731.03Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt45.759e-3530.71Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt7bb1.316e-3431.02protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt7bb1.327e-3431.02protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
back to top
BLAST of wnt11-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005930.10.000e+099.74SMESG000005930.1[more]
SMESG000074928.12.422e-10845.74SMESG000074928.1[more]
SMESG000074928.12.958e-10845.74SMESG000074928.1[more]
SMESG000074928.11.237e-10746.32SMESG000074928.1[more]
SMESG000067888.11.851e-2425.00SMESG000067888.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007710
GenBankABY85210.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007710 ID=SMED30007710|Name=wnt11-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1744bp
TTTCCAATAAAAGAAATATAAAATTTTATCGAACCGATATATATTTTTTT
GCCTTTTTTAATTTTTTTTTGGTTACATGGTTTTCAATTTTTACCATTTT
GGTTTCCAATAGACAGACAGAGAGAGAGAAAAAAAATAAAGAAGAAAAGA
AAAATAAAAAAACAGAAAATAAAACAGAATGAGAATTTTTCCCGATTTGA
TTGGAAACCTTTTGATGTTTGTTATTCTTATCAATTACAATTCAGGAATC
AAATGGCTGGGTCTTGCCAAATTAAACCGAAGCCACAAACAGGAATTGGA
TGGATTTACGAGATCTGAATGTGAATACGCAAGGAAAATTCAAGTTCTTC
GAAAAAGGCATTTTAGGTTTTGTTTGCATCATAAACATCGGTTTGCTATG
CATGCCGTTTTGATGGCTTCAAAGGCCACGGTTTATTATTGTATGAAAAC
CTTTGCTGACAGGAGATGGAATTGTAAATCTGTGGAAAAATTACCGAAAC
TACCTCCTGATTTGAAGTTGGGAACTCAAGAGCAGGCCGTTGTTCATGCT
TTTAGTAGCGCTGCGTTGGTGTTTGAAATTTCTAGAAGATGTTCACAAAA
CAAATTGAGACATTGCTCTTGTGGAAAAGATGAGTCAGATGCGAATGTTG
GATCAAACAATCAAAATTATACATATTATTATAGCAATTGTCTTGATAAC
ATTGATATTGGAATAGAGTCCACGAGAAACTTCTTGGGATTCCATCAAAT
GGGAATAAAATCCAAAGACTCTGATTCAAAATCTGAGAATAAAAAACCAA
ATAAACAAAACAAAAGTCAAATCATAAAGAGATTAAATGGACACAATTAT
GAAGTCGGAATTATGATAATGATGAATAGTTGGAAATCTAAATGCAAATG
CCATGGAGTTAGTGGAAGCTGTATAAATAAAATTTGTTTCAGACAACTTC
GACGACTTGATGACGAGGAACTATTGAAAATGATTAAAGATTATTATTTG
AGAGCAAAACATGTGACAATGGAAGATGATAACAAATTATATCCTACTCA
CTTTATTACCACAGGCCTTCAAAAGGAACCTCTTAAAACTACAGATTTAG
CATTTATTGAACATTCTTCAGATTATTGTGAACCTGATCCATCTGCCGGC
TCTATTGGTACACAAGGAAGACAGTGTGAAACGGTCAATGTCACTTTGTC
GAAAACCAATCACTGCAGTAACATGTGCTGCGGTAGGGGGTACCGTGAAG
TAATGGAAAAGGAGACCGTTCAGTGTAGATGTGAACTTGTTGATGTATAT
ATTGTCAAATGCAAACAGTGTATTCAAATTAATATTAGAAAATTTTGTTT
GTAAAAGTAATTTTCTACATCAAGTTGTCAACTCAATCTGATCTGAACTG
GAATTCTTAAAACATATTTCTGGAAAATATATGTAAATATATTCGAAATG
ATAAATTTTTAAGTGTTCATTCAACCATTTCATTTACTGGCTCATGACTA
ATGTCAGAAACTCTAAAAATTGTGTATGGCCATTTTAAAAAAATATCAGA
TTTCATTCGTGACAGTGCGGATTGATTTTGGTTTTTTTTTGTGAAAATAA
AAATTTTCATATTCTGATTAATGACATTTTTCCACTAAAAATTTCTATGA
TTATTATGTTATAAAAGGTTATAAAGTTTTTTATAAATTTGACGTTTTTT
TATTATTAAAACAAAATATATTTAATTAATTTTTTGTTGATGCG
back to top

protein sequence of SMED30007710-orf-1

>SMED30007710-orf-1 ID=SMED30007710-orf-1|Name=SMED30007710-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MRIFPDLIGNLLMFVILINYNSGIKWLGLAKLNRSHKQELDGFTRSECEY
ARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCK
SVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGK
DESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMGIKSKDSDS
KSENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCIN
KICFRQLRRLDDEELLKMIKDYYLRAKHVTMEDDNKLYPTHFITTGLQKE
PLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMC
CGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKFCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000062esophagus
PLANA:0000072mouth
PLANA:0000081pharynx pouch
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000421tail
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
IPR007087Znf_C2H2
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 166..178
score: 31.02
coord: 240..254
score: 68.03
coord: 117..131
score: 40.38
coord: 306..317
score: 47.61
coord: 136..149
score: 38.82
IPR005817WntSMARTSM00097wnt1_3coord: 53..391
e-value: 4.4E-37
score: 139.2
IPR005817WntPFAMPF00110wntcoord: 54..390
e-value: 4.5E-65
score: 220.3
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 63..390
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 328..391
e-value: 1.2E-5
score: 27.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..210
NoneNo IPR availablePANTHERPTHR12027:SF102PROTEIN WNT-4coord: 63..390
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 239..248