SMED30007649

Overview
NameSMED30007649
Smed IDSMED30007649
Length (bp)802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007649 (SMED30007649) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007649 (SMED30007649) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007649 (SMED30007649) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007649 (SMED30007649) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007649

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007649SMESG000048765.1 SmedASXL_012178SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007649SMESG000048765.1 dd_Smed_v4_14165_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007649SMESG000048765.1 dd_Smed_v4_14165_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007649SMESG000048765.1 dd_Smed_v6_14165_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30007649SMESG000048765.1 OX_Smed_1.0.02715ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30007649SMESG000048765.1 dd_Smed_v4_14165_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007649 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008251:9768..20680 -3966
Homology
BLAST of SMED30007649 vs. Ensembl Human
Match: C1QTNF3 (C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC:14326])

HSP 1 Score: 60.4622 bits (145), Expect = 5.491e-10
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWA--TSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S        TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  190 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 317          
BLAST of SMED30007649 vs. Ensembl Human
Match: C1QTNF3 (C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC:14326])

HSP 1 Score: 59.3066 bits (142), Expect = 7.286e-10
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWA--TSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S        TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  117 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 244          
BLAST of SMED30007649 vs. Ensembl Human
Match: C1QTNF3-AMACR (C1QTNF3-AMACR readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:49198])

HSP 1 Score: 59.6918 bits (143), Expect = 8.366e-10
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWA--TSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S        TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  101 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 228          
BLAST of SMED30007649 vs. Ensembl Xenopus
Match: ENSXETT00000022692.1 (C1q and TNF related 3 [Source:NCBI gene;Acc:100490044])

HSP 1 Score: 55.4546 bits (132), Expect = 1.496e-8
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWS--SSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            ++AF A +  +  N    N  +IF  + TN GN ++  TG F+A VTG+Y FT  +      +   V L+HN   I+ ++S  +     TS + ++L++ K+D+VWL+    A  LHG    Y TF G+LLFE
Sbjct:  115 QVAFMASMATHFSN---INSGIIFSSVETNVGNFFDVMTGRFSAPVTGIYFFTFHMLKHEEVEDVYVYLMHNGNTIVSMYSYETKGKQDTSGNSAVLKLAKEDEVWLRMGTGA--LHGDHQRYCTFCGFLLFE 242          
BLAST of SMED30007649 vs. Ensembl Mouse
Match: C1qtnf3 (C1q and tumor necrosis factor related protein 3 [Source:MGI Symbol;Acc:MGI:1932136])

HSP 1 Score: 60.077 bits (144), Expect = 4.219e-10
Identity = 48/133 (36.09%), Postives = 76/133 (57.14%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWS--SSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S  +     TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  190 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 317          
BLAST of SMED30007649 vs. Ensembl Mouse
Match: C1qtnf3 (C1q and tumor necrosis factor related protein 3 [Source:MGI Symbol;Acc:MGI:1932136])

HSP 1 Score: 59.3066 bits (142), Expect = 5.099e-10
Identity = 48/133 (36.09%), Postives = 76/133 (57.14%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWS--SSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S  +     TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  117 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 244          
BLAST of SMED30007649 vs. UniProt/SwissProt
Match: sp|Q9BXJ4|C1QT3_HUMAN (Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.499e-9
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWA--TSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S        TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  117 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 244          
BLAST of SMED30007649 vs. UniProt/SwissProt
Match: sp|Q9ES30|C1QT3_MOUSE (Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.567e-9
Identity = 48/133 (36.09%), Postives = 76/133 (57.14%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWS--SSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            +IAF A L  +  N+   N  +IF  + TN GN ++  TG F A V+GVY FT ++      ++  V L+HN   +  ++S  +     TS++ ++L++ K D+VWL+    A  LHG    +STF+G+LLFE
Sbjct:  117 QIAFMASLATHFSNQ---NSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGA--LHGDHQRFSTFAGFLLFE 244          
BLAST of SMED30007649 vs. TrEMBL
Match: A0A068WPA8 (Complement C1q tumor necrosis factor OS=Echinococcus granulosus OX=6210 GN=EgrG_000111700 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.639e-43
Identity = 104/224 (46.43%), Postives = 133/224 (59.38%), Query Frame = -1
Query:   59 SNSVLERCELQLEC--------TQEGSEK----NKIRLPIRNAQGPQGPRGHQXXXXXXXXXXXXXXXGETTVVKQTDRKKLKK------------IAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFE 658
            S + L  C LQ+EC        T   SE      KIR+P+R A+GPQGPRG +G  GPRG PG      E  V +   +  + K            IAFF GL+ N+   P+     I   ++TN G  Y+   G+F A V GVY F V ISAQG  KQAAVRL+HN  HI D+WS S PW+T+T+Q+IL +K++D VWL+ RE A +LHGYMYSTF+G+LLFE
Sbjct:   44 SQTALTECHLQVECSAPQPSHMTANDSEPLGVVRKIRIPVRAARGPQGPRGLRGPAGPRGPPGFSPEINEDIVTRVMTQPSVMKEVVSHLQGRQHRIAFFTGLQPNIEEMPA-GQRAIMSHVVTNVGGAYDPQKGQFCAPVDGVYSFVVAISAQG-RKQAAVRLMHNNNHIFDVWSDSTPWSTATNQAILMMKRNDCVWLRLRESAFYLHGYMYSTFAGHLLFE 265          
BLAST of SMED30007649 vs. TrEMBL
Match: A0A087VYY3 (Complement C1q tumor necrosis factor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000111700 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.711e-43
Identity = 104/224 (46.43%), Postives = 133/224 (59.38%), Query Frame = -1
Query:   59 SNSVLERCELQLEC--------TQEGSEKN----KIRLPIRNAQGPQGPRGHQXXXXXXXXXXXXXXXGETTVVKQTDRKKLKK------------IAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFE 658
            S + L  C LQ+EC        T   SE +    KIR+P+R A+GPQGPRG +G  GPRG PG      E  V +   +  + K            IAFF GL+ N+   P      I   ++TN G  Y+   G+F A V GVY F V ISAQG  KQAAVRL+HN  HI D+WS S PW+T+T+Q+IL +K++D VWL+ RE A +LHGYMYSTF+G+LLFE
Sbjct:   44 SQTALTECHLQVECSAPQPSHLTANDSEPSGVVRKIRIPVRAARGPQGPRGLRGPAGPRGPPGFSPEINEDIVTRVMTQPSVMKEVVSHLQGRHHRIAFFTGLQPNIEEMP-PGQRAIMSHVVTNVGGAYDPQKGQFCAPVDGVYSFVVAISAQG-RKQAAVRLMHNNNHIFDVWSDSAPWSTATNQAILMMKRNDCVWLRLRESAFYLHGYMYSTFAGHLLFE 265          
BLAST of SMED30007649 vs. TrEMBL
Match: A0A5J4NF54 (C1q domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012621 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 8.223e-42
Identity = 105/223 (47.09%), Postives = 145/223 (65.02%), Query Frame = -1
Query:   59 VLERCELQLECTQEGSEK--------------NKIRLPIRNAQGPQGPRGHQXXXXXXXXXXXXXXXGETT-----------VVKQTDRKKLKKIAFFAGLKENVVNEPSK-NDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFE 649
            +L  C LQLECT     K              +++R+PI +A+GPQG RG  G  GPRG  GPPG   E T           +++Q ++ ++  +AFF GL+ N+V++P+  N  VI + ++TN G  Y+  TGEFTA V G+YV +V ISAQG +K AAVRL+HN++ I+D+WS S PW+T+++Q+IL + K D+ WL  RE AH+LHGYMYSTFSGYLLFE
Sbjct:   11 ILTNCRLQLECTSPTFPKQIQSPPNSPRYPKESRVRVPILSARGPQGVRGMPGPPGPRGVRGPPGQCTENTNFSFSQAQMHNLLRQINKLRMH-VAFFVGLEYNIVDKPTDLNPKVIMNRVITNVGQVYDAVTGEFTAPVDGIYVLSVAISAQGKSK-AAVRLMHNEQPILDLWSESSPWSTTSNQAILHMSKGDRAWLSIREGAHYLHGYMYSTFSGYLLFE 231          
BLAST of SMED30007649 vs. TrEMBL
Match: A0A2H1C419 (C1q domain protein OS=Fasciola hepatica OX=6192 GN=D915_10838 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.792e-39
Identity = 76/135 (56.30%), Postives = 103/135 (76.30%), Query Frame = -1
Query:   59 RKKLKKIAFFAGLKENVVNEP-SKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFE 460
            R +  ++AFFAGL+ N+V +P   N  V+ + ++TN G  Y+ +TGEF A V GVYV TV ISAQG A+ AAVRL+HN++ ++DIW+ S PW+T+T+Q IL+++K D+ WL  RE A+FLHGYMYSTFSGYLLFE
Sbjct:    4 RHRETRVAFFAGLELNIVEQPIDSNPRVLMNRVITNVGRAYHASTGEFIAPVQGVYVLTVAISAQGRAR-AAVRLMHNEQQVLDIWAESSPWSTATNQGILQMRKGDRAWLSIREGAYFLHGYMYSTFSGYLLFE 137          
BLAST of SMED30007649 vs. TrEMBL
Match: A0A4E0R4U7 (Complement C1q tumor necrosis factor protein OS=Fasciola hepatica OX=6192 GN=D915_007148 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.571e-39
Identity = 76/135 (56.30%), Postives = 103/135 (76.30%), Query Frame = -1
Query:   59 RKKLKKIAFFAGLKENVVNEP-SKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFE 460
            R +  ++AFFAGL+ N+V +P   N  V+ + ++TN G  Y+ +TGEF A V GVYV TV ISAQG A+ AAVRL+HN++ ++DIW+ S PW+T+T+Q IL+++K D+ WL  RE A+FLHGYMYSTFSGYLLFE
Sbjct:   21 RHRETRVAFFAGLELNIVEQPIDSNPRVLMNRVITNVGRAYHASTGEFIAPVQGVYVLTVAISAQGRAR-AAVRLMHNEQQVLDIWAESSPWSTATNQGILQMRKGDRAWLSIREGAYFLHGYMYSTFSGYLLFE 154          
BLAST of SMED30007649 vs. Ensembl Cavefish
Match: ENSAMXT00000039153.1 (cerebellin-2-like [Source:NCBI gene;Acc:103040140])

HSP 1 Score: 47.7506 bits (112), Expect = 3.778e-6
Identity = 29/88 (32.95%), Postives = 47/88 (53.41%), Query Frame = -1
Query:   62 ASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWS--SSYPWATSTSQSILEIKKDDKVWLQ-FREQAHFLHGYMYSTFSGYLLF 316
            A + GVY F  +I+  G       RL  N +H++  +    S+  +T+   S+L ++  D V++Q F +   F +G  Y+TFSG LLF
Sbjct:  162 APIRGVYTFRFSITGHGSDSSTGARLFKNGRHVVIAYCHQPSHVVSTTNGASLL-LEVGDVVYVQLFPKSQIFDNGNFYNTFSGQLLF 248          
BLAST of SMED30007649 vs. Ensembl Sea Lamprey
Match: C1QTNF3 (C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC:14326])

HSP 1 Score: 57.7658 bits (138), Expect = 3.452e-10
Identity = 45/133 (33.83%), Postives = 71/133 (53.38%), Query Frame = -1
Query:   59 KIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWA--TSTSQSILEIKKDDKVWLQFREQAHFLHG--YMYSTFSGYLLFE 445
            KIAF A +  +  N+   N  +IF  +  N GN ++  TG F A VTGVY FT  +      ++  V L+HN   ++ ++S        T+ + ++L +K+ D+VWL+       +HG    +STF G+LLFE
Sbjct:  124 KIAFMASMATHFTNQ---NSGIIFSSVEANLGNYFDIITGRFNAPVTGVYYFTFNMLKHEDVEETVVYLMHNGNTVITLFSYEVKGKHDTAGNSAVLRLKEGDEVWLRLGNGG--IHGDHQRFSTFCGFLLFE 251          
BLAST of SMED30007649 vs. Planmine SMEST
Match: SMESG000048765.1 (SMESG000048765.1)

HSP 1 Score: 352.829 bits (904), Expect = 4.334e-124
Identity = 225/226 (99.56%), Postives = 225/226 (99.56%), Query Frame = -1
Query:   53 MDSHGXXXXXXXXXXXXXXXSDSQSNSVLERCELQLECTQEGSEKNKIRLPIRNAQGPQGPRGHQXXXXXXXXXXXXXXXGETTVVKQTDRKKLKKIAFFAGLKENVVNEPSKNDYVIFDGLMXXXXXXXXXXXXXXTASVTGVYVFTVTISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFELP 730
            MDSHGIFILSIFSLLFHIILSDSQSNSVLERCELQLECTQEGSEKNKIRLPIRNAQGPQGPRGHQGLQGPRGYPGPPGPPGETTVVKQTDRKKLKKIAFFAGLKENVVNEPSKNDYVIFDGLMTNFGNTYNNNTGEFTASVTGVYVFTVTISAQGGAK AAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFELP
Sbjct:    1 MDSHGIFILSIFSLLFHIILSDSQSNSVLERCELQLECTQEGSEKNKIRLPIRNAQGPQGPRGHQGLQGPRGYPGPPGPPGETTVVKQTDRKKLKKIAFFAGLKENVVNEPSKNDYVIFDGLMTNFGNTYNNNTGEFTASVTGVYVFTVTISAQGGAK-AAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWLQFREQAHFLHGYMYSTFSGYLLFELP 225          
The following BLAST results are available for this feature:
BLAST of SMED30007649 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C1QTNF35.491e-1036.09C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC... [more]
C1QTNF37.286e-1036.09C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC... [more]
C1QTNF3-AMACR8.366e-1036.09C1QTNF3-AMACR readthrough (NMD candidate) [Source:... [more]
back to top
BLAST of SMED30007649 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000022692.11.496e-835.34C1q and TNF related 3 [Source:NCBI gene;Acc:100490... [more]
back to top
BLAST of SMED30007649 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C1qtnf34.219e-1036.09C1q and tumor necrosis factor related protein 3 [S... [more]
C1qtnf35.099e-1036.09C1q and tumor necrosis factor related protein 3 [S... [more]
back to top
BLAST of SMED30007649 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9BXJ4|C1QT3_HUMAN3.499e-936.09Complement C1q tumor necrosis factor-related prote... [more]
sp|Q9ES30|C1QT3_MOUSE3.567e-936.09Complement C1q tumor necrosis factor-related prote... [more]
back to top
BLAST of SMED30007649 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WPA81.639e-4346.43Complement C1q tumor necrosis factor OS=Echinococc... [more]
A0A087VYY31.711e-4346.43Complement C1q tumor necrosis factor OS=Echinococc... [more]
A0A5J4NF548.223e-4247.09C1q domain-containing protein OS=Paragonimus weste... [more]
A0A2H1C4192.792e-3956.30C1q domain protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A4E0R4U73.571e-3956.30Complement C1q tumor necrosis factor protein OS=Fa... [more]
back to top
BLAST of SMED30007649 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000039153.13.778e-632.95cerebellin-2-like [Source:NCBI gene;Acc:103040140][more]
back to top
BLAST of SMED30007649 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C1QTNF33.452e-1033.83C1q and TNF related 3 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30007649 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007649 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000048765.14.334e-12499.56SMESG000048765.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007649 ID=SMED30007649|Name=SMED30007649|organism=Schmidtea mediterranea sexual|type=transcript|length=802bp
AAATATTATCAATTTATTCATAATTCGTAATTGATTTATTATTATATGAT
CATGGCAATTCAAACAACAAATACCCTGAAAAAGTGCTATACATGTAACC
ATGTAAGAAATGCGCTTGCTCCCTAAACTGGAGCCAGACTTTGTCATCTT
TCTTAATTTCCAAAATCGACTGACTCGTAGAGGTTGCCCATGGATAGCTG
GAACTCCAAATATCCATTATGTGTTTCTTATTGTGCAATAATCGAACTGC
TGCCTGTTTGGCTCCTCCCTGTGCTGATATCGTCACAGTGAATACATAGA
CCCCCGTGACAGAGGCTGTGAATTCCCCGGTGTTATTGTTGTAGGTGTTC
CCAAAATTTGTCATTAGTCCATCGAAGATCACGTAATCATTTTTCGATGG
CTCATTCACAACATTTTCTTTTAATCCAGCAAAAAATGCAATTTTTTTCA
ATTTTTTCCTGTCAGTCTGTTTTACCACGGTGGTTTCACCTGGGGGACCT
GGGGGACCAGGATACCCTCTTGGCCCTTGTAATCCCTGATGACCCCTAGG
ACCTTGTGGGCCTTGTGCATTACGAATTGGAAGACGAATTTTATTTTTTT
CCGATCCTTCTTGAGTACATTCTAGTTGTAATTCACATCTTTCCAGAACA
GAATTCGACTGAGAATCTGAAAGAATAATGTGAAAAAGTAGAGAGAAAAT
CGAAAGAATAAATATTCCATGGGAATCCATTATAAAATGATAACCAGTGA
TAAAAACAATAGTTTCCCTATAAATTCATCGACAGCCAATCAAAGACAGA
AG
back to top

protein sequence of SMED30007649-orf-1

>SMED30007649-orf-1 ID=SMED30007649-orf-1|Name=SMED30007649-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=227bp
MDSHGIFILSIFSLLFHIILSDSQSNSVLERCELQLECTQEGSEKNKIRL
PIRNAQGPQGPRGHQGLQGPRGYPGPPGPPGETTVVKQTDRKKLKKIAFF
AGLKENVVNEPSKNDYVIFDGLMTNFGNTYNNNTGEFTASVTGVYVFTVT
ISAQGGAKQAAVRLLHNKKHIMDIWSSSYPWATSTSQSILEIKKDDKVWL
QFREQAHFLHGYMYSTFSGYLLFELP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001073C1q_dom
IPR008983Tumour_necrosis_fac-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001073C1q domainPRINTSPR00007COMPLEMNTC1Qcoord: 182..203
score: 23.45
coord: 213..223
score: 55.64
coord: 110..136
score: 27.11
coord: 137..156
score: 34.8
IPR001073C1q domainSMARTSM00110C1Q_2coord: 90..225
e-value: 8.1E-15
score: 65.2
IPR001073C1q domainPFAMPF00386C1qcoord: 98..222
e-value: 5.1E-26
score: 91.4
IPR001073C1q domainPROSITEPS50871C1Qcoord: 92..226
score: 24.587
NoneNo IPR availableGENE3DG3DSA:1.20.5.320coord: 55..95
e-value: 1.0E-7
score: 33.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..66
NoneNo IPR availablePANTHERPTHR15427EMILIN ELASTIN MICROFIBRIL INTERFACE-LOCATED PROTEIN ELASTIN MICROFIBRIL INTERFACERcoord: 53..224
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.768
IPR008983Tumour necrosis factor-like domain superfamilyGENE3DG3DSA:2.60.120.40coord: 96..225
e-value: 2.2E-34
score: 120.4
IPR008983Tumour necrosis factor-like domain superfamilySUPERFAMILYSSF49842TNF-likecoord: 96..223