Dystrobrevin

Overview
NameDystrobrevin
Smed IDSMED30007670
Length (bp)3681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dystrobrevin (SMED30007670) t-SNE clustered cells

Violin plots show distribution of expression levels for Dystrobrevin (SMED30007670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dystrobrevin (SMED30007670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dystrobrevin (SMED30007670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007670SMESG000078318.1 SmedASXL_012491SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30007670SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007670SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007670SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007670SMESG000078318.1 dd_Smed_v6_12275_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dystrobrevin vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 335.88 bits (860), Expect = 4.850e-101
Identity = 209/627 (33.33%), Postives = 331/627 (52.79%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ KS        + C       +         V   Q           P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +                  N   P  ++    D        + K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISKS--------LGCVPTREPPHP--------VFPEQPEKPLDLAHIVPPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEAG---------------NVTRPPTDLSFNFD--------ANKQQRQLIAELENKNR---EILQEIQRLRLEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGV 561          
BLAST of Dystrobrevin vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 334.339 bits (856), Expect = 1.156e-100
Identity = 235/761 (30.88%), Postives = 362/761 (47.57%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVRN 2500
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ KS        + C       +         V   Q           P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +       +  P T +S +               F+ N     K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L               K     QAA         +G    +P               HG G PM                        P P  +T    + T    + L G     +  F  G R                               +LR +LL+AAD++TN M+ LV+ 
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISKS--------LGCVPTREPPHP--------VFPEQPEKPLDLAHIVPPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEA---GNVTRPPTDLSFN---------------FDAN-----KQQRQLIAELENKNR---EILQEIQRLRLEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLL---------------KEEEQKQAAQA-------TGSPHTSP--------------THGGGRPM------------------------PMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQGTRR------------------------------NLRNDLLVAADSITNTMSSLVKE 605          
BLAST of Dystrobrevin vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 333.183 bits (853), Expect = 5.389e-100
Identity = 244/761 (32.06%), Postives = 368/761 (48.36%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVRN 2500
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ K        ++ C       +         V   Q           P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +       +  P T +S +               F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L               K     QAA         +G    +P               HG G PM                        P P  +T    + T    + L G     +  F  G R                               +LR +LL+AAD++TN M+ LV+ 
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISK--------SLGCVPTREPPHP--------VFPEQPEKPLDLAHIVPPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEAG---NVTRPPTDLSFN---------------FDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLL---------------KEEEQKQAAQA-------TGSPHTSP--------------THGGGRPM------------------------PMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQGTRR------------------------------NLRNDLLVAADSITNTMSSLVKE 605          
BLAST of Dystrobrevin vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 331.643 bits (849), Expect = 7.446e-100
Identity = 212/594 (35.69%), Postives = 322/594 (54.21%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSA 1999
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ K        ++ C       +         V   Q           P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +                  N   P  ++    D        + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISK--------SLGCVPTREPPH--------PVFPEQPEKPLDLAHIVPPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEAG---------------NVTRPPTDLSFNFD--------ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQA 528          
BLAST of Dystrobrevin vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 287.345 bits (734), Expect = 2.451e-84
Identity = 185/581 (31.84%), Postives = 300/581 (51.64%), Query Frame = 2
Query:  368 VVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ KS        + C       +     Q     +   ++        P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +                  N   P  ++    D        + K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:    1 MIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISKS--------LGCVPTREPPHPVFPEQPEKPLDLAHIV--------PPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEAG---------------NVTRPPTDLSFNFD--------ANKQQRQLIAELENKNR---EILQEIQRLRLEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGV 504          
BLAST of Dystrobrevin vs. Ensembl Celegans
Match: dyb-1 (Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y048])

HSP 1 Score: 264.618 bits (675), Expect = 2.891e-76
Identity = 148/438 (33.79%), Postives = 232/438 (52.97%), Query Frame = 2
Query:  239 FKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSR-----IQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTL 1537
             ++LI+EM+ + FDSIRFA YR ACKLR+IQQ+T++ L+D+  ++E+FR+ GL  +     +  ++ E+++  ++  L+ RL A   +  ++   SI +L+ +LL +YD   TGRL+V ++KVAL+TL +GK +DK +Y F+ + D +G +   +F  +L  +L L   VFE P F ++  A       + + + +  FL+  L+DP P C++WL + HR+A++ NV H V C+ C      GFRYKCQRC +Y LCQ CFW G T+ NHSN H++KEY SS KS ++Q  H++ KS                                             C+P  +TV         A   G   + P + +     N+N + V   P+        T++ +W +S      P +       DDEH+LIARYA+ L
Sbjct:   36 MQQLIDEMRLQDFDSIRFATYRAACKLRFIQQKTKVHLVDIWNMIEAFRENGLNALPLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDV---SISLLLAFLLGAYDKQNTGRLTVFSIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCF-HKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEY-SSYKSPTKQLVHSIHKSLQ-------------------------------------------CIPATSTVGDANIDIFNAKIGGPVSSKPARPL-----NLN-NIVPATPTTIRRQHAATSSADWPTS--PVLLPGQASHGGVIDDEHKLIARYAAKL 417          
BLAST of Dystrobrevin vs. Ensembl Celegans
Match: dyb-1 (Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y048])

HSP 1 Score: 211.46 bits (537), Expect = 1.332e-58
Identity = 124/395 (31.39%), Postives = 197/395 (49.87%), Query Frame = 2
Query:  368 VVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSR-----IQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTL 1537
            ++E+FR+ GL  +     +  ++ E+++  ++  L+ RL A   +  ++   SI +L+ +LL +YD   TGRL+V ++KVAL+TL +GK +DK +Y F+ + D +G +   +F  +L  +L L   VFE P F ++  A       + + + +  FL+  L+DP P C++WL + HR+A++ NV H V C+ C      GFRYKCQRC +Y LCQ CFW G T+ NHSN H++KEY SS KS ++Q  H++ KS                                             C+P  +TV         A   G   + P + +     N+N + V   P+        T++ +W +S      P +       DDEH+LIARYA+ L
Sbjct:    1 MIEAFRENGLNALPLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDV---SISLLLAFLLGAYDKQNTGRLTVFSIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCF-HKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEY-SSYKSPTKQLVHSIHKSLQ-------------------------------------------CIPATSTVGDANIDIFNAKIGGPVSSKPARPL-----NLN-NIVPATPTTIRRQHAATSSADWPTS--PVLLPGQASHGGVIDDEHKLIARYAAKL 339          
BLAST of Dystrobrevin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 120.168 bits (300), Expect = 5.295e-27
Identity = 89/298 (29.87%), Postives = 148/298 (49.66%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R
Sbjct:  993 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECPG------LEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIR 1273          
BLAST of Dystrobrevin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 120.168 bits (300), Expect = 6.610e-27
Identity = 89/298 (29.87%), Postives = 148/298 (49.66%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R
Sbjct: 1931 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECPG------LEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIR 2211          
BLAST of Dystrobrevin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 120.168 bits (300), Expect = 7.185e-27
Identity = 89/298 (29.87%), Postives = 148/298 (49.66%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R
Sbjct: 1920 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECPG------LEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIR 2200          
BLAST of Dystrobrevin vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0087929)

HSP 1 Score: 339.732 bits (870), Expect = 7.275e-103
Identity = 219/622 (35.21%), Postives = 323/622 (51.93%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2101
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV             Q   R  D  ++ +          LP  N  S      +G     P        Q+  F   S + S     S  + +G   +++      S +      D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV-------------QVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPG----LPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASAN------DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMA--------------------PENPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 550          
BLAST of Dystrobrevin vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0087930)

HSP 1 Score: 339.732 bits (870), Expect = 9.390e-103
Identity = 219/622 (35.21%), Postives = 323/622 (51.93%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2101
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV             Q   R  D  ++ +          LP  N  S      +G     P        Q+  F   S + S     S  + +G   +++      S +      D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:   18 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV-------------QVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPG----LPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASAN------DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMA--------------------PENPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 559          
BLAST of Dystrobrevin vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0100298)

HSP 1 Score: 339.732 bits (870), Expect = 1.889e-102
Identity = 219/622 (35.21%), Postives = 323/622 (51.93%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2101
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV             Q   R  D  ++ +          LP  N  S      +G     P        Q+  F   S + S     S  + +G   +++      S +      D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV-------------QVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPG----LPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASAN------DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMA--------------------PENPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 550          
BLAST of Dystrobrevin vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0305077)

HSP 1 Score: 339.347 bits (869), Expect = 3.383e-102
Identity = 219/622 (35.21%), Postives = 323/622 (51.93%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2101
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV             Q   R  D  ++ +          LP  N  S      +G     P        Q+  F   S + S     S  + +G   +++      S +      D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:   18 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV-------------QVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPG----LPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASAN------DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMA--------------------PENPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 559          
BLAST of Dystrobrevin vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0308613)

HSP 1 Score: 340.502 bits (872), Expect = 4.085e-102
Identity = 219/622 (35.21%), Postives = 323/622 (51.93%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2101
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV             Q   R  D  ++ +          LP  N  S      +G     P        Q+  F   S + S     S  + +G   +++      S +      D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV-------------QVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPG----LPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASAN------DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMA--------------------PENPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 550          
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 331.643 bits (849), Expect = 9.584e-99
Identity = 206/597 (34.51%), Postives = 318/597 (53.27%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQ-NQSQSRNVDNNQRMMKTPAGQASPCL----------PYRNTVSRIQAADNGQF-RASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYH-----DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 1966
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS        ++C       Y Q + +  + ++ N  +   P    +  +          PY +  +  +      F R +P+   +   + V +S  ++   +  H    +           + N   K+   F H     DDEH LIARYAS L +      G      S+  D                      S K Q++LIA+LE KNK     +Q ++  +QQ+  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS--------LSCAASREPAYPQFSDTPEKTLNLNHIVPPRPVATGNEYMLSHSMPSSGNPYSSKAAHDETNQMKLFSRTTPD---LLKGKGVQYSLDIADRLADEHILIGL-----------YVNLLQKERSCFQHSSKNQDDEHCLIARYASRLAADEVAAKGRVPTDISLCLD----------------------SNKQQRQLIAELENKNK---EILQEIQRLRQQHEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 544          
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 328.176 bits (840), Expect = 2.182e-97
Identity = 209/600 (34.83%), Postives = 319/600 (53.17%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT----PAGQASPCL----------PYRNTVSRIQAADNGQF-RASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYH-----DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 1966
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS        ++C       Y Q         N   ++ T    P    +  +          PY +  +  +      F R +P+   +   + V +S  ++   +  H    +           + N   K+   F H     DDEH LIARYAS L +         +P        TD   I + L S+          K Q++LIA+LE KNK     +Q ++  +QQ+  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS--------LSCAASREPAYPQFSDTPEKTLNLNHIVGTWPPRPVATGNEYMLSHSMPSSGNPYSSKAAHDETNQMKLFSRTTPD---LLKGKGVQYSLDIADRLADEHILIGL-----------YVNLLQKERSCFQHSSKNQDDEHCLIARYASRLAADEVAAQKGRVP--------TD---ISLCLDSN----------KQQRQLIAELENKNK---EILQEIQRLRQQHEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 548          
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 328.176 bits (840), Expect = 2.182e-97
Identity = 209/600 (34.83%), Postives = 319/600 (53.17%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT----PAGQASPCL----------PYRNTVSRIQAADNGQF-RASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYH-----DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 1966
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS        ++C       Y Q         N   ++ T    P    +  +          PY +  +  +      F R +P+   +   + V +S  ++   +  H    +           + N   K+   F H     DDEH LIARYAS L +         +P        TD   I + L S+          K Q++LIA+LE KNK     +Q ++  +QQ+  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS--------LSCAASREPAYPQFSDTPEKTLNLNHIVGTWPPRPVATGNEYMLSHSMPSSGNPYSSKAAHDETNQMKLFSRTTPD---LLKGKGVQYSLDIADRLADEHILIGL-----------YVNLLQKERSCFQHSSKNQDDEHCLIARYASRLAADEVAAQKGRVP--------TD---ISLCLDSN----------KQQRQLIAELENKNK---EILQEIQRLRQQHEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 548          
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 315.849 bits (808), Expect = 5.834e-94
Identity = 197/586 (33.62%), Postives = 310/586 (52.90%), Query Frame = 2
Query:  224 IGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSS 1981
            + MA  K+L  +MK + +D+IR + YRTACKLR++Q++  L L+DV  ++E+FR  GL  ++    +   ++E ++  +Y QL+ RLP   Q+    +  +  +L+ ++  ++DT   GRL+V ++K+ LS L  GK +DK +Y F+ ++D  GA+  ++F+ +L + L L   VFEGP+F Y    ++     + K +++  FL+ +++DP PQCL+WL + HR+ N+ENV H V C  C  + + GFRY+CQ+C +Y LCQ+CFW G  +GNHSN HD+KE+ SS KS +++ G A+ KS        V     S   Y +   +  N+ N   +   P G  +   P  +T S            SP + + T          +Q  +  HA           SS +  + P +       D+EH+LIARYAS L +        D  HT+   D +             ++ N     K Q+ELI +LE KN+     +Q ++  + ++  A     ++            +  NP LL ELR LR RKDELE RM+SLQESR ELM QLE LM++L   ++
Sbjct:    9 VVMADRKQLFMDMKTQNYDTIRLSTYRTACKLRFVQKKCNLHLVDVWNMIEAFRDNGLNTLDVCTEISVARLETILTCIYQQLNKRLPTTHQIS---VQHNTSLLLNFMATAHDTDAQGRLTVFSVKMMLSVLCGGKLVDKLRYIFSQISDSHGAMEMSKFDHFLREALKLPAAVFEGPSFGYLDHLARSCF-PQQKKVMLNMFLDALMSDPPPQCLIWLPLVHRMGNVENVHHPVSCSFCRSDGMTGFRYRCQQCFNYQLCQNCFWRGHASGNHSNHHDMKEH-SSWKSPAKKLGRAISKSL-----GCVPSREPSHPIYPEYPEKPLNLSNI--VPPRPIGNMNEPAPPLSTGS------------SPTKRLPTL-------AAAQRMNEEHALI-AAYVNKLQSSPRALDSPVRS------DEEHKLIARYASRLAT--------DPGHTARPADFS-------------YDTN-----KQQRELIMQLENKNR---EILQEIQRLRVEHEQACQPTPER------------VQQNPTLLAELRQLRQRKDELEQRMSSLQESRRELMVQLEGLMKLLKAQAA 515          
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Match: dtnbb (dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070117-3])

HSP 1 Score: 284.263 bits (726), Expect = 3.735e-83
Identity = 125/300 (41.67%), Postives = 203/300 (67.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            M   ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+DV  ++E+FR  GL  ++ +  ++ +++E +++ ++ QL+ RLP   Q++   + +SI +L+ +++ +YD+ G G+L+V A+K  L+T+  GK +DK +Y F+ ++D +G ++  +F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ ++ADP PQCL+WL + HRLAN+ENV H V C  C  E ++GFRY+CQ+CH Y LCQ CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MVEKRQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIEAFRDNGLSTLDHNAEINVSRLETILSSIFYQLNKRLPTTHQIN---VEQSIGLLLNFIVATYDSEGHGKLTVFAMKAMLATMCGGKILDKLRYVFSQISDSNGVMVFAKFDQFLREVLKLPTAVFEGPSFGYTEHSVR-TCFPQQKKILLNTFLDVLMADPPPQCLVWLPLMHRLANVENVFHPVECSYCRSESMMGFRYRCQQCHGYQLCQSCFWRGHASGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.1889 bits (204), Expect = 9.461e-16
Identity = 79/201 (39.30%), Postives = 107/201 (53.23%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  S              ++T  P  ++    D        + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LRHRKDELE RM++LQESR ELM QLE LMR+L   + +  +S+   + S +M     + +A +  T + Q  L GV
Sbjct:  343 DEEHRLIARYAARLAAEAS--------------NSTQCPPSDLSFNFD--------ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRHRKDELERRMSALQESRRELMVQLEGLMRLLKAQTGTSPHSSPSHSASCTMPMPIRSTSAGSTPTHTPQDCLAGV 506          
BLAST of Dystrobrevin vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 347.051 bits (889), Expect = 3.076e-104
Identity = 216/644 (33.54%), Postives = 349/644 (54.19%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT-PA--------GQASPC--LPYRNTVSRIQAADNGQ----FRASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS        ++C       +     Q     N   ++   P           + PC   P+ N +S  ++ +  Q     RA+P    +   + + +S  V+   +  H    V      ++  +  + PS+       D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS--------LSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDNIFSHSVPCSGSPFTNKISPHKSTEVEQSKYLARAAPT---LLKGKGLQYSLDVADRLADEHVLIGVYANMLQNNHSRMLDSPSR------LDEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNR---EILQEIQRLRIEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 593          
BLAST of Dystrobrevin vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 347.051 bits (889), Expect = 8.377e-104
Identity = 216/644 (33.54%), Postives = 349/644 (54.19%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT-PA--------GQASPC--LPYRNTVSRIQAADNGQ----FRASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS        ++C       +     Q     N   ++   P           + PC   P+ N +S  ++ +  Q     RA+P    +   + + +S  V+   +  H    V      ++  +  + PS+       D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:   18 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS--------LSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDNIFSHSVPCSGSPFTNKISPHKSTEVEQSKYLARAAPT---LLKGKGLQYSLDVADRLADEHVLIGVYANMLQNNHSRMLDSPSR------LDEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNR---EILQEIQRLRIEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 599          
BLAST of Dystrobrevin vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 339.732 bits (870), Expect = 4.529e-101
Identity = 216/651 (33.18%), Postives = 349/651 (53.61%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT-PA--------GQASPC--LPYRNTVSRIQAADNGQ----FRASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL-------NTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS        ++C       +     Q     N   ++   P           + PC   P+ N +S  ++ +  Q     RA+P    +   + + +S  V+   +  H    V      ++  +  + PS+       D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L        T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:   18 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS--------LSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDNIFSHSVPCSGSPFTNKISPHKSTEVEQSKYLARAAPT---LLKGKGLQYSLDVADRLADEHVLIGVYANMLQNNHSRMLDSPSR------LDEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNR---EILQEIQRLRIEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEQELRQETQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 606          
BLAST of Dystrobrevin vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 339.347 bits (869), Expect = 5.358e-101
Identity = 216/651 (33.18%), Postives = 349/651 (53.61%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKT-PA--------GQASPC--LPYRNTVSRIQAADNGQ----FRASPNQTMMTTDQNVNFS-GVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL-------NTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS        ++C       +     Q     N   ++   P           + PC   P+ N +S  ++ +  Q     RA+P    +   + + +S  V+   +  H    V      ++  +  + PS+       D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L        T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS--------LSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDNIFSHSVPCSGSPFTNKISPHKSTEVEQSKYLARAAPT---LLKGKGLQYSLDVADRLADEHVLIGVYANMLQNNHSRMLDSPSR------LDEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNR---EILQEIQRLRIEHEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEQELRQETQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 600          
BLAST of Dystrobrevin vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 291.582 bits (745), Expect = 1.088e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 306          

HSP 2 Score: 81.2629 bits (199), Expect = 5.885e-15
Identity = 80/201 (39.80%), Postives = 105/201 (52.24%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  S+ +  D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  421 DEEHRLIARYAARLAAENSS-AVTDISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 580          
BLAST of Dystrobrevin vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 327.02 bits (837), Expect = 3.296e-98
Identity = 221/626 (35.30%), Postives = 340/626 (54.31%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKE---YTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE   + S +K  S     +L     R+    V            +    R + N   M  T     S  +P      R+Q + +      PN   +  D++   +  S +  + H C+ V ++            PS+       D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHLVPPRPLTN---MNDTVVSHMSSGVP--TPTKRLQYSQD-----MPN---LLADEHALIA--SYVARLQH-CTRVLDS------------PSR------LDEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 327.02 bits (837), Expect = 3.330e-98
Identity = 221/626 (35.30%), Postives = 340/626 (54.31%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKE---YTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE   + S +K  S     +L     R+    V            +    R + N   M  T     S  +P      R+Q + +      PN   +  D++   +  S +  + H C+ V ++            PS+       D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCF-PQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHLVPPRPLTN---MNDTVVSHMSSGVP--TPTKRLQYSQD-----MPN---LLADEHALIA--SYVARLQH-CTRVLDS------------PSR------LDEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 285.804 bits (730), Expect = 6.953e-84
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 80.8777 bits (198), Expect = 4.582e-15
Identity = 78/201 (38.81%), Postives = 106/201 (52.74%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:  369 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 531          
BLAST of Dystrobrevin vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 286.189 bits (731), Expect = 7.115e-84
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 78.1814 bits (191), Expect = 3.219e-14
Identity = 81/208 (38.94%), Postives = 105/208 (50.48%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS-------RSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A  S  +       R M     + +A +  T   Q  L+GV
Sbjct:  369 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 538          
BLAST of Dystrobrevin vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 285.804 bits (730), Expect = 1.768e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 78.1814 bits (191), Expect = 3.720e-14
Identity = 81/208 (38.94%), Postives = 105/208 (50.48%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS-------RSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A  S  +       R M     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 568          
BLAST of Dystrobrevin vs. UniProt/SwissProt
Match: sp|O60941|DTNB_HUMAN (Dystrobrevin beta OS=Homo sapiens OX=9606 GN=DTNB PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.588e-99
Identity = 244/761 (32.06%), Postives = 368/761 (48.36%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHT----NQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVRN 2500
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ K        ++ C       +         V   Q           P  P  N         N    +  +  + T  + + +S    IPS  H         ++ + L+H     + PS+       D+EHRLIARYA+ L +       +  P T +S +               F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L               K     QAA         +G    +P               HG G PM                        P P  +T    + T    + L G     +  F  G R                               +LR +LL+AAD++TN M+ LV+ 
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISK--------SLGCVPTREPPHP--------VFPEQPEKPLDLAHIVPPRPLTNM--------NDTMVSHMSSGVPTPTKRLQYS--QDIPS--HLADEHALIASYVARLQHCARVLDSPSR------LDEEHRLIARYAARLAAEAG---NVTRPPTDLSFN---------------FDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLL---------------KEEEQKQAAQA-------TGSPHTSP--------------THGGGRPM------------------------PMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQGTRR------------------------------NLRNDLLVAADSITNTMSSLVKE 605          
BLAST of Dystrobrevin vs. UniProt/SwissProt
Match: sp|P84060|DTNB_RAT (Dystrobrevin beta OS=Rattus norvegicus OX=10116 GN=Dtnb PE=1 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 1.525e-97
Identity = 219/626 (34.98%), Postives = 338/626 (53.99%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKE---YTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q++   + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE   + S +K  S     +L     R+    V            +    R + N    M +      P         R+Q   +      PN   +  D++   +  S +  + H C+ V ++            PS+       D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      RSM     + +A +  T   Q  L+GV
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHATEISVSRLETVISSIYYQLNKRLPSTHQIN---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKELSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVP-----TPTKRLQYGQD-----MPN---LLADEHALIA--SYVARLQH-CTRVLDS------------PSR------LDEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRSMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin vs. UniProt/SwissProt
Match: sp|O70585|DTNB_MOUSE (Dystrobrevin beta OS=Mus musculus OX=10090 GN=Dtnb PE=1 SV=3)

HSP 1 Score: 285.804 bits (730), Expect = 6.853e-82
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 80.8777 bits (198), Expect = 4.588e-14
Identity = 78/201 (38.81%), Postives = 106/201 (52.74%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin vs. UniProt/SwissProt
Match: sp|Q9Y4J8|DTNA_HUMAN (Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 2.221e-81
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 86.6557 bits (213), Expect = 8.376e-16
Identity = 81/201 (40.30%), Postives = 106/201 (52.74%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  431 DEEHRLIARYAARLAAESSS---------SQPPQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 597          
BLAST of Dystrobrevin vs. UniProt/SwissProt
Match: sp|Q9D2N4|DTNA_MOUSE (Dystrobrevin alpha OS=Mus musculus OX=10090 GN=Dtna PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 3.231e-81
Identity = 130/300 (43.33%), Postives = 207/300 (69.00%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNIELNVARLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 81.2629 bits (199), Expect = 3.696e-14
Identity = 81/208 (38.94%), Postives = 106/208 (50.96%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN-------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L        T  +S   S+   T SR +     + +A    T + Q  LTGV
Sbjct:  428 DEEHRLIARYAARLAAESSS---------SQPTQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRVE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGTQGASSPRSSPSHTISRPIPMPIRSASACPTPTHTPQDSLTGV 601          
BLAST of Dystrobrevin vs. TrEMBL
Match: A0A4S2LEN9 (ZZ-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009439 PE=4 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 3.224e-119
Identity = 188/311 (60.45%), Postives = 235/311 (75.56%), Query Frame = 2
Query:  236 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD-----------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1132
            GFKRL+ EMK +QFD+IRFAAYRTA KLRYIQQRT    M++  VVE+FR+ GL+ L + + +LD      ++A++Y+QLS   P  D              PN++  + E+L+ +L+Y+ D   T RL+V +LK+ALSTL + KP DKF+YHFTLL+DPSGALI  +FE YL DLL L + VFEGPNF Y  QA++ +L GRSK I+IE+FLE+MLADPGPQ L+WLTIFHRLA +EN+RHNVRCEGC RE + G RYKC RC HYNLCQDCFWTGVTT  H+N HDVKEY+S+SKSHSRQFGH+LRKS+
Sbjct:   85 GFKRLLAEMKLRQFDTIRFAAYRTASKLRYIQQRTLFRFMELGRVVETFREFGLHQLNDPNASLDYAGTARILARIYSQLS--CPTTDVQTKSCSRTTPSFDPNVLRAASEILLSFLIYALDVCATARLTVNSLKIALSTLTNAKPSDKFRYHFTLLSDPSGALIQGKFETYLQDLLRLPISVFEGPNFFYTPQAAQAMLSGRSKNILIEDFLERMLADPGPQLLVWLTIFHRLAAVENIRHNVRCEGCKREPLFGLRYKCTRCQHYNLCQDCFWTGVTTEPHTNAHDVKEYSSASKSHSRQFGHSLRKSF 393          
BLAST of Dystrobrevin vs. TrEMBL
Match: A0A3R7EUH4 (Dystrobrevin beta OS=Clonorchis sinensis OX=79923 GN=DTNB PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.077e-118
Identity = 187/311 (60.13%), Postives = 235/311 (75.56%), Query Frame = 2
Query:  236 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD-----------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1132
            GFKRL+ EMK +QFD+IRFAAYRTA KLRYIQQRT    M++  VVE+FR+ GL+ L + + +LD      ++A++Y+QLS   P  D              PN++  + E+L+ +L+Y+ D   T RL+V +LK+ALSTL + KP +KF+YHFTLL+DPSGALI  +FE YL DLL L + VFEGPNF Y  QA++ +L GRSK I+IE+FLE+MLADPGPQ L+WLTIFHRLA +EN+RHNVRCEGC RE + G RYKC RC HYNLCQDCFWTGVTT  H+N HDVKEY+S+SKSHSRQFGH+LRKS+
Sbjct:   85 GFKRLLAEMKLRQFDTIRFAAYRTASKLRYIQQRTLFRFMELGRVVETFREFGLHQLNDPNASLDYAGTARILARIYSQLSG--PTTDVQTKSGSKTTPSFDPNVLRAASEILLSFLIYALDVCATARLTVNSLKIALSTLTNAKPSEKFRYHFTLLSDPSGALIQGKFETYLQDLLRLPISVFEGPNFFYTPQAAQAMLSGRSKNILIEDFLERMLADPGPQLLVWLTIFHRLAAVENIRHNVRCEGCKREPLFGLRYKCTRCQHYNLCQDCFWTGVTTEPHTNAHDVKEYSSASKSHSRQFGHSLRKSF 393          
BLAST of Dystrobrevin vs. TrEMBL
Match: A0A0X3NGC7 (Dystrobrevin-1 OS=Schistocephalus solidus OX=70667 GN=DTN1 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 9.505e-118
Identity = 186/320 (58.13%), Postives = 233/320 (72.81%), Query Frame = 2
Query:  215 TQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD--------------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1132
            ++    AGF+RL+ E+KAK+FD IRFAAYRTA KLRYIQ+RT L  +D+  VVE+FR  GL+L + S  L+R   E ++ ++Y  L    P  D               L   ++ ++ E+L+GWL Y  D +  GRL+V  LKVALSTLASGKP DKF+YHFTLLT+P+G L   R E YL +LL LAVGVFE PNF+YNSQ SKFI+ GRSK+I++EEFLE+MLA+PGPQ   WL +FHR+  +ENVRH V+CEGC RE IIG RYKC RC  YNLCQDCFWTG+TT  H+N+HDVKEYT+S+K HSRQFGH+LRKS+
Sbjct:  101 SENAAFAGFRRLLAELKAKKFDQIRFAAYRTASKLRYIQKRTLLGSLDIWRVVETFRDVGLHLADPSVTLNRQGTEQLLWRIYANLP---PPTDSPVVCDATGQRQILPLQSPMLTQAAEILLGWLTYILDPTNCGRLAVSGLKVALSTLASGKPADKFRYHFTLLTNPAGVLQIPRLETYLQELLSLAVGVFEEPNFSYNSQTSKFIISGRSKSILVEEFLERMLAEPGPQTFSWLKVFHRMVIVENVRHQVKCEGCKREPIIGLRYKCTRCPRYNLCQDCFWTGITTDAHTNSHDVKEYTTSTKQHSRQFGHSLRKSF 417          
BLAST of Dystrobrevin vs. TrEMBL
Match: A0A0X3NXD5 (Dystrobrevin-1 OS=Schistocephalus solidus OX=70667 GN=DTN1 PE=4 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 4.910e-117
Identity = 186/320 (58.13%), Postives = 233/320 (72.81%), Query Frame = 2
Query:  215 TQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQ--------------LHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1132
            ++    AGF+RL+ E+KAK+FD IRFAAYRTA KLRYIQ+RT L  +D+  VVE+FR  GL+L + S  L+R   E ++ ++Y  L    P  D               L   ++ ++ E+L+GWL Y  D +  GRL+V  LKVALSTLASGKP DKF+YHFTLLT+P+G L   R E YL +LL LAVGVFE PNF+YNSQ SKFI+ GRSK+I++EEFLE+MLA+PGPQ   WL +FHR+  +ENVRH V+CEGC RE IIG RYKC RC  YNLCQDCFWTG+TT  H+N+HDVKEYT+S+K HSRQFGH+LRKS+
Sbjct:  101 SENAAFAGFRRLLAELKAKKFDQIRFAAYRTASKLRYIQKRTLLGSLDIWRVVETFRDVGLHLADPSVTLNRQGTEQLLWRIYANLP---PPTDSPVVCDATGQRQILPLQSPMLTQAAEILLGWLTYILDPTNCGRLAVSGLKVALSTLASGKPADKFRYHFTLLTNPAGVLQIPRLETYLQELLSLAVGVFEEPNFSYNSQTSKFIISGRSKSILVEEFLERMLAEPGPQTFSWLKVFHRMVIVENVRHQVKCEGCKREPIIGLRYKCTRCPRYNLCQDCFWTGITTDAHTNSHDVKEYTTSTKQHSRQFGHSLRKSF 417          
BLAST of Dystrobrevin vs. TrEMBL
Match: A0A4E0RH39 (Dystrobrevin beta OS=Fasciola hepatica OX=6192 GN=D915_003256 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 2.040e-114
Identity = 185/305 (60.66%), Postives = 232/305 (76.07%), Query Frame = 2
Query:  236 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPE-----SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1132
            GFKRL+ EM+A+QFDSIRFAAYRTA KLRYIQQRT   ++D+  VV++FR  GL+ + E++  LD      ++A++Y+ L+  +       P  +       ++E+L+GWL Y+ D   TGRL+V  LK+ALS L + KP +KF+YHFTLL+DPSGALIP +FE YL DLL L V VFEGPNF Y  QA++ +L GRSK I+IEEFL++MLADPG Q L+WLTIFHRLA++ENVRH+VRCE C RE I+G RYKC RC HYNLCQDCFWTG TT  H+N HDVKEY+SSSKSHSRQFGH+LRKS+
Sbjct:  114 GFKRLLTEMRARQFDSIRFAAYRTASKLRYIQQRTMFGMVDLWRVVDTFRDFGLHQITENNATLDYASTGRLLARIYSHLNGAVEPNSGKPPRTLDVTAVHLAVELLLGWLAYALDICSTGRLTVTGLKIALSVLTNAKPAEKFRYHFTLLSDPSGALIPAKFEAYLQDLLKLPVSVFEGPNFFYTPQAAQSLLSGRSKNILIEEFLDRMLADPGSQLLVWLTIFHRLASVENVRHSVRCEVCKREPILGLRYKCTRCPHYNLCQDCFWTGATTDQHTNAHDVKEYSSSSKSHSRQFGHSLRKSF 418          

HSP 2 Score: 63.5438 bits (153), Expect = 3.968e-6
Identity = 41/88 (46.59%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 1838 NPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN-TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSS 2098
            NP L+ EL+ LR RKDELE RM++LQ +R ELM QLE+L+R+L+ T    QTN A    + ++ +   + +S  S  SGL   TP SS
Sbjct:  855 NPKLVTELQALRQRKDELETRMSNLQRNRTELMLQLETLVRLLSVTGGPIQTNQA----RPQTTDAVESVLSDLS-PSGLLPSTPSSS 937          
BLAST of Dystrobrevin vs. Ensembl Cavefish
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 327.405 bits (838), Expect = 7.151e-99
Identity = 197/619 (31.83%), Postives = 326/619 (52.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGN-WDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2083
            MA  +++  EM+ + FD+IR + YRTACKLR++Q++ +L L+DV  ++E+FR  GL  ++ +  L  +++E +++ +Y QL+ RLP   Q++   + +SI +L+ +LL ++++ G GRL+V ++K+ L+ + SGK +DK +Y F+ ++D +GA+  +RF+ +L + L L   VFEGP+F Y   +++     + K +++  FL+ ++ D  PQCL+WL + HR+AN+ENV H V C  C  E ++GFRY+CQ+C  Y LCQ+CFW G  +GNHSN H +KE+ SS KS +++FG A+ KS                                             C+P R          +  +  +P + +  +  N+   G++    MN   + +    N   +S +  + PS+       D+EHRLIARY S L +                 + ++AP++        F+ N     K Q++LIA+LE KN+     +Q ++  + ++  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++    ++     SR +     +  T    +G   +
Sbjct:   12 MAEKRQIFMEMRTQNFDTIRLSTYRTACKLRFVQKKCKLHLVDVWNMIEAFRDNGLNTLDHNTELSVSRLETIVSSIYFQLNKRLPTTHQIN---VQQSISLLLNFLLAAHESEGQGRLTVFSVKMMLAIMCSGKIVDKLRYIFSQISDSNGAMTVSRFDHFLRECLKLPSAVFEGPSFGYTEHSAQSCF-PQQKKVMLNMFLDTIMDDSPPQCLVWLPLMHRIANVENVVHPVSCSYCRSESMVGFRYRCQQCFSYQLCQNCFWRGHASGNHSNQHQMKEH-SSWKSPAKKFGRAISKSLG-------------------------------------------CVPSRE-------PPHPMYPENPERPLDLS--NIVVQGIAAAQRMNEEHALIAAYVNKLQTSPRALDSPSRT------DEEHRLIARYTSRLAT-----------------EPSNAPQLN-------FDVN-----KQQRQLIAELEHKNR---EILQEIQRLRLEHEQACQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQAAGSPQTSPGHRSSRPIPMPVRSTGTTPTHTGYPPI 523          
BLAST of Dystrobrevin vs. Ensembl Cavefish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 318.161 bits (814), Expect = 2.217e-94
Identity = 219/632 (34.65%), Postives = 334/632 (52.85%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTS---SSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQ-----FRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL------NTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2083
            MA  ++L  EM+A + DSIR + YR ACKLR++Q+R  L L+D+  V+E+FR+ GL  M+ +      ++E +++ ++ QL+ R+P   Q++   + +SI +L+ +LL +YD  G G++SV  +K+AL+TL  GK +DK +Y F+ + DP G ++ ++F+Q+L ++L L   VFEGP+F+Y    +K I   + K + +  FL+  ++DP  QCL+WL + HRLAN+ENV H V C  C  + ++GFRY+CQ+CH+Y LCQ+CFW G  +G+HSN H +KEYTS    +K  S     +L  +  R+    +            +    R V N    M       S   PY    SR+ A D+ +      RA+P+   +   + V +S    I   +         G + + L+       +      DDEH LIARYAS L +  ++         S+  D                        K Q+ LIA+LE KN+EIL EIQRLR +   +  A   +TDK               NP LL EL+ LR RK+ELE RM++LQESR ELM QLE LM +L      ++  SS  ++A  S  +  +  + +T  + S Q  L G+
Sbjct:   10 MADKRQLFAEMRALELDSIRLSTYRAACKLRFVQKRCNLHLVDIWNVIEAFRENGLNTMDLNTEFTVARLEAILSTIFHQLNKRMPTTHQIN---VEQSILLLLNFLLAAYDPDGQGKVSVFVVKMALATLCGGKILDKLRYIFSQIADPDGIMVYSQFDQFLKEVLKLPGVVFEGPSFSYTEHTAK-ICFSQHKQVTLNIFLDAFMSDPPAQCLVWLPLMHRLANVENVFHPVECSYCQSQSMMGFRYRCQQCHNYQLCQECFWRGNASGSHSNQHQMKEYTSWKSPAKKLSNALSKSLSCASSREPLHPLFSDTPEKPLNLAHVVPPRPVTNGNEFMSC-YSMPSTSNPYS---SRVAANDSVKPRKPLARAAPD---LLKGKGVQYS----IDIADRLADEHVLIGLYANLLQKKRSCLLENSSNNQDDEHYLIARYASRLAADEASAKSRAPEAMSLPLDTN----------------------KQQRLLIAELENKNREILLEIQRLRQQ---HVEASQPSTDKEQ------------QNPTLLAELKQLRQRKEELEQRMSALQESRRELMVQLEQLMLLLKNPGAGSSPRSSPGHTASSSVPTPVLLTSCSTTPSHSPQDSLMGL 589          
BLAST of Dystrobrevin vs. Ensembl Cavefish
Match: dtnbb (dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070117-3])

HSP 1 Score: 282.337 bits (721), Expect = 1.706e-82
Identity = 124/296 (41.89%), Postives = 202/296 (68.24%), Query Frame = 2
Query:  242 KRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+DV  ++E+FR  GL  ++ +  ++ +++E +++ ++ QL+ RLP   Q++   + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D  G ++  +F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLAN+ENV H V C  C  E ++GFRY+CQ+CH Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   16 RQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIEAFRDNGLSTLDHNAEINVSRLETILSSIFYQLNKRLPTTHQIN---VEQSIGLLLNFMVATYDSEGHGKLTVFSMKSMLATMCGGKIVDKLRYIFSQISDSGGTMVFAKFDQFLREVLKLPTAVFEGPSFGYTEHSVR-TCFPQQKKILLNTFLDVMMADPPPQCLVWLPLMHRLANVENVFHPVECSYCRSESMMGFRYRCQQCHGYQLCQNCFWRGHASGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.9593 bits (206), Expect = 4.154e-16
Identity = 79/201 (39.30%), Postives = 106/201 (52.74%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  S              ++T  P  ++    D        + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LRHRKDELE RM++LQESR ELM QLE LMR+L   +    +S+   + S +M     + +A +  T + Q  L GV
Sbjct:  344 DEEHRLIARYAARLAAEAS--------------NSTQCPPTDLSFNFD--------ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRHRKDELEKRMSALQESRRELMVQLEGLMRLLKAQTGGSPHSSPSHSASCTMPMPIRSTSAGSTPTHTPQDCLAGV 507          
BLAST of Dystrobrevin vs. Ensembl Cavefish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 276.559 bits (706), Expect = 4.438e-81
Identity = 128/300 (42.67%), Postives = 203/300 (67.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A + DSIR + YR ACKLR++Q+R  L L+D+  V+E+FR+ GL  M+ +      ++E +++ ++ QL+ R+P   Q++   + +SI +L+ +LL +YD  G G++SV  +K+AL+TL  GK +DK +Y F+ + DP G ++ ++F+Q+L ++L L   VFEGP+F+Y    +K I   + K + +  FL+  ++DP  QCL+WL + HRLAN+ENV H V C  C  + ++GFRY+CQ+CH+Y LCQ+CFW G  +G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   10 MADKRQLFAEMRALELDSIRLSTYRAACKLRFVQKRCNLHLVDIWNVIEAFRENGLNTMDLNTEFTVARLEAILSTIFHQLNKRMPTTHQIN---VEQSILLLLNFLLAAYDPDGQGKVSVFVVKMALATLCGGKILDKLRYIFSQIADPDGIMVYSQFDQFLKEVLKLPGVVFEGPSFSYTEHTAK-ICFSQHKQVTLNIFLDAFMSDPPAQCLVWLPLMHRLANVENVFHPVECSYCQSQSMMGFRYRCQQCHNYQLCQECFWRGNASGSHSNQHQMKEYT-SWKSPAKKLSNALSKS 304          

HSP 2 Score: 65.4698 bits (158), Expect = 2.414e-10
Identity = 60/144 (41.67%), Postives = 81/144 (56.25%), Query Frame = 2
Query: 1670 KSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL------NTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2083
            K Q+ LIA+LE KN+EIL EIQRLR +   +  A   +TDK               NP LL EL+ LR RK+ELE RM++LQESR ELM QLE LM +L      ++  SS  ++A  S  +  +  + +T  + S Q  L G+
Sbjct:  346 KQQRLLIAELENKNREILLEIQRLRQQ---HVEASQPSTDKEQ------------QNPTLLAELKQLRQRKEELEQRMSALQESRRELMVQLEQLMLLLKNPGAGSSPRSSPGHTASSSVPTPVLLTSCSTTPSHSPQDSLMGL 474          
BLAST of Dystrobrevin vs. Ensembl Cavefish
Match: drp2 (dystrophin related protein 2 [Source:NCBI gene;Acc:103025899])

HSP 1 Score: 138.272 bits (347), Expect = 9.604e-33
Identity = 105/356 (29.49%), Postives = 170/356 (47.75%), Query Frame = 2
Query:  275 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFR----QTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQ---ASPCLPYRNTVSRIQ 1300
             ++I+F+AYRTA KLR +Q+  RL L+ +  V + FR    Q G Y+M+         +E++ A   T L  RL     +  N IP  ++M + WLL  YD+   G++ V++ K  + +L +    +K++Y F  +  P+G          LH+++ +      V  F G N    S  S F +     AI +  FLE M  +P  Q ++WL + HR+   E+ +H  RC  C +  I GFRY+  +  + ++CQ CF TG TT      + + EY   ++S    R F   L+  +              SK Y     Q R     Q +++  +G+   +SP LP+ +T SRI+
Sbjct:  317 LNNIKFSAYRTAMKLRRVQKALRLDLLKLTSVTDVFREQELQHGEYVMDV--------VEVIHA--LTALYERLEEERSVLIN-IPLCVDMCLNWLLNVYDSGRNGKMRVLSFKTGVVSLCNADVQEKYRYLFRQVCGPNGLTDQKHLSLLLHEVIQIPRQLGEVAAFGGSNVE-PSVRSCFRMAPGKPAIEVSHFLEWMSLEP--QSVVWLPVLHRVTAAESAKHQARCYICKQCPIKGFRYRSLKQFNVDICQMCFLTGRTTKGKRLHYPIMEYYTPTTSGEKMRDFAKTLKNKF-------------RSKQYFSKHPQ-RGYLPVQTVLEAESGETPCSSPRLPHADTHSRIE 644          
BLAST of Dystrobrevin vs. Ensembl Sea Lamprey
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 304.294 bits (778), Expect = 2.271e-90
Identity = 131/300 (43.67%), Postives = 205/300 (68.33%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+ FD+IR + YRTACKLR++Q++  L L+D+  ++E+FR+ GL  +++   +   ++E +IA +Y QL+ RLP   Q+H   + +SI +L+ ++L +Y+  G G+++V  +KVAL+T+  GK +DK +Y F+ ++D +G ++  +F+QYLH++L L   VFEGP+F Y  QA++     + K + +  FL+ +++DP PQ L+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH Y LCQDCFW G  +  HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MADRRQLFLEMRAQNFDAIRLSTYRTACKLRFVQKKCNLHLVDIWNMIEAFRENGLNALDAGAEVSVARLENLIASVYYQLNKRLPTTHQIH---VEQSINLLLNFMLAAYNGEGCGKMTVFGVKVALATMCGGKVVDKLRYIFSQISDSNGVMVLNKFDQYLHEVLKLPTAVFEGPSFGYTEQAARSCFPHQQKKVTLNVFLDALMSDPPPQILIWLPLMHRLANVENVFHPVECSFCHSESMLGFRYRCQQCHSYQLCQDCFWRGQASSTHSNQHQMKEYT-SWKSPAKKLTRALSKS 307          

HSP 2 Score: 83.9593 bits (206), Expect = 1.118e-16
Identity = 73/208 (35.10%), Postives = 102/208 (49.04%), Query Frame = 2
Query: 1496 DDEHRLIARYASTLVSSRST--HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQ-TNSALYSTKSRSMNQ---------AANTISTFSRQSGLTGV 2083
            D+EHRLIARYA+ L +  ST  H+    P              E+   SD        + K Q++LIA+LE KN+  + +  +    + + AS  +   D+               NP LL EL+ LR RKDELE RM++LQESR ELM QLE LM++L      Q T S+  S+ S +M +         +A +  T + Q  LTGV
Sbjct:  425 DEEHRLIARYAARLAAEASTTVHTVHRTP-------------TELAFNSD--------TNKQQRQLIAELENKNR-EIMQEIQRLRLEHEQASQTSPEKDQ--------------QNPTLLAELKLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQATQSSPRSSPSHTMARPMPMPIRSTSAGSTPTHTPQDSLTGV 596          
BLAST of Dystrobrevin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002801.1 (pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1 gene:ENSPMAG00000002555.1 transcript:ENSPMAT00000002801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 1.517e-33
Identity = 83/282 (29.43%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  275 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLI--PESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHS 1099
             +++RF+AYRTA KLR +Q+   L L+ +  +   F Q+GL   ++   +D ++    +  +Y  L  +       H +L+  P  ++M + WLL  YDT   G++  ++ K  L +L++    DK+++ F  +   SG     R    LHD + +      V  F G N   + ++      GR + I    FLE M  +P  Q ++WL + HR+A  E  +H  +C  C    I+GFRY+  +  +Y++CQ CF++G T   H  ++ + EY +   SHS
Sbjct:   30 LNNVRFSAYRTAMKLRRLQKALCLDLVSLDALTNVFEQSGL--KQNDRLMDVSEAVGCLTTIYQGLERK-------HSDLVNLPLCVDMCLNWLLNVYDTGRGGKIRELSFKTGLVSLSNAHLEDKYRFLFKQVASVSGLCDQRRLGLMLHDAVQIPRQLGEVASFGGSNIEPSVRSCFQFANGRPE-IEATMFLEWMRMEP--QSMVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLSYPMVEYCTPVSSHS 299          
BLAST of Dystrobrevin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004878.1 (pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 gene:ENSPMAG00000004410.1 transcript:ENSPMAT00000004878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 1.034e-26
Identity = 86/290 (29.66%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  275 FDSIRFAAYRTACKLRYIQQ---RTR-----------LILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFK-YHFTLLTDPSGALIPTR-FEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTS 1081
             +S+RF+AYRTA KLR +Q+   RTR           L   D + +    R  G            T++  ++A+LY  L +    G        P   +M + WLL  YD S TG++  ++LKV L  L+     +K+K Y F  ++ P G     R     L + + +      V  F G N    S  S F        + +  FLE M  +P  Q L+WL + HR+A  E  +H  +C  C    I+GFRY+  +  +Y++CQ CF++G T   H   + + EY +
Sbjct:   28 LNSVRFSAYRTAMKLRRLQKALCRTRHQPEMSTIPMGLDCHDEQSMSPHERLVG-----------ATEVGRLLAELYGGLES----GQGQRLVAAPLCTDMALNWLLNVYDPSRTGKIRSLSLKVGLICLSKAPLEEKYKLYIFRQVSGPGGGGCDQRQLGLLLQEAIQIPRQLGEVASFGGSNIE-PSVRSCFKFANSRDMVEVGRFLEWMKLEP--QSLVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDICQSCFFSGRTAKGHKLHYPMVEYCT 299          
BLAST of Dystrobrevin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010595.1 (pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 gene:ENSPMAG00000009594.1 transcript:ENSPMAT00000010595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 3.197e-19
Identity = 78/291 (26.80%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  248 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPE-SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFT------LLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRS-----KAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSS 1084
            L+  +  +Q + IR+A YRTA KL  +Q+   L L+ V  ++  F  +    ++    L+  Q+  ++ +++   S   P      P++  E + E+ +  LL   D+  +G++S  ++  AL  L++G+   K++          +L   +   IP     Y   LL L   + EG  F     A   +    S      +I   +FL   L++P  Q  LWL   +R+       H  +C  C    I+G R++C RC + +LCQ+CF TG  TG H+ +H V E  +S
Sbjct:    4 LLRLVLTEQLNVIRYAVYRTAAKLLALQKLCCLHLVSVSTILTVFNSSA---VDWESELNVRQVYQLLRKVHGMASREQPM-----PHVDGELASELTLNLLLAICDSERSGKVSPRSMWNALLLLSTGQLTHKYRGGVVCLCFARILPHCNAIGIPCN-NIYASQLLAL---LGEGCAFGTAEMAVTSLFHAVSYHSDIPSITESQFLGWCLSEP--QLFLWLPAMYRMMKAAGSIHEAKCNICKTCPIVGLRFRCLRCWNLDLCQNCFLTGRDTGWHAPSHPVIESCTS 280          
BLAST of Dystrobrevin vs. Ensembl Nematostella
Match: EDO47831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKW6])

HSP 1 Score: 280.796 bits (717), Expect = 2.969e-82
Identity = 201/662 (30.36%), Postives = 320/662 (48.34%), Query Frame = 2
Query:  275 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFIL-----VGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSK----DYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYH---------DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHG--YGSPMTT---HRSLSYTADS 2191
            FD+IRFA+YRTA KL++IQ++T L L+DV  ++E+FR+ GL  ++ +  L   ++E +++ ++  L+ RLP    +    +  SI ++  WLLY+YD+   GR+ V+++K ALS++  G+ +DK +YHF+ + D +G L   +FE YL +LL L   V E P F +    +         + R +  ++  FLE ++    P    WL+   ++ N     H V C+ C  + ++GFRYKC  C++Y LCQDCFW G  + +H   HD++EY++ +       G +LR  +       +  +GK  +    D+ +    SR +D    +   P+  + P     N  S         +  SP+   + ++ + N + +S        C N++ +G W             W  + +         DDEH+LI+RYA+ LV    T S    P TS S+ + DA                    K Q+ELI  LE KN+ +L                +    D+ + A  + S   +  NP LL EL+ LR RKDELE RM++LQESR ELM QLE LM +L   + S     + ++ +  +   A+T      Q+  T ++P SS L    G   +  G   GSP  T    + L   ADS
Sbjct:    3 FDTIRFASYRTAAKLQFIQKKTNLHLVDVYNMIEAFRENGLNTLDHNTELHELRLEAIVSSIFYALNKRLPTTHNVD---VERSISLVTNWLLYAYDSDAIGRIRVLSVKTALSSMCYGRLVDKLRYHFSQIEDNNGMLNFPKFEAYLRELLQLPASVGEAPTFGFTEDVASIFFKPQGPLDRQRTQLVH-FLECVMNKEPPPPYAWLSTLQKMNNAAKTEHQVACQVCKNKPVVGFRYKCLHCYNYVLCQDCFWRGKVSQHHKTDHDMREYSTWNAGEK---GSSLRSKF-------LCGSGKKKRPSLPDFPREPEPSRTLDMTNIVPPLPSDLSGP----NNATS--------DYVTSPSPESVVSNVSSNPTKLSD----EVTCVNLS-SGFW------------CWIFYLYYLILFSCRMDDEHKLISRYAARLVRVHKTFS----PATSSSELSIDA-------------------NKEQRELIQTLENKNRLLL--------------KEIRRLRDEHDEA--SKSAAQLAQNPELLAELKLLRQRKDELELRMSALQESRRELMVQLEGLMNLLKVIARSPKAQHIAASPAPGLFSKAST-----PQTPGTPMSPDSSKLSGVDGDIKQAFGDQAGSPSLTRNLRQDLLLAADS 577          
BLAST of Dystrobrevin vs. Ensembl Nematostella
Match: EDO41097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C8])

HSP 1 Score: 159.458 bits (402), Expect = 8.322e-40
Identity = 150/585 (25.64%), Postives = 247/585 (42.22%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVL-----AVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYST 2011
            + + I+++AYRTA KLR IQ+ T+L L+ +  +  +F Q  L     + N     +  M+  L+T   N     D ++P +   +I++ + WLL  YD+   G++ +++ K+ L  L      DK+ Y F L+ D  G +   +    LHD L +      +  F G N    S  S F      + I   +F+  + A+P  Q ++WL   HRLA  E V+H  +C  C    I+GFR++C +C +Y+LCQ CFW+G  +  H  TH V +Y  S+ S                        G+  KD+    S  RN    ++  K P  +    LP +  +      + G   A P+   MT  QNVN    +++    +  +   + G      K++ +P         D+EH+LIA+Y  +L +              +S D  +   +E                      I KLE +N+             Q     + +  D  +S+  + S      +  LL E + LR  K  LE RM  L++   +L  QL+ L ++L+     +T S  Y T
Sbjct:  351 ELNDIKYSAYRTAMKLRCIQKATKLDLVTLNNLSSAFVQHNL---SKARNDALIGVAEMVDTLHTVFDNIEVGFDNVNPAI---NIDLTLNWLLNVYDSGRVGKIRLLSFKIGLVCLCRAHLDDKYNYLFKLVADNDGKMDHKQLGLLLHDSLQVPRQLGEIAAFGGSNIE-PSVRSCFEKAREKERIDPTQFVYWLSAEP--QSIVWLPTLHRLAASEAVKHKAKCSICKEYPIVGFRFRCLKCFNYDLCQSCFWSGRISHEHRLTHPVHQYCLSTTS------------------------GEDVKDF---LSMVRNKFKARKYKKNPPKKLG-YLPIQTVM------EGGNLEAPPS---MTPQQNVNNEVHNRLGMFANRLAEAESDGG-----KYSPKPM--------DEEHQLIAQYCQSLKNVCFVSQPRSPTQIVMSLDANEKDDLESE--------------------IGKLEDENR----------YPLQSEYERLKSMRDADHSSDGDLSTGSQSRDTELLTEAKLLRQHKGRLEARMQVLEDHNRQLEAQLQRLRQLLD---QVRTGSLWYHT 843          
BLAST of Dystrobrevin vs. Ensembl Nematostella
Match: EDO45067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ0])

HSP 1 Score: 139.043 bits (349), Expect = 5.109e-36
Identity = 87/304 (28.62%), Postives = 148/304 (48.68%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDV---------RGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASK----FILVGRSKAIVIE-----EFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            + ++I++AAYRTA KLR I ++T+L L+++           V + + +  L + E+S        +++ A    Q  +R    D      IP + ++ +  +L  YD   TG +  ++LK+ +S L + K  DK++Y F  + +    L   R   +L + L +   ++E   F+  S        F  V  +  + +E      F+E M+A+P  Q ++WL   HRLA  E V+H  +C  C    I+GFRY+C +C +++LCQ CFW G  +  H   H  +EY    S K   + F   +R
Sbjct:   22 ELNNIKYAAYRTAMKLRAIHKKTQLYLVEIPILTATLDEEDVPDGYTEKALSIPEAS--------KIITALFINQNGDRQDFID------IPMASDLTLNLMLNIYDPGRTGYIQALSLKIGISLLCAAKLQDKYRYLFRQMCNSRAVLDRKRLTLFLQECLQIPKYIYESTIFSGTSVEPAVKNCFETVSFTYTLEVELQKFKSFMEWMVAEP--QTIVWLPTLHRLAVSETVKHEAKCNICKMYPIVGFRYRCLKCFNFDLCQGCFWAGRVSKGHKIGHPTQEYCLAPSQKEDIKDFAKVMR 309          
BLAST of Dystrobrevin vs. Ensembl Nematostella
Match: EDO29437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3M8])

HSP 1 Score: 58.9214 bits (141), Expect = 9.415e-10
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  272 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLL 730
            + ++I++AAYRTA KLR I ++T+L L+++  +  +  +  +    +   L   +   +I  L+   +     GD+     IP + ++ +  +L  YD   TG +  ++LK+ +S L + K  DK++Y F  + +    L   R   +L + L
Sbjct:   48 ELNNIKYAAYRTAMKLRAIHKKTQLYLVEIPILTATLDEEDVPDGYTEKALSIPEASKIITALFINQN-----GDRQDFIDIPMASDLTLNLMLNIYDPGRTGYIQALSLKIGISLLCAAKLQDKYRYLFRQMCNSRAVLDRKRLTLFLQECL 195          
BLAST of Dystrobrevin vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 300.442 bits (768), Expect = 1.601e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   12 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 2.272e-14
Identity = 75/196 (38.27%), Postives = 97/196 (49.49%), Query Frame = 2
Query: 1568 DMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSA-------------------KSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            DMP   ++  +   P+        LF+ +MPTS                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  322 DMPEKPLNLAHIVPPRPVNIANEYLFSHSMPTSGNPYSTKKVPMDLPCSLDANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKTQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 502          
BLAST of Dystrobrevin vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.212 bits (770), Expect = 2.910e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 69.3218 bits (168), Expect = 2.027e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 2
Query: 1490 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            + D+EH LIARYA+ L S  +       +D+P +       DA                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  376 HQDEEHSLIARYAARLASDAAAQQQRVPMDLPCS------LDA-------------------NKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 549          
BLAST of Dystrobrevin vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 300.827 bits (769), Expect = 8.136e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 68.9366 bits (167), Expect = 2.488e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 2
Query: 1490 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            + D+EH LIARYA+ L S  +       +D+P +       DA                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  408 HQDEEHSLIARYAARLASDAAAQQQRVPMDLPCS------LDA-------------------NKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 581          
BLAST of Dystrobrevin vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.212 bits (770), Expect = 8.309e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   12 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 306          

HSP 2 Score: 69.3218 bits (168), Expect = 2.113e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 2
Query: 1490 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            + D+EH LIARYA+ L S  +       +D+P    S D                      + K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  425 HQDEEHSLIARYAARLASDAAAQQQRVPMDLP---CSLD----------------------ANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 598          
BLAST of Dystrobrevin vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 300.827 bits (769), Expect = 1.112e-87
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 2
Query:  230 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1129
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 76.6406 bits (187), Expect = 1.157e-13
Identity = 80/206 (38.83%), Postives = 103/206 (50.00%), Query Frame = 2
Query: 1490 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2083
            + D+EH LIARYA+ L S  +       +D+P    S D                      + K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  431 HQDEEHSLIARYAARLASDAAAQQQRVPMDLP---CSLD----------------------ANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKTQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 596          
BLAST of Dystrobrevin vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 1576.61 bits (4081), Expect = 0.000e+0
Identity = 771/772 (99.87%), Postives = 772/772 (100.00%), Query Frame = 2
Query:  182 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVR 2497
            MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLV+
Sbjct:    1 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVK 772          

HSP 2 Score: 337.421 bits (864), Expect = 4.865e-108
Identity = 187/188 (99.47%), Postives = 187/188 (99.47%), Query Frame = 3
Query: 2652 GKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAXXXXXXHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKIXXXXXXXXXXXXXXRHKWDNSN 3215
             KKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN
Sbjct:  825 AKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN 1012          

HSP 3 Score: 75.485 bits (184), Expect = 4.865e-108
Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
Query: 2491 CKELQPSANNKXXXXXXXXXXXXXXXXXXXRMNHNYHFNEYESEYERALDDCGMAK 2658
             KELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAK
Sbjct:  771 VKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAK 826          
BLAST of Dystrobrevin vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 1363.21 bits (3527), Expect = 0.000e+0
Identity = 714/835 (85.51%), Postives = 729/835 (87.31%), Query Frame = 2
Query:  182 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHAL----------------RKSWDRQNN--------------STVACTGKSSKDYQQNQSQSRNVDN-------NQRMMKTPAG-----QASPCLPYRNTVSRIQA-------ADNGQFRASPNQTMMTT------DQN--------VNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVR 2497
            MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHAL                + S D Q N               T A        Y+   S+ +  DN       NQ MM T        + +  L + +    + A       A N    +S +Q ++ T      D+N        VNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLV+
Sbjct:    1 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNFTGNEKWNKMLLFSHQQHSLDASTKTLNDASNAGLMSSNSQPLIMTQAVNKIDRNFNTASPSSVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVK 835          

HSP 2 Score: 337.806 bits (865), Expect = 3.291e-108
Identity = 187/188 (99.47%), Postives = 187/188 (99.47%), Query Frame = 3
Query: 2652 GKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAXXXXXXHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKIXXXXXXXXXXXXXXRHKWDNSN 3215
             KKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN
Sbjct:  888 AKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN 1075          

HSP 3 Score: 75.8702 bits (185), Expect = 3.291e-108
Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 1
Query: 2491 CKELQPSANNKXXXXXXXXXXXXXXXXXXXRMNHNYHFNEYESEYERALDDCGMAK 2658
             KELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAK
Sbjct:  834 VKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAK 889          
BLAST of Dystrobrevin vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 116.316 bits (290), Expect = 1.222e-25
Identity = 59/208 (28.37%), Postives = 110/208 (52.88%), Query Frame = 2
Query:  527 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILV-------GRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F  ++     I         G  + I +  FL  +  +P  Q L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct: 3366 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNSPESGNHRFIRLSNFLAWLRLEP--QSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 3571          
BLAST of Dystrobrevin vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 103.219 bits (256), Expect = 9.964e-22
Identity = 60/246 (24.39%), Postives = 112/246 (45.53%), Query Frame = 2
Query:  527 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFA-----------YNSQASKFIL----------------------------------VGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1123
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F            + +   KF+                                    G  + I +  FL  +  +P  Q L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct: 3358 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRKKNSNSENSNEKSPESGNHRFIRLSNFLAWLRLEP--QSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 3601          
The following BLAST results are available for this feature:
BLAST of Dystrobrevin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DTNB4.850e-10133.33dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
DTNB1.156e-10030.88dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
DTNB5.389e-10032.06dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
DTNB7.446e-10035.69dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
DTNB2.451e-8431.84dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyb-12.891e-7633.79Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
dyb-11.332e-5831.39Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
dys-15.295e-2729.87Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-16.610e-2729.87Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-17.185e-2729.87Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyb7.275e-10335.21gene:FBgn0033739 transcript:FBtr0087929[more]
Dyb9.390e-10335.21gene:FBgn0033739 transcript:FBtr0087930[more]
Dyb1.889e-10235.21gene:FBgn0033739 transcript:FBtr0100298[more]
Dyb3.383e-10235.21gene:FBgn0033739 transcript:FBtr0305077[more]
Dyb4.085e-10235.21gene:FBgn0033739 transcript:FBtr0308613[more]
back to top
BLAST of Dystrobrevin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtna9.584e-9934.51dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtna2.182e-9734.83dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtna2.182e-9734.83dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtnba5.834e-9433.62dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
dtnbb3.735e-8341.67dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtna3.076e-10433.54dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna8.377e-10433.54dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna4.529e-10133.18dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna5.358e-10133.18dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna1.088e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
back to top
BLAST of Dystrobrevin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dtnb3.296e-9835.30dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb3.330e-9835.30dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb6.953e-8442.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb7.115e-8442.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb1.768e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
back to top
BLAST of Dystrobrevin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60941|DTNB_HUMAN2.588e-9932.06Dystrobrevin beta OS=Homo sapiens OX=9606 GN=DTNB ... [more]
sp|P84060|DTNB_RAT1.525e-9734.98Dystrobrevin beta OS=Rattus norvegicus OX=10116 GN... [more]
sp|O70585|DTNB_MOUSE6.853e-8242.67Dystrobrevin beta OS=Mus musculus OX=10090 GN=Dtnb... [more]
sp|Q9Y4J8|DTNA_HUMAN2.221e-8143.33Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA... [more]
sp|Q9D2N4|DTNA_MOUSE3.231e-8143.33Dystrobrevin alpha OS=Mus musculus OX=10090 GN=Dtn... [more]
back to top
BLAST of Dystrobrevin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LEN93.224e-11960.45ZZ-type domain-containing protein OS=Opisthorchis ... [more]
A0A3R7EUH41.077e-11860.13Dystrobrevin beta OS=Clonorchis sinensis OX=79923 ... [more]
A0A0X3NGC79.505e-11858.13Dystrobrevin-1 OS=Schistocephalus solidus OX=70667... [more]
A0A0X3NXD54.910e-11758.13Dystrobrevin-1 OS=Schistocephalus solidus OX=70667... [more]
A0A4E0RH392.040e-11460.66Dystrobrevin beta OS=Fasciola hepatica OX=6192 GN=... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtnba7.151e-9931.83dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
dtna2.217e-9434.65dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtnbb1.706e-8241.89dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070... [more]
dtna4.438e-8142.67dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
drp29.604e-3329.49dystrophin related protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dtnba2.271e-9043.67dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
ENSPMAT00000002801.11.517e-3329.43pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1... [more]
ENSPMAT00000004878.11.034e-2629.66pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 ge... [more]
ENSPMAT00000010595.13.197e-1926.80pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 ... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dystrobrevin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO478312.969e-8230.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410978.322e-4025.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450675.109e-3628.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294379.415e-1025.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dystrobrevin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtna1.601e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna2.910e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna8.136e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna8.309e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna1.112e-8744.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
back to top
BLAST of Dystrobrevin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000078318.14.865e-10899.87SMESG000078318.1[more]
SMESG000078318.13.291e-10885.51SMESG000078318.1[more]
SMESG000020523.11.222e-2528.37SMESG000020523.1[more]
SMESG000020523.19.964e-2224.39SMESG000020523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007670 ID=SMED30007670|Name=Dystrobrevin|organism=Schmidtea mediterranea sexual|type=transcript|length=3681bp
ATTTAATTAAAATCAGCGAGAATTAAACCATTTATAAACGTGTATAAATT
TTACTTTTCCGGAATTGTGGAATGAAATTATTTTCAGAATCAGATATAAA
TTTTAGCGAATAGTATTTTTTCAAGAATAAAACTGAATCTTTTCCGCGGC
GCAAAAACCATTATATTGTCCATTATTTGCAATGAACACTTTGTCGAAAA
CACAAAATAAAGTCACTCAACAAATTGGAATGGCAGGTTTCAAGCGCCTA
ATTAATGAAATGAAAGCCAAACAATTTGACTCGATCCGATTCGCAGCGTA
TAGAACCGCATGCAAATTGAGATACATTCAACAGAGGACAAGATTAATTC
TAATGGATGTCAGGGGTGTGGTAGAGTCGTTTCGTCAAACAGGACTTTAC
CTTATGGAATCCAGCTGCAATCTCGACAGAACTCAAATAGAAATGATGAT
AGCTCAATTATATACCCAATTATCAAACAGATTACCAGCCGGTGACCAGT
TACATCCGAATCTTATTCCAGAATCTATAGAAATGCTAATGGGTTGGTTG
CTCTATAGTTATGACACATCCGGAACTGGTCGATTATCAGTAATGGCATT
GAAAGTAGCTTTATCAACTTTAGCTTCAGGAAAACCAATGGATAAATTTA
AATATCATTTCACACTATTAACTGATCCATCTGGAGCTCTGATCCCAACG
CGATTCGAACAATATCTTCACGATTTACTAGTTTTGGCTGTGGGTGTATT
TGAAGGACCAAATTTTGCTTACAATTCTCAAGCTTCAAAATTTATTCTTG
TTGGAAGATCAAAAGCTATCGTAATTGAAGAATTTCTTGAAAAAATGTTA
GCTGATCCCGGTCCCCAATGTTTACTGTGGTTGACAATTTTCCATAGATT
AGCAAACATTGAAAACGTGCGTCACAATGTTCGATGTGAAGGGTGTCACA
GGGAAGTGATTATTGGATTCAGATACAAATGCCAGAGGTGCCATCATTAT
AATTTATGCCAAGATTGTTTCTGGACAGGAGTGACTACTGGCAATCATAG
CAACACTCATGATGTCAAAGAATACACGTCTTCTTCAAAGTCTCATTCGC
GTCAATTTGGTCACGCGCTTCGTAAATCATGGGATAGACAAAACAATTCC
ACAGTAGCATGTACTGGAAAATCATCAAAAGATTACCAACAAAACCAGTC
ACAATCAAGGAATGTTGACAATAATCAACGAATGATGAAAACCCCTGCAG
GTCAGGCTAGTCCATGTCTACCATATAGAAATACAGTATCCCGAATCCAA
GCGGCCGATAATGGTCAATTTAGAGCTTCTCCAAATCAAACAATGATGAC
CACGGACCAAAATGTTAACTTTTCCGGTGTTAGTCAAATTCCTTCAATGA
ATCACGCATGTAGTAACGTTACAAATACCGGAAATTGGGATTCATCCCTG
AAGCATACTAATCAGCCTTCAAAAGACTGGCGTCAGTTCTATCATGATGA
CGAACACAGGCTGATCGCTCGTTATGCAAGCACTTTGGTCTCTAGTCGTT
CTACTCATTCCGGCCTTGATATGCCTCACACTTCTATCAGTCAAGATAAT
ACAGATGCTCCGAAAATTGAGGTCCATTTAAGATCAGATTTATTCAATCA
AAATATGCCTACGTCCGCCAAATCGCAGAAAGAACTTATCGCAAAATTGG
AAGCTAAAAATAAAGAAATTTTACGTGAAATCCAAAGACTGCGGCTTGAG
CAACAACAAAACGCATCTGCTGTAAATGCTGCAACGGATAAAACCAACAG
TGCAATCAACAATGATTCCGTCACCGGAATTGTAAATAATCCCAATTTAC
TGGTGGAGTTAAGGAATCTCAGACACAGGAAAGATGAGTTGGAAAACCGT
ATGACAAGTTTACAGGAAAGTCGATTGGAACTGATGCAACAATTGGAATC
ATTAATGAGAGTTCTTAATACCAGTTCAAGTAGTCAAACAAATTCTGCTC
TTTATAGTACTAAATCAAGATCTATGAATCAGGCTGCAAATACAATATCA
ACATTCAGTAGGCAGTCGGGGCTGACAGGTGTGACCCCATTGAGTAGTTT
ACTTCCATCAAATTCTGGCCAGCCATTAAAGCTTCATGGTTATGGCTCAC
CGATGACTACTCACAGATCCCTCAGTTATACTGCAGATAGTAATAGATCA
GTAACAATGGGTCCGCATTCAATTTTACCCCAACCCCGATTTAACACACT
CACTCGTCATTCCAGAACATTTTCAGCAGATGAAGGATTAGGCGGATTCG
CTTCTCAACCGAGAAGAACTTTCACTTCTGGGAATCGTACTCTAGAATCG
TTGGGTGTTGATACAACAGATTATTATTTAAAACAATCATCAGATAAAGC
TAAACAAAATAATTCACTTTCCAAAGAAATGGATTTGAGACAAAATTTAT
TAATGGCAGCCGACAATGTCACAAATGCCATGACTGGTCTTGTAAGGAAC
TCCAACCTTCTGCCAATAACAAACAGACTTTCAGCCAAAATTCATCGCCA
ACGTCTACGTCACAGCCCAACAATCAAAATAGAATGAATCATAATTATCA
TTTCAATGAATATGAATCCGAATACGAAAGAGCTCTAGATGACTGTGGAA
TGGCAAAAAATCTTCCACTGCTCCACAAAATCTTAATTCTGCAACTGTTT
TTGCAAATAGTAGAATATCTAGTAGAATTTTATCTGAACAGCGATTTTTA
AACGAATTGCGTGCCAGACGGCAAAATAATACACTCGGGCGAGGCAGTAA
TGATCAAAATGACTACAATAATCACAATTTACAAAATGACAGCCCTCCAG
GTCCTGCTCCGAAATTGCAGGAATCGTCTGTAAATAAAGGCGTAAGAATT
GCTCCTCCACCTCTGCCACCTCATAGAACTAGACCTCAAGGTGAACTTCG
AACAAATAGCAATGGAACACTTTGTAATTATGGAGAATCAGATTCAGAAG
CATATTTATATTCGGATCCTGAATGCAGTTTATTGAGACTTAATGAAGAT
GAAATGGGTCCAGCTATGTCTTTAGGTAGAGGCAGAGAAAAAAGTATACC
CATGGAAAACGAAAAGTTGTATGATATACATAGCCTACATCAAAAAATAA
ATTCATTAAACAATGGTGACTTAGACCAAGATTTAGACAACCGCCATAAA
TGGGATAATTCTAACTGACAAATTGGGATGTAGGCTCGGAATCCATGGAC
TCGAATACAAAATCATGTTTCAATTCATGTTAATTCATCAATTTATCATG
ATATTTTAACTATTTCATGCGAAAACTCTCGATTGATGTTTATTTTATAA
AAATCATTTCCAGACATTTTAGTGAAAAGATAAAAATTGTAAATGTTTAA
TCGTAGTTGTTTTAGTCTTAAATTTTTATATAAATTCACAGATTTTTAAA
TTAGCTCGATTTTATTGAATTGTGTTTTTTTGTTGAAAGATAATTAACGT
TTTTGAAATTTACTGTAAATCTTTTTTAAAAGAGCACATCTGAATTTTAT
TGTGGTTTTGTAGATAATATATAGATTATTGCAAAAATAATATATTAAAA
CCTTTGAGAAAATGTTTATTTTATTTTGTTTACGTGGATTATTTATATTT
TTTCAATGTATAATTTTATTGTTTAATTTAG
back to top

protein sequence of SMED30007670-orf-1

>SMED30007670-orf-1 ID=SMED30007670-orf-1|Name=SMED30007670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=802bp
MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQ
QRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNR
LPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASG
KPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQ
ASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNV
RCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTS
SSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQR
MMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSGV
SQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYAS
TLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQK
ELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGI
VNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSS
SQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLK
LHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSAD
EGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEM
DLRQNLLMAADNVTNAMTGLVRNSNLLPITNRLSAKIHRQRLRHSPTIKI
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043145Znf_ZZ_sf
IPR000433Znf_ZZ
IPR015154EF-hand_dom_typ2
IPR011992EF-hand-dom_pair
IPR015153EF-hand_dom_typ1
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 496..523
NoneNo IPR availableCOILSCoilCoilcoord: 553..587
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 55..151
e-value: 2.9E-8
score: 35.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 779..802
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..350
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 16..612
NoneNo IPR availablePANTHERPTHR12268:SF19DYSTROBREVIN ALPHAcoord: 16..612
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 227..300
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 246..291
e-value: 4.5E-15
score: 66.1
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 247..289
e-value: 3.1E-11
score: 42.9
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 246..293
score: 14.03
IPR015154EF-hand domain, type 2PFAMPF09069EF-hand_3coord: 154..241
e-value: 8.1E-15
score: 55.0
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 241..301
e-value: 1.8E-22
score: 80.6
IPR015153EF-hand domain, type 1PFAMPF09068EF-hand_2coord: 22..147
e-value: 3.9E-26
score: 91.6
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 152..245
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 30..149