Actin

Overview
NameActin
Smed IDSMED30007704
Length (bp)1528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin (SMED30007704) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin (SMED30007704) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin (SMED30007704) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin (SMED30007704) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007704

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007704SMESG000030853.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30007704SMESG000030853.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30007704SMESG000030853.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007704SMESG000036432.1 Contig450GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30007704SMESG000036432.1 Contig450GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007704SMESG000051672.1 SMESG000051670.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30007704SMESG000051672.1 SMESG000051670.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30007704SMESG000051672.1 SMESG000051670.1 Contig1138GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007704SMESG000051672.1 SMESG000051670.1 Contig450GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30007704SMESG000051672.1 SMESG000051670.1 Contig450GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v4_3_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 SMESG000003228.1 Contig22470newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 SMESG000003228.1 Contig22470uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 Contig41231newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 Contig41231uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 Contig26446newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007704SMESG000051672.1 SMESG000051670.1 Contig26446uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30007704SMESG000051672.1 SMESG000051670.1 dd_Smed_v6_3_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 356/376 (94.68%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D+DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLG+ES GIHET+YNSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 356/376 (94.68%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D+DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLG+ES GIHET+YNSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 356/376 (94.68%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D+DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLG+ES GIHET+YNSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 354/376 (94.15%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLG+ES GIHET+YNSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 353/376 (93.88%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLG+ES GIHET+YNSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100663)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 369/376 (98.14%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 348/386 (90.16%), Postives = 365/386 (94.56%), Query Frame = 1
Query:  190 RSLTKLFSNMSDE-DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            RS T+L   M DE D  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:   12 RSETELQYKMCDEEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 397          
BLAST of Actin vs. Ensembl Xenopus
Match: rspry1 (ring finger and SPRY domain containing 1 [Source:Xenbase;Acc:XB-GENE-1002344])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 343/374 (91.71%), Postives = 359/374 (95.99%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE+  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 342/374 (91.44%), Postives = 359/374 (95.99%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +ED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    7 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 380          
BLAST of Actin vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Acta2 (actin, alpha 2, smooth muscle, aorta [Source:MGI Symbol;Acc:MGI:87909])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 343/374 (91.71%), Postives = 360/374 (96.26%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +ED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 EEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Mouse
Match: Actc1 (actin, alpha, cardiac muscle 1 [Source:MGI Symbol;Acc:MGI:87905])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 343/374 (91.71%), Postives = 359/374 (95.99%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE+  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|Q964E0|ACTC_BIOTE (Actin, cytoplasmic OS=Biomphalaria tenagophila OX=112528 PE=3 SV=1)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 359/376 (95.48%), Postives = 370/376 (98.40%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TAS SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|Q964E1|ACTC_BIOOB (Actin, cytoplasmic OS=Biomphalaria obstructa OX=153466 PE=3 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 359/376 (95.48%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTATSSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|P12716|ACTC_PISOC (Actin, cytoplasmic OS=Pisaster ochraceus OX=7612 PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 358/376 (95.21%), Postives = 370/376 (98.40%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKE+++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVFDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEVTALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|Q964E3|ACTC_BIOAL (Actin, cytoplasmic OS=Biomphalaria alexandrina OX=50959 PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 358/376 (95.21%), Postives = 370/376 (98.40%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TAS SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+E+ GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|Q964D9|ACTC_PLATR (Actin, cytoplasmic OS=Planorbella trivolvis OX=283763 PE=3 SV=1)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 358/376 (95.21%), Postives = 370/376 (98.40%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TAS SSSLEKSYELPDGQVITIGNERFRCPEA++QPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVIDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMYQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A0C5GED0 (Beta-actin OS=Polycelis sp. ZD-2015 OX=1615610 PE=2 SV=1)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 372/376 (98.94%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MS+EDVAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFD EM TASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYN IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+SLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MSEEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFDQEMHTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNGIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A5J4NKW1 (Actin beta/gamma 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0004141 PE=3 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 367/376 (97.61%), Postives = 372/376 (98.94%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MSDEDVAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+SLAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: K7X7R0 (Beta-actin OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DE+V ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAER IVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHET YNSIMKCDVDIRKDLY+N VLSGGSTMYPGIADRMQKEIS+LAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MGDEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAERGIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETPYNSIMKCDVDIRKDLYSNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A4S2LD35 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008170 PE=3 SV=1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI++LAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A419PSP4 (Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10905s PE=3 SV=1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M DEDVAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI++LAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 354/372 (95.16%), Postives = 366/372 (98.39%), Query Frame = 1
Query:  229 DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            ++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+SLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    6 EIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Cavefish
Match: acta2 (actin alpha 2, smooth muscle [Source:NCBI gene;Acc:103040556])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 343/374 (91.71%), Postives = 360/374 (96.26%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            DE+  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEESTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Cavefish
Match: zgc:86709 (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103031734])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 342/374 (91.44%), Postives = 359/374 (95.99%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D++  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+G+ES GIHETTYNSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 353/376 (93.88%), Postives = 370/376 (98.40%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M+++++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 351/376 (93.35%), Postives = 368/376 (97.87%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M+++++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG P HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 462.996 bits (1190), Expect = 9.932e-162
Identity = 211/381 (55.38%), Postives = 286/381 (75.07%), Query Frame = 1
Query:  229 DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---------GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D  A+V+DNGSG+CKAGFAG++APR   PS+VGRPR +  M+         G G    Y+G +A  +RG+L+L+YP+E GIVT WDDME++W H +  EL   P++ PVLLTEAPLNP  NRE+  Q++FE F APA+++A+QAVLSLYASG  TG+ +  GDGVTH VP++EGY LP A+LR D+AGRD+TD L +IL ERG++F ++AE EIV DIKE++CY+A D++ E+R       L   Y+LPDGQVIT+ ++RFR PE LF P+ +GL++ GIH+  + S+ + D+D+RK LY+N +LSGGS+++PG+ +R+ +E++ LAP    ++I APPERKYSVWIGGSILASLSTFQQMWI+  EY E GP +VHR+C 
Sbjct:    6 DNPAVVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKELR--RKPEELAVDYKLPDGQVITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAPVRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVVHRRCL 384          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008200.1 (pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 gene:ENSPMAG00000007412.1 transcript:ENSPMAT00000008200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.891 bits (616), Expect = 5.829e-77
Identity = 129/289 (44.64%), Postives = 182/289 (62.98%), Query Frame = 1
Query:  265 MCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYA-SGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-TERGYSF------TTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLE-KSY--ELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIR 1089
              K G+AG + P  +FP++VGRP  R    +  +  KD  VGD+A   R +L + YP+E+GIV NWDDM+ +W +TF  ++L V   E  +LLTE P+NP  NREK+ ++MFE +   A+Y+AIQAVL+LYA +G  TG+V+DSGDGVTH  P+YEG++LPH   RLD+AGRD+T YL+K+L     Y F       T+AE E V               + +R A   + +  +S+  +LPDG++I +G ERF  PEALFQP  + +ESVG+ E  +N+I   D+D R
Sbjct:    1 FVKCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDLMVGDDASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPDKLNVNTRECKILLTEPPMNPMKNREKIIEVMFEQYGFSAVYIAIQAVLTLYAQAGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVLWLNHSYFFIPVLFRCTSAEWESVN-------------VSSLRRAKLFTIVRVRSFLPQLPDGRIIKVGGERFEAPEALFQPHLIDVESVGVAELLFNTIQAADIDTR 276          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.343 bits (599), Expect = 1.513e-72
Identity = 149/414 (35.99%), Postives = 216/414 (52.17%), Query Frame = 1
Query:  238 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALD-------FDAE----MRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLE-SVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIS----------------SLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 1344
            A  +D  +   K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IKE+  YI  D       FDA+    M+  +  +++ K         I +G ERF  PE  F P F   + +  I E   N I  C +D+R+ LY N VLSGGSTM+     R+Q+++                  + P  + ++++    ++Y+VW GGS+LAS   F Q+  +K++Y+E GP I  H   F
Sbjct:    4 ACTLDKKNRYTKIGYAGNTEPQFIIPSCISIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIEKPNYST-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKK-----EFTIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVF 411          
BLAST of Actin vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 326/374 (87.17%), Postives = 357/374 (95.45%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D +VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG+MVGMGQKDSYVGDEAQSKRGILTL+YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPK+NREKMTQIMFETFN PA YV+IQAVLSLY+SGRTTGIVLDSGDGVTH VPIY G++LPHAILR+DLAGRDLTDYLMKIL+ERGYSF+TTAEREIVRDIKEKLCY+ALDF+ EM+TA+ SSS+EKSYELPDGQVITIGNERFR PEALF PS LGLES GI +TTYNSIMKCDVD+RK+LY N V+SGG+TM+PGIA+RMQKEI++LAP +MK+KI+APPERKYSVWIGGSILASL+TFQQMWISKQEYDESGP IVH KCF
Sbjct:    2 DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375          
BLAST of Actin vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 366.696 bits (940), Expect = 3.863e-124
Identity = 178/376 (47.34%), Postives = 250/376 (66.49%), Query Frame = 1
Query:  241 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSL-------APPT----MKIKIVAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGP 1320
            +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE P+NP  NREKM ++MFE ++   +YVAIQAVL+LYA G ++G+V+DSGDGVTH VP+YE   L H   RLD+AGRD+T +L+ +L+ RGY+F  TA+ E VR IKEKLCY++ D D + + A  +++L +SYELPDG+ I +G ERF  PE LFQP  + +E  G+ E  +N++   DVDIR  LY   VLSGGS+MYPG+  R++KE+  L         P+     K++I  PP RK+ V+IGG++LAS ++    MW+SKQE+ ESGP
Sbjct:    7 IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGP 382          
BLAST of Actin vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 361.303 bits (926), Expect = 4.119e-122
Identity = 170/360 (47.22%), Postives = 250/360 (69.44%), Query Frame = 1
Query:  241 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYL-MKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEM-RTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 1311
            +V+DNGSG+ KAGF+G++ P+A+   +VG  ++  VM+   Q D+++G+ AQ  RG+L L+YPI+HG+V +WD ME IW +     L++    EHP+L+TEAP+NP  NRE+M Q++FETF+  A+YV+  AVLSLYASGRTTG V+D G+G   TVPIY+G+ALP +++R+D+ G D+T+ L  ++    G S  +++EREIVR +KEK+CY+A +   E  +    +  L  +++LPDG+ I +GN+R+R PE LF P  +GL   G+ +    SI K D+D+RK L ++ +LSGG+T   G  DRM  ++ +L   T KIKI+AP ERKY+ WIGGSIL  LSTFQ++W  K ++ E
Sbjct:   15 VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 238.039 bits (606), Expect = 1.643e-73
Identity = 157/447 (35.12%), Postives = 234/447 (52.35%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFP--------------SIVGRP-----------------RHQGVMVGM------GQK-----DSYVGDEA--QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT--TAEREIVRDIKEKLCYIALDFDAEMRTASASSS-----LEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYN-SIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLA--------------PPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHR 1335
            MS  +  A+V+DNG+G+ K GFAG+D+P  VFP              S VG P                    G   G+      G++     D Y+G+EA   S+    +L YPI HG V NWD ME+ W ++ +  LR  PE+H  LLTE PLNP  NRE++ +I FE+FN   +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +  AI  + +AGRD+T ++  +L ERG + T+  TAE+     IK++ CY+  D   E        S     + ++ E    +V+ IG ERF  PE  F P     + +    T  + +I  C +D+RK LY N VLSGGSTM+     R+Q+++ S+                  + + +++  +++ +VW GGS+LA  + F+    +K++Y+E GP IV  
Sbjct:    1 MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRN 442          
BLAST of Actin vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 102.064 bits (253), Expect = 1.104e-23
Identity = 78/289 (26.99%), Postives = 122/289 (42.21%), Query Frame = 1
Query:  226 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-----------TERGYSFTTTA--------------EREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNE-RFRCPEALFQP 1011
            ++V+A+V+D GS     G++G D P+++ PS+ G+          G K  +        R    LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +AG+ +   + K L            +R   F                   R   ++ KE LC+I      E      SS+ ++S E P  + I   NE R+   E LF P
Sbjct:   12 DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295          

HSP 2 Score: 95.5153 bits (236), Expect = 1.537e-21
Identity = 48/118 (40.68%), Postives = 74/118 (62.71%), Query Frame = 1
Query:  973 NERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 1317
            NE  + P    +P     E +G+ +  Y+SIM  DVD+R  L  N VL+GG++  PG++DR+  E++ +  P++K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct:  363 NETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-PSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 360/376 (95.74%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M D+DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIS+LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 357/374 (95.45%), Postives = 370/374 (98.93%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+DVAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+SLAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 357/374 (95.45%), Postives = 371/374 (99.20%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TA++SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+SLAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 357/374 (95.45%), Postives = 369/374 (98.66%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            ++DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL Y+ALDF+ EM TA+ASSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIS+LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 352/376 (93.62%), Postives = 371/376 (98.67%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M+D+D+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TA++SSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTV+SGG+TMYPG+ADRMQKEIS+LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 376          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 371/374 (99.20%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            ++DV+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM+TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAPPTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 369/374 (98.66%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    4 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 369/374 (98.66%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            D+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   37 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 410          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 1
Query:  223 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            +E++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000051672.1 (SMESG000051672.1)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 376/376 (100.00%), Postives = 376/376 (100.00%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000051670.1 (SMESG000051670.1)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 376/376 (100.00%), Postives = 376/376 (100.00%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000066020.1 (SMESG000066020.1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 363/376 (96.54%), Postives = 372/376 (98.94%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            M+DEDV+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+SLAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 360/376 (95.74%), Postives = 372/376 (98.94%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MSDED++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI+SLAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000057992.1 (SMESG000057992.1)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 360/376 (95.74%), Postives = 372/376 (98.94%), Query Frame = 1
Query:  217 MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1344
            MSDED++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDF+ EM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLG+ES GIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI+SLAP TMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of Actin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTB0.000e+094.92actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB0.000e+094.92actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTG10.000e+094.39actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+094.39actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+094.39actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-20.000e+094.68Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+094.68Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+094.68Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-40.000e+094.15Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-30.000e+093.88Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
back to top
BLAST of Actin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act5C0.000e+094.95gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C0.000e+094.95gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C0.000e+094.95gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C0.000e+094.95gene:FBgn0000042 transcript:FBtr0070823[more]
Act5C0.000e+094.95gene:FBgn0000042 transcript:FBtr0100663[more]
back to top
BLAST of Actin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+095.19actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb10.000e+095.19actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb20.000e+094.92actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+094.92actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+094.92actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of Actin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb0.000e+095.19actin, beta [Source:NCBI gene;Acc:407952][more]
actg10.000e+094.92actin gamma 1 [Source:NCBI gene;Acc:394957][more]
acta20.000e+090.16actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
rspry10.000e+091.71ring finger and SPRY domain containing 1 [Source:X... [more]
acta20.000e+091.44actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
back to top
BLAST of Actin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actb0.000e+094.92actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg10.000e+094.39actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg10.000e+094.39actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Acta20.000e+091.71actin, alpha 2, smooth muscle, aorta [Source:MGI S... [more]
Actc10.000e+091.71actin, alpha, cardiac muscle 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Actin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q964E0|ACTC_BIOTE0.000e+095.48Actin, cytoplasmic OS=Biomphalaria tenagophila OX=... [more]
sp|Q964E1|ACTC_BIOOB0.000e+095.48Actin, cytoplasmic OS=Biomphalaria obstructa OX=15... [more]
sp|P12716|ACTC_PISOC0.000e+095.21Actin, cytoplasmic OS=Pisaster ochraceus OX=7612 P... [more]
sp|Q964E3|ACTC_BIOAL0.000e+095.21Actin, cytoplasmic OS=Biomphalaria alexandrina OX=... [more]
sp|Q964D9|ACTC_PLATR0.000e+095.21Actin, cytoplasmic OS=Planorbella trivolvis OX=283... [more]
back to top
BLAST of Actin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C5GED00.000e+097.87Beta-actin OS=Polycelis sp. ZD-2015 OX=1615610 PE=... [more]
A0A5J4NKW10.000e+097.61Actin beta/gamma 1 OS=Paragonimus westermani OX=34... [more]
K7X7R00.000e+097.87Beta-actin OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A4S2LD350.000e+097.07Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PSP40.000e+097.07Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10... [more]
back to top
BLAST of Actin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+095.19actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb20.000e+094.92actin beta [Source:NCBI gene;Acc:103030443][more]
actb10.000e+095.16actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta20.000e+091.71actin alpha 2, smooth muscle [Source:NCBI gene;Acc... [more]
zgc:867090.000e+091.44actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Actin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011113.10.000e+093.88pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.10.000e+093.35pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.19.932e-16255.38pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
ENSPMAT00000008200.15.829e-7744.64pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 ge... [more]
ENSPMAT00000003686.11.513e-7235.99pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
back to top
BLAST of Actin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT10.000e+087.17Actin; structural protein involved in cell polariz... [more]
ARP23.863e-12447.34Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP14.119e-12247.22Actin-related protein of the dynactin complex; req... [more]
ARP31.643e-7335.12Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP41.104e-2326.99Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385200.000e+095.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426460.000e+095.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450130.000e+095.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380060.000e+095.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379760.000e+093.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021726.20.000e+094.92actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb0.000e+094.92cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb0.000e+094.92cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000011677.20.000e+094.39actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000029375.10.000e+094.39actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
back to top
BLAST of Actin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051672.10.000e+0100.00SMESG000051672.1[more]
SMESG000051670.10.000e+0100.00SMESG000051670.1[more]
SMESG000066020.10.000e+096.54SMESG000066020.1[more]
SMESG000058003.10.000e+095.74SMESG000058003.1[more]
SMESG000057992.10.000e+095.74SMESG000057992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007704 ID=SMED30007704|Name=Actin|organism=Schmidtea mediterranea sexual|type=transcript|length=1528bp
TTGAAATTTTACAAACTGGGCAATTCGATGATTTGTTTGTGCATTTGTTA
TTCAAAATTTTGACCTTTAACCCTTTTGTGTTATCAGTAAACGAATAATA
CTTTCATACATGTCCAAATATGGACATAGTTAAAATTAACCTTTGTGCAA
AAAATCTCGATATAAATTACTCGAAATTATTCAACATGTCGCAGTTTAAC
AAAACTATTTTCAAATATGTCAGACGAAGATGTAGCAGCTTTGGTTGTTG
ATAACGGATCTGGTATGTGCAAAGCCGGATTCGCTGGTGATGATGCTCCT
CGAGCCGTTTTTCCATCCATTGTTGGTCGTCCAAGACATCAAGGTGTCAT
GGTTGGTATGGGACAAAAAGATAGTTATGTCGGAGATGAAGCACAATCCA
AACGAGGTATTTTAACTTTGAAATACCCCATTGAACACGGCATTGTTACC
AATTGGGATGACATGGAAAAGATTTGGCATCATACGTTTTACAATGAATT
GAGAGTAGCCCCTGAAGAACATCCAGTTTTATTAACTGAAGCTCCTCTTA
ATCCAAAAGCCAACAGAGAAAAGATGACACAAATCATGTTTGAAACATTC
AATGCGCCCGCCATGTATGTTGCCATCCAAGCAGTGTTGTCATTGTATGC
ATCTGGTCGAACCACTGGTATCGTTTTGGATTCCGGAGACGGTGTAACAC
ACACTGTTCCGATTTACGAAGGATACGCTCTTCCTCACGCCATCTTGAGA
TTAGATCTTGCAGGAAGAGATCTTACAGATTACTTAATGAAAATTCTCAC
AGAAAGAGGATACAGTTTCACAACTACAGCTGAAAGAGAAATCGTTAGAG
ATATTAAAGAAAAGCTTTGTTATATTGCTCTTGATTTTGATGCTGAAATG
AGAACAGCTTCAGCCTCGTCATCATTGGAAAAGAGTTATGAGTTACCTGA
CGGTCAAGTAATTACTATTGGTAATGAAAGATTTAGATGCCCAGAAGCAC
TATTCCAACCAAGTTTCTTGGGATTAGAATCAGTCGGTATCCATGAAACA
ACTTACAACAGCATCATGAAATGCGATGTCGATATCAGAAAAGATTTGTA
CGCCAACACAGTCTTATCAGGAGGCTCAACAATGTATCCTGGCATTGCTG
ATCGTATGCAGAAAGAAATTTCATCATTGGCTCCACCGACAATGAAAATC
AAGATTGTTGCTCCACCAGAAAGAAAATACTCTGTATGGATCGGAGGTTC
AATTTTGGCATCATTGTCAACTTTCCAACAAATGTGGATTTCAAAACAAG
AATATGACGAATCTGGTCCAGGAATCGTTCATCGCAAATGTTTTTAAACA
AAAATATTTTCAATTTGAATAATTTGATTAATGAATAAACAATTATTAAT
TTTATACATTTCTGTTTGAGCAAAAAATTCAATGAATTCAACTTCTGGAA
TAAATGTTGGCAATAGTTTTATTATTTTTCTCATATCAAGTTGTATTTTT
AAAAATATAAAATAAAATCATTTTTAAA
back to top

protein sequence of SMED30007704-orf-1

>SMED30007704-orf-1 ID=SMED30007704-orf-1|Name=SMED30007704-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MSDEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYIALDFDAEMRTASASSSLEKSYELPDGQVIT
IGNERFRCPEALFQPSFLGLESVGIHETTYNSIMKCDVDIRKDLYANTVL
SGGSTMYPGIADRMQKEISSLAPPTMKIKIVAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004000Actin
IPR004001Actin_CS
IPR020902Actin/actin-like_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004000Actin familyPRINTSPR00190ACTINcoord: 62..84
score: 94.91
coord: 50..61
score: 92.79
coord: 116..129
score: 97.31
coord: 27..36
score: 96.55
coord: 141..160
score: 96.3
coord: 237..253
score: 91.95
IPR004000Actin familySMARTSM00268actin_3coord: 6..376
e-value: 3.0E-239
score: 810.8
IPR004000Actin familyPFAMPF00022Actincoord: 4..376
e-value: 4.8E-149
score: 496.4
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 4..374
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 181..273
e-value: 2.8E-190
score: 633.6
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 9..372
e-value: 2.8E-190
score: 633.6
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 139..339
e-value: 2.8E-190
score: 633.6
NoneNo IPR availablePANTHERPTHR11937:SF397ACTIN-57B-RELATEDcoord: 4..374
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 9..182
e-value: 7.09208E-21
score: 87.2591
IPR004001Actin, conserved sitePROSITEPS00406ACTINS_1coord: 54..64
IPR004001Actin, conserved sitePROSITEPS00432ACTINS_2coord: 357..365
IPR020902Actin/actin-like conserved sitePROSITEPS01132ACTINS_ACT_LIKEcoord: 105..117
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 147..376
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 5..154